spacer  

ClustalW Results - LuxS més LuxS d'Archeae


Results of search
Number of sequences 61
Alignment score 748096
Sequence format Pearson
Sequence type aa
ClustalW version 1.83
JalView
Output file clustalw-20070602-23335575.output
Alignment file clustalw-20070602-23335575.aln
Guide tree file clustalw-20070602-23335575.dnd
Your input file clustalw-20070602-23335575.input

To save a result file right-click the file link in the above table and choose "Save Target As".
If you cannot see the JalView button, reload the page and check your browser settings to enable Java Applets.




Alignment

CLUSTAL W (1.83) multiple sequence alignment


LuxS_Borrelia_burgdorferi_NEGA      --------------MKK---ITSFTIDHTKLNP--GIYVSRKDTFENVIF 31
LuxS_Borrelia_garinii_NEGATIU       --------------MKK---ITSFTIDHTKLNP--GIYVSRKDTFENVIF 31
LuxS_Desulfotalea_psychrophila      --------------MEK---IASFTIDHTKLKR--GVYVSRQDKVAGNVI 31
LuxS_Clostridium_acetobutylicu      --------------MEK---IASFTVNHLTLQP--GVYVSRKDKFGDVVI 31
LuxS_Staphylococcus_aureus_sub      -------------MTKMN--VESFNLDHTKVVAPFIRLAGTMEGLNGDVI 35
LuxS_Staphylococcus_epidermidi      -------------MTKMN--VESFNLDHTKVVAPFIRLAGTMEGLNGDVI 35
LuxS_Listeria_monocytogenes_st      ------------MAEKMN--VESFNLDHTKVKAPFVRLAGTKVGVHGDEI 36
LuxS_Listeria_monocytogenes_PO      ------------MAEKMN--VESFNLDHTKVKAPFVRLAGTKVGVHGDEI 36
LuxS_Listeria_innocua_POSITIU       ------------MAEKMN--VESFNLDHTKVKAPFVRLAGTKVGVHGDEI 36
LuxS_Oceanobacillus_iheyensis_      ------------MTKKMN--VESFNLDHTKVKAPYVRLVGVTEGANGDKV 36
LuxS_Helicobacter_pylori_J99_N      --------------MKMN--VESFNLDHTKVKAPYVRIADRKKGVNGDLI 34
LuxS_Helicobacter_pylori_POSIT      -----------MKTPKMN--VESFNLDHTKVKAPYVRVADRKKGVNGDLI 37
LuxS_Propionibacterium_acnes_P      ------------MAHKMN--VESFNLDHTKVAAPFVRVADVKHLPAGDTL 36
LuxS_Bacillus_anthracis_POSITI      --------------MPS---VESFELDHTIVKAPYVRHCGVHNVGSDGIV 33
LuxS_Bacillus_cereus_ATCC14579      --------------MPS---VESFELDHTIVKAPYVRHCGVHNVGSDGIV 33
LuxS_Bacillus_subtilis_POSITIU      --------------MPS---VESFELDHNAVVAPYVRHCGVHKVGTDGVV 33
LuxS_Geobacillus_kaustophilus_      --------------MPSP--VESFELDHCAVKAPYVRHCGVHKVGSDGVV 34
LuxS_Bacillus_halodurans_POSIT      --------------MPT---VESFELDHTIVKAPFVRPCGTHKVGTNGEV 33
LuxS_Bacillus_clausii_POSITIU       --------------MPS---VESFELDHTIVKAPYVRHCGKHKIGSDGEV 33
LuxS_Deinococcus_radiodurans_P      -----------MPDMAN---VESFDLDHTKVKAPYVRLAGVKTTPKGDQI 36
LuxS_Thermus_thermophilus_HB27      --------------MAE---VESFSLDHTKVKAPYVRLAGRKALAGG-VV 32
LuxS_Lactobacillus_johnsonii_P      --------------MGK---VESFELDHTKVKAPYVRLITVEEGQKGDKI 33
LuxS_Lactobacillus_reuteri_POS      --------------MAK---VESFTLDHTKVKAPYVRLITVEEGAKGDKI 33
LuxS_Lactobacillus_plantarum_P      --------------MAK---VESFTLDHTKVLAPYVRKITVENGPKGDAI 33
LuxS_Streptococcus_gordonii_st      --------------MSKEVIVESFELDHTIVKAPYVRLIGEESGPKGDVI 36
LuxS_Streptococcus_pneumoniae_      --------------MSKEVIVESFELDHTIVKAPYVRLIGEETGPKGDII 36
LuxS_Streptococcus_mutans_POSI      --------------MTKEVTVESFELDHIAVKAPYVRLISEEFGPKGDLI 36
LuxS_Streptococcus_pyogenes_se      --------------MTKEVIVESFELDHTIVKAPYVRLISEEFGPKGDRI 36
LuxS_Streptococcus_agalactiae_      --------------MTKEVVVESFELDHTIVKAPYVRLISEEVGPVGDII 36
LuxS_Lactococcus_lactis_subsp_      --------------MAE---VESFQLDHTKVLAPYVRLIGSETGPKGDVI 33
LuxS_Enterococcus_faecalis_POS      --------------MAR---VESFELDHNTVKAPYVRLAGTEQNG-DALV 32
LuxS_Wolinella_succinogenes_NE      --------------MPL---LDSFKVDHTKMPAPAVRLAKTMTTPKGDEI 33
LuxS_Helicobacter_hepaticus_NE      --------------MPL---LDSFKVDHTKMPAPAVRLAKTMQTPKGDTI 33
LuxS_Campylobacter_jejuni_NEGA      --------------MPL---LDSFKVDHTKMPAPAVRLAKVMKTPKGDDI 33
LuxS_Campylobacter_jejuni_RM12      --------------MPL---LDSFKVDHTKMPAPAVRLAKVMKTPKGDDI 33
LuxS_2Neisseria_meningitidis_s      --------------MPL---LDSFKVDHTRMHAPAVRVAKTMTTPKGDTI 33
LuxS_Neisseria_meningitidis_se      --------------MPL---LDSFKVDHTRMHAPAVRVAKTMTTPKGDTI 33
LuxS_Haemophilus_influenzae_NE      --------------MPL---LDSFKVDHTKMNAPAVRIAKTMLTPKGDNI 33
LuxS_Mannheimia_succiniciprodu      --------------MPL---LDSFKVDHTVMKAPAVRVAKIMRTPKGDDI 33
LuxS_Pasteurella_multocida_NEG      --------------MPL---LDSFKVDHTRMKAPAVRIAKTMTTPKGDNI 33
LuxS_Vibrio_alginolyticus_NEGA      --------------------------------------------------
LuxS_Vibrio_parahaemolyticus_N      --------------MPL---LDSFTVDHTRMNAPAVRVAKTMQTPKGDTI 33
LuxS_Vibrio_harveyi_NEGATIU         --------------MPL---LDSFTVDHTRMNAPAVRVAKTMQTPKGDTI 33
LuxS_Vibrio_vulnificus_NEGATIU      --------------MPL---LDSFTVDHTRMHAPAVRVAKTMQTPKGDTI 33
LuxS_Vibrio_cholerae_NEGATIU        --------------MPL---LDSFTVDHTRMNAPAVRVAKTMQTPKGDTI 33
LuxS_Photobacterium_profundum_      --------------MPL---LDSFTVDHTRMNAPAVRVAKTMQTPKGDTI 33
LuxS_Shewanella_oneidensis_POS      --------------MPL---LDSFTVDHTRMNAPAVRVAKHMTTPKGDAI 33
LuxS_Escherichia_coli_NEGATIU       --------------MPL---LDSFTVDHTRMEAPAVRVAKTMNTPHGDAI 33
LuxS_Escherichia_coli_O157_H7_      --------------MPL---LDSFTVDHTRMEAPAVRVAKTMNTPHGDAI 33
LuxS_Shigella_flexneri_NEGATIU      --------------MPL---LDSFTVDHTRMEAPAVRVAKTMNTPHGDAI 33
LuxS_Escherichia_coli_O6_NEGAT      --------------MPL---LDSFTVDHTRMEAPAVRVAKTMNTPHGDAI 33
LuxS_Salmonella_typhimurium_NE      --------------MPL---LDSFAVDHTRMQAPAVRVAKTMNTPHGDAI 33
LuxS_Salmonella_typhi_NEGATIU       --------------MPL---LDSFAVDHTRMQAPAVRGAKTMNTPHGDAI 33
LuxS_Serratia_marcescens_NEGAT      --------------MPL---LDSFTVDHTRMAAPAVRVAKTMKTPHGDTI 33
LuxS_Yersinia_pestis_NEGATIU        --------------MPL---LDSFTVDHTIMKAPAVRVAKTMKTPHGDEI 33
LuxS_Pectobacterium_atroseptic      --------------MPL---LDSFTVDHTRMAAPAVRVAKTMKTPHGDNI 33
LuxS_Photorhabdus_luminescens_      --------------MPL---LDSFTVDHTRMNAPAVRVAKTMKTPHGDTI 33
LuxS_Proteus_mirabilis_NEGATIU      --------------MPL---LDSFTVDHTRMSAPAVRVAKTMKTPSGDTI 33
LuxS_Haemophilus_ducreyi_NEGAT      --------------MPL---LDSFKVDHTRMNAPAVRVAKTITTPKGDLI 33
LuxS_Clostridium_perfringens_P      --------------MVK---VESFELDHTKVKAPYVRKAGIKIGPKGDIV 33
LuxS_Archeae_Haloferax_volcani      MDSAVLLDLLGNENRRRILRLLSHKPCYVTEISEYLGVSPKAVIDHLRKL 50
                                                                                      

LuxS_Borrelia_burgdorferi_NEGA      TTIDIRIKAPNIEP--IIENAAIHTIEHIGATLLRNNEVWT--EKIVYFG 77
LuxS_Borrelia_garinii_NEGATIU       TTIDIRIKAPNIEP--IIENAAIHTIEHIGATLLRNNEVWT--EKIVYFG 77
LuxS_Desulfotalea_psychrophila      TTFDLRLKEPNNEP--ALDGAASHTIEHIGATFLRNHKTWA--DRTIYFG 77
LuxS_Clostridium_acetobutylicu      TTFDIRMTSPNEEP--VMNTAEVHTIEHLGATFLRNHGTYA--EKTVYFG 77
LuxS_Staphylococcus_aureus_sub      HKYDIRFKQPNKE---HMDMPGLHSLEHLMAENIRNHSD-----KVVDLS 77
LuxS_Staphylococcus_epidermidi      HKYDIRFKQPNKE---HMDMPGLHSLEHLMAENIRNHTD-----KVVDLS 77
LuxS_Listeria_monocytogenes_st      YKYDVRFKQPNKE---HMEMPALHSLEHLMAELARNHTD-----KLVDIS 78
LuxS_Listeria_monocytogenes_PO      YKYDVRFKQPNKE---HMEMPALHSLEHLMAELARNHTD-----KLVDIS 78
LuxS_Listeria_innocua_POSITIU       YKYDVRFKQPNKE---HMEMPALHSLEHLMAELARNHTD-----KLVDIS 78
LuxS_Oceanobacillus_iheyensis_      HKYDIRIKQPNKA---HMEMPGLHSLEHLMAENIRNHSD-----AVLDIG 78
LuxS_Helicobacter_pylori_J99_N      VKYDVRFKQPNRD---HMDMPSLHSLEHLVAEIIRNHAN-----YVVDWS 76
LuxS_Helicobacter_pylori_POSIT      VKYDVRFKQPNQD---HMDMPSLHSLEHLVAEIIRNHAS-----YVVDWS 79
LuxS_Propionibacterium_acnes_P      TKYDVRFCQPNKE---HLDMPAVHSLEHSFAECVRNHSD-----AVIDFG 78
LuxS_Bacillus_anthracis_POSITI      NKFDIRFCQPNKQ---AMKPDVIHTLEHLLAFNLRKYIDRYPHFDIIDIS 80
LuxS_Bacillus_cereus_ATCC14579      NKFDIRFCQPNKQ---AMKPDVIHTLEHLLAFNLRKYIDRYPHFDIIDIS 80
LuxS_Bacillus_subtilis_POSITIU      NKFDIRFCQPNKQ---AMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDIS 80
LuxS_Geobacillus_kaustophilus_      NKFDIRFCQPNKE---AMDPAAIHTLEHLLAYTLRRHAAKYDHFDIIDIS 81
LuxS_Bacillus_halodurans_POSIT      NKFDIRFFQPNKQ---AMKPDVIHTLEHLLALNIRKFAEAYDHFDVIDLS 80
LuxS_Bacillus_clausii_POSITIU       NKFDIRFCQPNKE---ALKPGVIHTLEHLLAINIRRFSEEYDHFDVIDIS 80
LuxS_Deinococcus_radiodurans_P      SKYDLRFLQPNQG---AIDPAAIHTLEHLLAGYMRDHLEG-----VVDVS 78
LuxS_Thermus_thermophilus_HB27      EKYDLRLAQPNRE---ALPTGALHTLEHLLAGYLRDHLPG-----VIDLS 74
LuxS_Lactobacillus_johnsonii_P      SNFDLRLVQPNEN---AIPTGGLHTIEHLLAGLLRDRIDG-----YIDCS 75
LuxS_Lactobacillus_reuteri_POS      SNYDLRLVQPNEN---AIPTAGLHTIEHLLAGLLRDRLDG-----VIDCS 75
LuxS_Lactobacillus_plantarum_P      TNFDLRLVQPNKT---AIDTAGLHTIEHMLAGLLRDRMDG-----VIDCS 75
LuxS_Streptococcus_gordonii_st      SNFDIRLVQPNED---SIPTAGLHTIEHLLAMLIRKRIDG-----MIDCS 78
LuxS_Streptococcus_pneumoniae_      SNYDIRLVQPNED---SIPTAGLHTIEHLLAKLIRTRIDG-----MIDCS 78
LuxS_Streptococcus_mutans_POSI      TNFDIRLVQPNED---SIPTAGLHTIEHLLAKLIRQRIDG-----MIDCS 78
LuxS_Streptococcus_pyogenes_se      TNFDVRLVQPNQN---SIETAGLHTIEHLLAKLIRQRIDG-----MIDCS 78
LuxS_Streptococcus_agalactiae_      TNFDIRLIQPNEN---AIDTAGLHTIEHLLAKLIRQRING-----LIDCS 78
LuxS_Lactococcus_lactis_subsp_      TNFDVRFVQPNAN---AIGMAALHTIEHSMASLIRDRIDG-----MIDFS 75
LuxS_Enterococcus_faecalis_POS      EKYDLRFLQPNKD---ALPTGALHTLEHLLAVNMRDELKG-----IIDIS 74
LuxS_Wolinella_succinogenes_NE      AVFDLRFCRPNQE---ILSEKGIHTLEHLFAGFMREHLNGE-GIEIIDIS 79
LuxS_Helicobacter_hepaticus_NE      SVFDLRFTRPNCE---LLSEKGIHTMEHLIAGFMREHLNNT-RVEIIDIS 79
LuxS_Campylobacter_jejuni_NEGA      SVFDLRFCIPNKD---IMSEKGTHTLEHLFAGFMRDHLNSN-SVEIIDIS 79
LuxS_Campylobacter_jejuni_RM12      SVFDLRFCIPNKD---IMSEKGTHTLEHLFAGFMRDHLNSN-SVEIIDIS 79
LuxS_2Neisseria_meningitidis_s      TVFDLRFCVPNKE---ILPEKGIHTLEHLFAGFMRDHLNGN-GVEIIDIS 79
LuxS_Neisseria_meningitidis_se      TVFDLRFCVPNKE---ILPGKGIHTLEHLFAGFMRDHLNGN-GVEIIDIS 79
LuxS_Haemophilus_influenzae_NE      TVFDLRFCIPNKE---ILSPKGIHTLEHLFAGFMRDHLNGD-SIEIIDIS 79
LuxS_Mannheimia_succiniciprodu      TVFDLRFCVPNKE---ILSPKGIHTLEHLFAGFMREHLNGD-SVEIIDIS 79
LuxS_Pasteurella_multocida_NEG      TVFDLRFCIPNKE---ILSPKGIHTLEHLFAGFMRDHLNGT-EVEIIDIS 79
LuxS_Vibrio_alginolyticus_NEGA      ----------------------------------------D-SVEIIDIS 9
LuxS_Vibrio_parahaemolyticus_N      TVFDLRFTAPNKD---ILSEKGIHTLEHLYAGFMRNHLNGD-SVEIIDIS 79
LuxS_Vibrio_harveyi_NEGATIU         TVFDLRFTAPNKD---ILSEKGIHTLEHLYAGFMRNHLNGD-SVEIIDIS 79
LuxS_Vibrio_vulnificus_NEGATIU      TVFDLRFTAPNKD---ILSEKGIHTLEHLYAGFMRKHLNGA-SVEIIDIS 79
LuxS_Vibrio_cholerae_NEGATIU        TVFDLRFTMPNKD---ILSERGIHTLEHLYAGFMRNHLNGS-QVEIIDIS 79
LuxS_Photobacterium_profundum_      TVFDLRFCRPNMD---ILSERGIHTLEHLYAGFMRNHLNSE-RVEIIDIS 79
LuxS_Shewanella_oneidensis_POS      TVFDLRFCAPNKD---ILSERGIHTLEHLFAGFMRDHLNGD-DVEIIDIS 79
LuxS_Escherichia_coli_NEGATIU       TVFDLRFCVPNKE---VMPERGIHTLEHLFAGFMRNHLNGN-GVEIIDIS 79
LuxS_Escherichia_coli_O157_H7_      TVFDLRFCVPNKE---VMPERGIHTLEHLFAGFMRNHLNGN-GVEIIDIS 79
LuxS_Shigella_flexneri_NEGATIU      TVFDLRFCVPNKE---VMPERGIHTLEHLFAGFMRNHLNGN-GVEIIDIS 79
LuxS_Escherichia_coli_O6_NEGAT      TVFDLRFCVPNKE---VMPERGIHTLEHLFAGFMRNHLNGN-GVEIIDIS 79
LuxS_Salmonella_typhimurium_NE      TVFDLRFCIPNKE---VMPEKGIHTLEHLFAGFMRDHLNGN-GVEIIDIS 79
LuxS_Salmonella_typhi_NEGATIU       TVFDLRFCIPNKE---VMPEKGIHTLEHLFAGFMRDHLNGN-GVEIIDIS 79
LuxS_Serratia_marcescens_NEGAT      TVFDLRFCRPNLE---VMPERGIHTLEHLFAGFMRDHLNGQ-GVEIIDIS 79
LuxS_Yersinia_pestis_NEGATIU        TVFDLRFCVPNKE---VMPEKGIHTLEHLFAGFMRDHLNGD-GVEIIDIS 79
LuxS_Pectobacterium_atroseptic      TVFDLRFCRPNIE---VMPERGIHTLEHLFAGFMRDHLNGD-GVEIIDIS 79
LuxS_Photorhabdus_luminescens_      TVFDLRFCIPNKQ---VMPEKGIHTLEHLFAGFMRNHLNGE-GVEIIDIS 79
LuxS_Proteus_mirabilis_NEGATIU      TVFDLRFTVPNKK---AMPEKGIHTLEHLFAGFMRNHLNGE-GVEIIDIS 79
LuxS_Haemophilus_ducreyi_NEGAT      TVFDLRFCRPNME---IMSSKGIHTLEHLYAGFMRDHLNSD-KVEIIDIS 79
LuxS_Clostridium_perfringens_P      SKFDLRFVQPNKE---LLSDKGMHTLEHFLAGFMREKLD-----DVIDIS 75
LuxS_Archeae_Haloferax_volcani      EDAGLIESRTDDQRRKYFHISRNLRLEVNVSPYGFGAKSAYPPSPSLDMA 100
                                                                                  :  .

LuxS_Borrelia_burgdorferi_NEGA      PMGCRTGFYLIIFGDYESKDLVDLV-----------------SWLFSEIV 110
LuxS_Borrelia_garinii_NEGATIU       PMGCRTGFYLIIFGNYESKDLIDLI-----------------SWLFSEIV 110
LuxS_Desulfotalea_psychrophila      PMGCQTGFYLILAGDWKAKDIVPLM-----------------QEMFAYVA 110
LuxS_Clostridium_acetobutylicu      PMGCRTGFYLILQGDYTSNDIVPLL-----------------REMYKFIA 110
LuxS_Staphylococcus_aureus_sub      PMGCQTGFYVSFINHDNYDDVLNIV-----------------EATLNDVL 110
LuxS_Staphylococcus_epidermidi      PMGCQTGFYVSFINHDDYDDVLNII-----------------DQTLHDVL 110
LuxS_Listeria_monocytogenes_st      PMGCQTGFYVSFINHSDYDDALEII-----------------ATTLTDVL 111
LuxS_Listeria_monocytogenes_PO      PMGCQTGFYVSFINHSDYDDALEII-----------------ATTLTDVL 111
LuxS_Listeria_innocua_POSITIU       PMGCQTGFYMSFINHNDYDDALEIL-----------------ATTLTDVL 111
LuxS_Oceanobacillus_iheyensis_      PMGCQTGFYLSLINHDDYDDVLTMI-----------------EKTLEDVL 111
LuxS_Helicobacter_pylori_J99_N      PMGCQTGFYLTVLNHDNYTEILEVL-----------------EKTMQDVL 109
LuxS_Helicobacter_pylori_POSIT      PMGCQTGFYLTVLNHDNYTEILEVL-----------------EKTMQDVL 112
LuxS_Propionibacterium_acnes_P      PMGCQTGFYLIMIGEPDVSGTCELV-----------------ETTLRDIL 111
LuxS_Bacillus_anthracis_POSITI      PMGCQTGYYLVVSGTPTVREIIDLL-----------------ELTLKDAV 113
LuxS_Bacillus_cereus_ATCC14579      PMGCQTGYYLVVSGTPTVREIIDLL-----------------ELTLKDAV 113
LuxS_Bacillus_subtilis_POSITIU      PMGCQTGYYLVVSGEPTSAEIVDLL-----------------EDTMKEAV 113
LuxS_Geobacillus_kaustophilus_      PMGCQTGFYLVVSGSPTVDEIIDLL-----------------EEAMKDAL 114
LuxS_Bacillus_halodurans_POSIT      PMGCQTGFYLIMSGKPTVEEIIDVL-----------------EQTMKYSL 113
LuxS_Bacillus_clausii_POSITIU       PMGCQTGYYLIMSGTPSVEEIIDVL-----------------EKTMTYSL 113
LuxS_Deinococcus_radiodurans_P      PMGCRTGMYMAVIGEPDEQGVMKAF-----------------EAALKDTA 111
LuxS_Thermus_thermophilus_HB27      PMGCRTGFYLVVEGPVGEEKVLEAF-----------------AQALKDVL 107
LuxS_Lactobacillus_johnsonii_P      PFGCRTGFHLLVWGTPSTTDVAKAL-----------------KESLEEIR 108
LuxS_Lactobacillus_reuteri_POS      PFGCRTGFHLITWGEHSTTEVAKAL-----------------KSSLEEIA 108
LuxS_Lactobacillus_plantarum_P      PFGCRTGFHLITWGEHDTVEVAKAL-----------------KSSLEFIA 108
LuxS_Streptococcus_gordonii_st      PFGCRTGFHMIMWGRHTPSEIAQVI-----------------KSCLEEIA 111
LuxS_Streptococcus_pneumoniae_      PFGCRTGFHMIMWGRHTSAKIAAVI-----------------KDSLKEIA 111
LuxS_Streptococcus_mutans_POSI      PFGCRTGFHLIMWGKHTTTQIATVI-----------------KASLEEIA 111
LuxS_Streptococcus_pyogenes_se      PFGCRTGFHLIMWGKHSSTDIAKVI-----------------KSSLEEIA 111
LuxS_Streptococcus_agalactiae_      PFGCRTGFHMIMWGKQDATEIAKVI-----------------KSSLEAIA 111
LuxS_Lactococcus_lactis_subsp_      PFGCQTGFHMIMWGEHSSEEIAKVI-----------------KSSLEELA 108
LuxS_Enterococcus_faecalis_POS      PMGCRTGFYMIMWDQHSPQEIRDAL-----------------VNVLNKVI 107
LuxS_Wolinella_succinogenes_NE      PMGCRTGFYMSLIGVPKNARVLEAW-----------------RRSMEDIL 112
LuxS_Helicobacter_hepaticus_NE      PMGCRTGFYMSVVGAPNEYNVKEAW-----------------ESSMRDVL 112
LuxS_Campylobacter_jejuni_NEGA      PMGCRTGFYMSLIGTPDEKSIAKAW-----------------EAAMKDVL 112
LuxS_Campylobacter_jejuni_RM12      PMGCRTGFYMSLIGTPDEKSVAKAW-----------------EEAMKDVL 112
LuxS_2Neisseria_meningitidis_s      PMGCRTGFYMSLIGTPSEQQVADAW-----------------LASMQDVL 112
LuxS_Neisseria_meningitidis_se      PMGCRTGFYMSLIGTPSEQQVADAW-----------------LASMQDVL 112
LuxS_Haemophilus_influenzae_NE      PMGCRTGFYMSLIGTPNEQKVSEAW-----------------LASMQDVL 112
LuxS_Mannheimia_succiniciprodu      PMGCRTGFYMSLIGTPNEQQVADAW-----------------LASMRDVL 112
LuxS_Pasteurella_multocida_NEG      PMGCRTGFYMSLIGTPNEQQVADAW-----------------LASMRDVL 112
LuxS_Vibrio_alginolyticus_NEGA      PMGCRTGFYMSLIGTPSEQQVADAW-----------------IAAMEDVL 42
LuxS_Vibrio_parahaemolyticus_N      PMGCRTGFYMSLIGTPSEQQVADAW-----------------LASMEDVL 112
LuxS_Vibrio_harveyi_NEGATIU         PMGCRTGFYMSLIGTPSEQQVADAW-----------------IAAMEDVL 112
LuxS_Vibrio_vulnificus_NEGATIU      PMGCRTGFYMSLIGAPSEQDVASAW-----------------TASMEDVL 112
LuxS_Vibrio_cholerae_NEGATIU        PMGCRTGFYMSLIGAPTEQQVAQAW-----------------LAAMQDVL 112
LuxS_Photobacterium_profundum_      PMGCRTGFYMSLIGTPSEQDVAAGW-----------------TAAMEDVL 112
LuxS_Shewanella_oneidensis_POS      PMGCRTGFYMSLIGVPTERQVADAW-----------------LASMEDVL 112
LuxS_Escherichia_coli_NEGATIU       PMGCRTGFYMSLIGTPDEQRVADAW-----------------KAAMEDVL 112
LuxS_Escherichia_coli_O157_H7_      PMGCRTGFYMSLIGTPDEQRVADVW-----------------KAAMEDVL 112
LuxS_Shigella_flexneri_NEGATIU      PMGCRTGFYMSLIGTPDEQRVADAW-----------------KAAMEDVL 112
LuxS_Escherichia_coli_O6_NEGAT      PMGCRTGFYMSLIGTPDEQRVADAW-----------------KAAMEDVL 112
LuxS_Salmonella_typhimurium_NE      PMGCRTGFYMSLIGTPDEQRVADAW-----------------KAAMADVL 112
LuxS_Salmonella_typhi_NEGATIU       PMGCRTGFYMSLIGTPDEQRVADAW-----------------KAAMADVL 112
LuxS_Serratia_marcescens_NEGAT      PMGCRTGFYMSLIGVPEEQRVADAW-----------------KAAMADVL 112
LuxS_Yersinia_pestis_NEGATIU        PMGCRTGFYMSLIGTPDEQRVADAW-----------------KAAMADVL 112
LuxS_Pectobacterium_atroseptic      PMGCRTGFYMSLIGTPDEQRVAESW-----------------KAAMSDVL 112
LuxS_Photorhabdus_luminescens_      PMGCRTGFYMSLIGEPAEVRVADAW-----------------KAAMADVL 112
LuxS_Proteus_mirabilis_NEGATIU      PMGCRTGFYMSLIGQPDEQRVANAW-----------------KAAMEDVL 112
LuxS_Haemophilus_ducreyi_NEGAT      PMGCRTGFYMSLIGEPSAQAVANAW-----------------KNAMHDIL 112
LuxS_Clostridium_perfringens_P      PMGCKTGFYLTSFGDIDVKDIIEAL-----------------EYSLSKVL 108
LuxS_Archeae_Haloferax_volcani      GRCPHVTLEVENAGTDDVSELARELGKLEELDNELSLAQRWVQGRITDVL 150
                                        :.   :   .                                    

LuxS_Borrelia_burgdorferi_NEGA      ---NFSEPIPGAS--------DKECGNYKEHNLDMAK-YESSKYLQILNN 148
LuxS_Borrelia_garinii_NEGATIU       ---NFSEPIPGAS--------HKECGNYKDHNLDMAK-YESSKYLQILNN 148
LuxS_Desulfotalea_psychrophila      ---QFTGTIPGES--------AVECGNFRFMDLIQAKEEAGKYFTEVLDN 149
LuxS_Clostridium_acetobutylicu      ---DFKGEVPGAA--------ARDCGNYLDMNLPMAN-YWGKKFSALLDN 148
LuxS_Staphylococcus_aureus_sub      ----NATEVPACN--------EVQCGWAASHSLEGAKTIAQAFLDK-RNE 147
LuxS_Staphylococcus_epidermidi      ----NASEVPACN--------EVQCGWAASHSLEGAKTIAQAFLDK-REQ 147
LuxS_Listeria_monocytogenes_st      ----AATEVPACN--------EVQCGWAASHSLEGAKALAAEFLDK-RDE 148
LuxS_Listeria_monocytogenes_PO      ----VATEVPACN--------EVQCGWAASHSLEGAKALAEEFLAK-RSE 148
LuxS_Listeria_innocua_POSITIU       ----AADSVPACN--------EVQCGWAASHSLEGAKELAEEFLAK-RSE 148
LuxS_Oceanobacillus_iheyensis_      ----QATEVPACN--------EVQCGWAANHSLLGAQEIAKEMLNE-KAS 148
LuxS_Helicobacter_pylori_J99_N      ----KAKEVPASN--------EKQCGWAANHTLEGAQNLARAFLDK-RAE 146
LuxS_Helicobacter_pylori_POSIT      ----KATEVPASN--------EKQCGWAANHTLEGAKDLARAFLDK-RAE 149
LuxS_Propionibacterium_acnes_P      ----KLNTTPAAN--------EVQCGWGANHSIKAAQEAAHTMLNH-RDE 148
LuxS_Bacillus_anthracis_POSITI      ----QITEIPAAN--------ETQCGQAKLHDLEGAKRLMNFWLSQDKDE 151
LuxS_Bacillus_cereus_ATCC14579      ----QITEIPAAN--------ETQCGQAKLHDLEGAQRLMNFWLSQDKDE 151
LuxS_Bacillus_subtilis_POSITIU      ----EITEIPAAN--------EKQCGQAKLHDLEGAKRLMRFWLSQDKEE 151
LuxS_Geobacillus_kaustophilus_      ----AATEVPAAT--------ERQCGQAKLHDLEAAKQLMRFWLSQEKEE 152
LuxS_Bacillus_halodurans_POSIT      ----ELEEVPAAN--------EKQCGQAKLHDLDGAKKLMTYWLSHEKDS 151
LuxS_Bacillus_clausii_POSITIU       ----SIETVPAAT--------EKECGQAALHDLEGTKEVMRKWLSEDKGS 151
LuxS_Deinococcus_radiodurans_P      GHDQ---PIPGVS--------ELECGNYRDHDLAAARQHARDVLDQGLKV 150
LuxS_Thermus_thermophilus_HB27      AHEG---EVPGAS--------FRECGNYRDHDLPGAKAWAEKVLKAGLRV 146
LuxS_Lactobacillus_johnsonii_P      DNIT-WEDVPGTT--------IESCGNYRDHSLFSAKQWSRDILEKGISD 149
LuxS_Lactobacillus_reuteri_POS      YKTK-WEDVQGTT--------IESCGNYRDHSLFSAKEWSKKILDEGISD 149
LuxS_Lactobacillus_plantarum_P      GPAK-WEDVQGTT--------IDSCGNYKDHSLFSAKEWAKLILSQGISS 149
LuxS_Streptococcus_gordonii_st      ETTT-WEDVPGTT--------IESCGNYKDHSLFSAKEWAKLILKQGISD 152
LuxS_Streptococcus_pneumoniae_      ETTT-WEDVPGTT--------IESCGNYKDHSLFSAKEWAKLILEQGISD 152
LuxS_Streptococcus_mutans_POSI      NTIS-WKDVPGTT--------IESCGNYKDHSLFSAKEWAKLILKQGISD 152
LuxS_Streptococcus_pyogenes_se      TGIT-WEDVPGTT--------LESCGNYKDHSLFAAKEWAQLIIDQGISD 152
LuxS_Streptococcus_agalactiae_      GGVT-WEDVPGTT--------IESCGNYKDHSLHSAQEWAKLILSQGISD 152
LuxS_Lactococcus_lactis_subsp_      SDEFGWDNVPGVA--------EKECGNYRNHSLFGAKEWSKKILSEGIST 150
LuxS_Enterococcus_faecalis_POS      NTEV----VPAVS--------AKECGNYKDHSLFAAKEYAKIVLDQGISL 145
LuxS_Wolinella_succinogenes_NE      -TLKSEEEIPELN--------IYQCGTACMHSLKEAQEIARTVLDRGISI 153
LuxS_Helicobacter_hepaticus_NE      -RICDEKDIPELN--------IYQCGTAKMHSLKEAQDIAQVVLDKGVSV 153
LuxS_Campylobacter_jejuni_NEGA      -SVSDQSKIPELN--------IYQCGTCAMHSLDEAKQIAQKVLNLGISI 153
LuxS_Campylobacter_jejuni_RM12      -SVSDQSKIPELN--------IYQCGTCAMHSLDEAKQIAQKVLNLGISI 153
LuxS_2Neisseria_meningitidis_s      -NVKDQSKIPELN--------EYQCGTYQMHSLAEAQQIAQNVLARKVAV 153
LuxS_Neisseria_meningitidis_se      -NVKDQSKIPELN--------EYQCGTYQMHSLAEAQQIAQNVLARKVAV 153
LuxS_Haemophilus_influenzae_NE      -GVQDQASIPELN--------IYQCGSYTEHSLEDAHEIAKNVIARGIGV 153
LuxS_Mannheimia_succiniciprodu      -TVQDQSTIPELN--------IYQCGTYTEHSLADAHETARHVIEKGIAI 153
LuxS_Pasteurella_multocida_NEG      -LVKDQAQIPELN--------AFQCGTYTEHSLAEAQQIAHNVLERGVSV 153
LuxS_Vibrio_alginolyticus_NEGA      -KVESQNKIPELN--------EYQCGTAAMHSLKEAQQIAKNILDAGVSV 83
LuxS_Vibrio_parahaemolyticus_N      -KVESQNKIPELN--------EYQCGTAAMHSLEEAQQIAKNILAAGVSV 153
LuxS_Vibrio_harveyi_NEGATIU         -KVENQNKIPELN--------EYQCGTAAMHSLDEAKQIAKNILEVGVAV 153
LuxS_Vibrio_vulnificus_NEGATIU      -KVESQNKIPELN--------EYQCGTAAMHSLDEAKQIAQNILAAGISV 153
LuxS_Vibrio_cholerae_NEGATIU        -KVESQEQIPELN--------EYQCGTAAMHSLEEAKAIAKNVIAAGISV 153
LuxS_Photobacterium_profundum_      -NVESQDQIPELN--------EYQCGTYSMHSLEEAKDIAKTILAEGINV 153
LuxS_Shewanella_oneidensis_POS      -KVVEQSEIPELN--------EYQCGTYEMHSLEQAQDIARNIIAAGVSV 153
LuxS_Escherichia_coli_NEGATIU       -KVQDQNQIPELN--------VYQCGTYQMHSLQEAQDIARSILERDVRI 153
LuxS_Escherichia_coli_O157_H7_      -KVQDQNQIPELN--------VYQCGTYQMHSLQEAQDIARSILERDVRI 153
LuxS_Shigella_flexneri_NEGATIU      -KVQDQNQIPELN--------VYQCGTYQMHSLQEAQDIARSILEREVRI 153
LuxS_Escherichia_coli_O6_NEGAT      -KVQDQNQIPELN--------VYQCGTYQMHSLQEAQDIARNILERDVRI 153
LuxS_Salmonella_typhimurium_NE      -KVQDQNQIPELN--------VYQCGTYQMHSLSEAQDIARHILERDVRV 153
LuxS_Salmonella_typhi_NEGATIU       -KVQDQNQIPELN--------VYQCGTYQMHSLSEAQDIARHILERDVRV 153
LuxS_Serratia_marcescens_NEGAT      -KVTDQRKIPELN--------EYQCGTYHMHSLEEAQEIAKHILDNGVVV 153
LuxS_Yersinia_pestis_NEGATIU        -KVTDQRKIPELN--------EYQCGTYHMHSLEEAQSIAKDILDRDVRI 153
LuxS_Pectobacterium_atroseptic      -KVTDQRKIPELN--------EYQCGTYDMHSLKEAQEIAQHIVDHDIGI 153
LuxS_Photorhabdus_luminescens_      -KVKDQSQIPELN--------IYQCGTYHMHSLTEAQDIAHHILDSDVLV 153
LuxS_Proteus_mirabilis_NEGATIU      -KVKDQNHIPELN--------VYQCGTYEMHSLAEAQDIARDILSHTIGI 153
LuxS_Haemophilus_ducreyi_NEGAT      TKVSDVTQIPELN--------IYQCGTFSEHSLEDAHQIARDVLAKGISV 154
LuxS_Clostridium_perfringens_P      ----EQEEIPAAN--------ELQCGSAKLHSLELAKSHAKQVLENGISD 146
LuxS_Archeae_Haloferax_volcani      DRLNDRLGVDADSRFYAEILAALANGSNTVRGIAKELNADPAVVDSALHH 200
                                                             *      :                 

LuxS_Borrelia_burgdorferi_NEGA      IKEENLKYP---------- 157
LuxS_Borrelia_garinii_NEGATIU       IKEENLKYP---------- 157
LuxS_Desulfotalea_psychrophila      IAEKNLSYPS--------- 159
LuxS_Clostridium_acetobutylicu      ISEDRLNYPE--------- 158
LuxS_Staphylococcus_aureus_sub      WHDVFGTGK---------- 156
LuxS_Staphylococcus_epidermidi      WNDIYGEGK---------- 156
LuxS_Listeria_monocytogenes_st      WKNVFGE------------ 155
LuxS_Listeria_monocytogenes_PO      WKNVFGE------------ 155
LuxS_Listeria_innocua_POSITIU       WKNVFGE------------ 155
LuxS_Oceanobacillus_iheyensis_      WSEVF-------------- 153
LuxS_Helicobacter_pylori_J99_N      WSEVGV------------- 152
LuxS_Helicobacter_pylori_POSIT      WSEVGV------------- 155
LuxS_Propionibacterium_acnes_P      WEQVMA------------- 154
LuxS_Bacillus_anthracis_POSITI      LEKVFG------------- 157
LuxS_Bacillus_cereus_ATCC14579      LEKVFG------------- 157
LuxS_Bacillus_subtilis_POSITIU      LLKVFG------------- 157
LuxS_Geobacillus_kaustophilus_      LKKVFG------------- 158
LuxS_Bacillus_halodurans_POSIT      LTKVFES------------ 158
LuxS_Bacillus_clausii_POSITIU       LKQVF-------------- 156
LuxS_Deinococcus_radiodurans_P      QETILLER----------- 158
LuxS_Thermus_thermophilus_HB27      QATVPLEAR---------- 155
LuxS_Lactobacillus_johnsonii_P      DPFERHVVE---------- 158
LuxS_Lactobacillus_reuteri_POS      KPFERHVVD---------- 158
LuxS_Lactobacillus_plantarum_P      DPFVRKVVE---------- 158
LuxS_Streptococcus_gordonii_st      NAFERHVI----------- 160
LuxS_Streptococcus_pneumoniae_      DAFERHVI----------- 160
LuxS_Streptococcus_mutans_POSI      DPFERHLV----------- 160
LuxS_Streptococcus_pyogenes_se      DPFSRHVI----------- 160
LuxS_Streptococcus_agalactiae_      NAFERHIV----------- 160
LuxS_Lactococcus_lactis_subsp_      DPYERKVI----------- 158
LuxS_Enterococcus_faecalis_POS      DPFERIL------------ 152
LuxS_Wolinella_succinogenes_NE      MDNEALKLQL--------- 163
LuxS_Helicobacter_hepaticus_NE      MNTQELLLKDFA------- 165
LuxS_Campylobacter_jejuni_NEGA      INNKELKLENA-------- 164
LuxS_Campylobacter_jejuni_RM12      MNNKELKLENA-------- 164
LuxS_2Neisseria_meningitidis_s      NKNEELTLDEGLLNA---- 168
LuxS_Neisseria_meningitidis_se      NKNEELTLDEGLLNA---- 168
LuxS_Haemophilus_influenzae_NE      NKNEDLSLDNSLLK----- 167
LuxS_Mannheimia_succiniciprodu      NKNEDLLLDEKLLNL---- 168
LuxS_Pasteurella_multocida_NEG      NKNEDLLLDEQLLSL---- 168
LuxS_Vibrio_alginolyticus_NEGA      NKNDELALPESMLKELRID 102
LuxS_Vibrio_parahaemolyticus_N      NKNDELALPESMLKELRVD 172
LuxS_Vibrio_harveyi_NEGATIU         NKNDELALPESMLRELRID 172
LuxS_Vibrio_vulnificus_NEGATIU      NKNDELALPEAMLKELKVD 172
LuxS_Vibrio_cholerae_NEGATIU        NRNDELALPESMLNELKVH 172
LuxS_Photobacterium_profundum_      NKNDELALPESMLKELDVK 172
LuxS_Shewanella_oneidensis_POS      NRNDDLKLSDEILGKL--- 169
LuxS_Escherichia_coli_NEGATIU       NSNEELALPKEKLQELHI- 171
LuxS_Escherichia_coli_O157_H7_      NSNEELALPKEKLQELHI- 171
LuxS_Shigella_flexneri_NEGATIU      NSNEELALPKEKLQELHI- 171
LuxS_Escherichia_coli_O6_NEGAT      NSNEELALPKEKLQELHI- 171
LuxS_Salmonella_typhimurium_NE      NSNKELALPKEKLQELHI- 171
LuxS_Salmonella_typhi_NEGATIU       NSNKELALPKEKLQELHI- 171
LuxS_Serratia_marcescens_NEGAT      NHNDELALPKEKLQELHI- 171
LuxS_Yersinia_pestis_NEGATIU        NHNEELALPKEKLTELHI- 171
LuxS_Pectobacterium_atroseptic      NQNDDLALPKDKLAELHI- 171
LuxS_Photorhabdus_luminescens_      NKNDELALPEEKLTELKV- 171
LuxS_Proteus_mirabilis_NEGATIU      NHNDELALPEDKLKELQI- 171
LuxS_Haemophilus_ducreyi_NEGAT      NLNEDLTLDEEWLNR---- 169
LuxS_Clostridium_perfringens_P      KFYVE-------------- 151
LuxS_Archeae_Haloferax_volcani      LAEGGLVAHNGDRWRID-- 217
                                                       
PLEASE NOTE: Showing colors on large alignments is slow.

spacer
spacer