spacer

ClustalW Results - LuxS


Results of search
Number of sequences 60
Alignment score 743683
Sequence format Pearson
Sequence type aa
ClustalW version 1.83
JalView
Output file clustalw-20070602-23430588.output
Alignment file clustalw-20070602-23430588.aln
Guide tree file clustalw-20070602-23430588.dnd
Your input file clustalw-20070602-23430588.input

To save a result file right-click the file link in the above table and choose "Save Target As".
If you cannot see the JalView button, reload the page and check your browser settings to enable Java Applets.




Alignment

CLUSTAL W (1.83) multiple sequence alignment


LuxS_Deinococcus_radiodurans_P      MPDMAN---VESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPN 47
LuxS_Thermus_thermophilus_HB27      ---MAE---VESFSLDHTKVKAPYVRLAGRKALAGG-VVEKYDLRLAQPN 43
LuxS_Lactobacillus_johnsonii_P      ---MGK---VESFELDHTKVKAPYVRLITVEEGQKGDKISNFDLRLVQPN 44
LuxS_Lactobacillus_reuteri_POS      ---MAK---VESFTLDHTKVKAPYVRLITVEEGAKGDKISNYDLRLVQPN 44
LuxS_Lactobacillus_plantarum_P      ---MAK---VESFTLDHTKVLAPYVRKITVENGPKGDAITNFDLRLVQPN 44
LuxS_Streptococcus_gordonii_st      ---MSKEVIVESFELDHTIVKAPYVRLIGEESGPKGDVISNFDIRLVQPN 47
LuxS_Streptococcus_pneumoniae_      ---MSKEVIVESFELDHTIVKAPYVRLIGEETGPKGDIISNYDIRLVQPN 47
LuxS_Streptococcus_mutans_POSI      ---MTKEVTVESFELDHIAVKAPYVRLISEEFGPKGDLITNFDIRLVQPN 47
LuxS_Streptococcus_pyogenes_se      ---MTKEVIVESFELDHTIVKAPYVRLISEEFGPKGDRITNFDVRLVQPN 47
LuxS_Streptococcus_agalactiae_      ---MTKEVVVESFELDHTIVKAPYVRLISEEVGPVGDIITNFDIRLIQPN 47
LuxS_Lactococcus_lactis_subsp_      ---MAE---VESFQLDHTKVLAPYVRLIGSETGPKGDVITNFDVRFVQPN 44
LuxS_Enterococcus_faecalis_POS      ---MAR---VESFELDHNTVKAPYVRLAGTEQNG-DALVEKYDLRFLQPN 43
LuxS_Staphylococcus_aureus_sub      ----MTKMNVESFNLDHTKVVAPFIRLAGTMEGLNGDVIHKYDIRFKQPN 46
LuxS_Staphylococcus_epidermidi      ----MTKMNVESFNLDHTKVVAPFIRLAGTMEGLNGDVIHKYDIRFKQPN 46
LuxS_Listeria_monocytogenes_st      ---MAEKMNVESFNLDHTKVKAPFVRLAGTKVGVHGDEIYKYDVRFKQPN 47
LuxS_Listeria_monocytogenes_PO      ---MAEKMNVESFNLDHTKVKAPFVRLAGTKVGVHGDEIYKYDVRFKQPN 47
LuxS_Listeria_innocua_POSITIU       ---MAEKMNVESFNLDHTKVKAPFVRLAGTKVGVHGDEIYKYDVRFKQPN 47
LuxS_Oceanobacillus_iheyensis_      ---MTKKMNVESFNLDHTKVKAPYVRLVGVTEGANGDKVHKYDIRIKQPN 47
LuxS_Helicobacter_pylori_J99_N      -----MKMNVESFNLDHTKVKAPYVRIADRKKGVNGDLIVKYDVRFKQPN 45
LuxS_Helicobacter_pylori_POSIT      --MKTPKMNVESFNLDHTKVKAPYVRVADRKKGVNGDLIVKYDVRFKQPN 48
LuxS_Propionibacterium_acnes_P      ---MAHKMNVESFNLDHTKVAAPFVRVADVKHLPAGDTLTKYDVRFCQPN 47
LuxS_Bacillus_anthracis_POSITI      -----MPS-VESFELDHTIVKAPYVRHCGVHNVGSDGIVNKFDIRFCQPN 44
LuxS_Bacillus_cereus_ATCC14579      -----MPS-VESFELDHTIVKAPYVRHCGVHNVGSDGIVNKFDIRFCQPN 44
LuxS_Bacillus_subtilis_POSITIU      -----MPS-VESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPN 44
LuxS_Geobacillus_kaustophilus_      -----MPSPVESFELDHCAVKAPYVRHCGVHKVGSDGVVNKFDIRFCQPN 45
LuxS_Bacillus_halodurans_POSIT      -----MPT-VESFELDHTIVKAPFVRPCGTHKVGTNGEVNKFDIRFFQPN 44
LuxS_Bacillus_clausii_POSITIU       -----MPS-VESFELDHTIVKAPYVRHCGKHKIGSDGEVNKFDIRFCQPN 44
LuxS_Clostridium_perfringens_P      ------MVKVESFELDHTKVKAPYVRKAGIKIGPKGDIVSKFDLRFVQPN 44
LuxS_Wolinella_succinogenes_NE      ------MPLLDSFKVDHTKMPAPAVRLAKTMTTPKGDEIAVFDLRFCRPN 44
LuxS_Helicobacter_hepaticus_NE      ------MPLLDSFKVDHTKMPAPAVRLAKTMQTPKGDTISVFDLRFTRPN 44
LuxS_Campylobacter_jejuni_NEGA      ------MPLLDSFKVDHTKMPAPAVRLAKVMKTPKGDDISVFDLRFCIPN 44
LuxS_Campylobacter_jejuni_RM12      ------MPLLDSFKVDHTKMPAPAVRLAKVMKTPKGDDISVFDLRFCIPN 44
LuxS_Vibrio_alginolyticus_NEGA      --------------------------------------------------
LuxS_Vibrio_parahaemolyticus_N      ------MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPN 44
LuxS_Vibrio_harveyi_NEGATIU         ------MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPN 44
LuxS_Vibrio_vulnificus_NEGATIU      ------MPLLDSFTVDHTRMHAPAVRVAKTMQTPKGDTITVFDLRFTAPN 44
LuxS_Vibrio_cholerae_NEGATIU        ------MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTMPN 44
LuxS_Photobacterium_profundum_      ------MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFCRPN 44
LuxS_Shewanella_oneidensis_POS      ------MPLLDSFTVDHTRMNAPAVRVAKHMTTPKGDAITVFDLRFCAPN 44
LuxS_Escherichia_coli_NEGATIU       ------MPLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPN 44
LuxS_Escherichia_coli_O157_H7_      ------MPLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPN 44
LuxS_Shigella_flexneri_NEGATIU      ------MPLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPN 44
LuxS_Escherichia_coli_O6_NEGAT      ------MPLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPN 44
LuxS_Salmonella_typhimurium_NE      ------MPLLDSFAVDHTRMQAPAVRVAKTMNTPHGDAITVFDLRFCIPN 44
LuxS_Salmonella_typhi_NEGATIU       ------MPLLDSFAVDHTRMQAPAVRGAKTMNTPHGDAITVFDLRFCIPN 44
LuxS_Serratia_marcescens_NEGAT      ------MPLLDSFTVDHTRMAAPAVRVAKTMKTPHGDTITVFDLRFCRPN 44
LuxS_Yersinia_pestis_NEGATIU        ------MPLLDSFTVDHTIMKAPAVRVAKTMKTPHGDEITVFDLRFCVPN 44
LuxS_Pectobacterium_atroseptic      ------MPLLDSFTVDHTRMAAPAVRVAKTMKTPHGDNITVFDLRFCRPN 44
LuxS_Proteus_mirabilis_NEGATIU      ------MPLLDSFTVDHTRMSAPAVRVAKTMKTPSGDTITVFDLRFTVPN 44
LuxS_Photorhabdus_luminescens_      ------MPLLDSFTVDHTRMNAPAVRVAKTMKTPHGDTITVFDLRFCIPN 44
LuxS_2Neisseria_meningitidis_s      ------MPLLDSFKVDHTRMHAPAVRVAKTMTTPKGDTITVFDLRFCVPN 44
LuxS_Neisseria_meningitidis_se      ------MPLLDSFKVDHTRMHAPAVRVAKTMTTPKGDTITVFDLRFCVPN 44
LuxS_Haemophilus_influenzae_NE      ------MPLLDSFKVDHTKMNAPAVRIAKTMLTPKGDNITVFDLRFCIPN 44
LuxS_Mannheimia_succiniciprodu      ------MPLLDSFKVDHTVMKAPAVRVAKIMRTPKGDDITVFDLRFCVPN 44
LuxS_Pasteurella_multocida_NEG      ------MPLLDSFKVDHTRMKAPAVRIAKTMTTPKGDNITVFDLRFCIPN 44
LuxS_Haemophilus_ducreyi_NEGAT      ------MPLLDSFKVDHTRMNAPAVRVAKTITTPKGDLITVFDLRFCRPN 44
LuxS_Borrelia_burgdorferi_NEGA      ------MKKITSFTIDHTKLNP--GIYVSRKDTFENVIFTTIDIRIKAPN 42
LuxS_Borrelia_garinii_NEGATIU       ------MKKITSFTIDHTKLNP--GIYVSRKDTFENVIFTTIDIRIKAPN 42
LuxS_Desulfotalea_psychrophila      ------MEKIASFTIDHTKLKR--GVYVSRQDKVAGNVITTFDLRLKEPN 42
LuxS_Clostridium_acetobutylicu      ------MEKIASFTVNHLTLQP--GVYVSRKDKFGDVVITTFDIRMTSPN 42
                                                                                      

LuxS_Deinococcus_radiodurans_P      QG-AIDPAAIHTLEHLLAGYMRDHLE-----GVVDVSPMGCRTGMYMAVI 91
LuxS_Thermus_thermophilus_HB27      RE-ALPTGALHTLEHLLAGYLRDHLP-----GVIDLSPMGCRTGFYLVVE 87
LuxS_Lactobacillus_johnsonii_P      EN-AIPTGGLHTIEHLLAGLLRDRID-----GYIDCSPFGCRTGFHLLVW 88
LuxS_Lactobacillus_reuteri_POS      EN-AIPTAGLHTIEHLLAGLLRDRLD-----GVIDCSPFGCRTGFHLITW 88
LuxS_Lactobacillus_plantarum_P      KT-AIDTAGLHTIEHMLAGLLRDRMD-----GVIDCSPFGCRTGFHLITW 88
LuxS_Streptococcus_gordonii_st      ED-SIPTAGLHTIEHLLAMLIRKRID-----GMIDCSPFGCRTGFHMIMW 91
LuxS_Streptococcus_pneumoniae_      ED-SIPTAGLHTIEHLLAKLIRTRID-----GMIDCSPFGCRTGFHMIMW 91
LuxS_Streptococcus_mutans_POSI      ED-SIPTAGLHTIEHLLAKLIRQRID-----GMIDCSPFGCRTGFHLIMW 91
LuxS_Streptococcus_pyogenes_se      QN-SIETAGLHTIEHLLAKLIRQRID-----GMIDCSPFGCRTGFHLIMW 91
LuxS_Streptococcus_agalactiae_      EN-AIDTAGLHTIEHLLAKLIRQRIN-----GLIDCSPFGCRTGFHMIMW 91
LuxS_Lactococcus_lactis_subsp_      AN-AIGMAALHTIEHSMASLIRDRID-----GMIDFSPFGCQTGFHMIMW 88
LuxS_Enterococcus_faecalis_POS      KD-ALPTGALHTLEHLLAVNMRDELK-----GIIDISPMGCRTGFYMIMW 87
LuxS_Staphylococcus_aureus_sub      KE-HMDMPGLHSLEHLMAENIRNHSD-----KVVDLSPMGCQTGFYVSFI 90
LuxS_Staphylococcus_epidermidi      KE-HMDMPGLHSLEHLMAENIRNHTD-----KVVDLSPMGCQTGFYVSFI 90
LuxS_Listeria_monocytogenes_st      KE-HMEMPALHSLEHLMAELARNHTD-----KLVDISPMGCQTGFYVSFI 91
LuxS_Listeria_monocytogenes_PO      KE-HMEMPALHSLEHLMAELARNHTD-----KLVDISPMGCQTGFYVSFI 91
LuxS_Listeria_innocua_POSITIU       KE-HMEMPALHSLEHLMAELARNHTD-----KLVDISPMGCQTGFYMSFI 91
LuxS_Oceanobacillus_iheyensis_      KA-HMEMPGLHSLEHLMAENIRNHSD-----AVLDIGPMGCQTGFYLSLI 91
LuxS_Helicobacter_pylori_J99_N      RD-HMDMPSLHSLEHLVAEIIRNHAN-----YVVDWSPMGCQTGFYLTVL 89
LuxS_Helicobacter_pylori_POSIT      QD-HMDMPSLHSLEHLVAEIIRNHAS-----YVVDWSPMGCQTGFYLTVL 92
LuxS_Propionibacterium_acnes_P      KE-HLDMPAVHSLEHSFAECVRNHSD-----AVIDFGPMGCQTGFYLIMI 91
LuxS_Bacillus_anthracis_POSITI      KQ-AMKPDVIHTLEHLLAFNLRKYIDRYPHFDIIDISPMGCQTGYYLVVS 93
LuxS_Bacillus_cereus_ATCC14579      KQ-AMKPDVIHTLEHLLAFNLRKYIDRYPHFDIIDISPMGCQTGYYLVVS 93
LuxS_Bacillus_subtilis_POSITIU      KQ-AMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVS 93
LuxS_Geobacillus_kaustophilus_      KE-AMDPAAIHTLEHLLAYTLRRHAAKYDHFDIIDISPMGCQTGFYLVVS 94
LuxS_Bacillus_halodurans_POSIT      KQ-AMKPDVIHTLEHLLALNIRKFAEAYDHFDVIDLSPMGCQTGFYLIMS 93
LuxS_Bacillus_clausii_POSITIU       KE-ALKPGVIHTLEHLLAINIRRFSEEYDHFDVIDISPMGCQTGYYLIMS 93
LuxS_Clostridium_perfringens_P      KE-LLSDKGMHTLEHFLAGFMREKLD-----DVIDISPMGCKTGFYLTSF 88
LuxS_Wolinella_succinogenes_NE      QE-ILSEKGIHTLEHLFAGFMREHLN-GEGIEIIDISPMGCRTGFYMSLI 92
LuxS_Helicobacter_hepaticus_NE      CE-LLSEKGIHTMEHLIAGFMREHLN-NTRVEIIDISPMGCRTGFYMSVV 92
LuxS_Campylobacter_jejuni_NEGA      KD-IMSEKGTHTLEHLFAGFMRDHLN-SNSVEIIDISPMGCRTGFYMSLI 92
LuxS_Campylobacter_jejuni_RM12      KD-IMSEKGTHTLEHLFAGFMRDHLN-SNSVEIIDISPMGCRTGFYMSLI 92
LuxS_Vibrio_alginolyticus_NEGA      ----------------------------DSVEIIDISPMGCRTGFYMSLI 22
LuxS_Vibrio_parahaemolyticus_N      KD-ILSEKGIHTLEHLYAGFMRNHLN-GDSVEIIDISPMGCRTGFYMSLI 92
LuxS_Vibrio_harveyi_NEGATIU         KD-ILSEKGIHTLEHLYAGFMRNHLN-GDSVEIIDISPMGCRTGFYMSLI 92
LuxS_Vibrio_vulnificus_NEGATIU      KD-ILSEKGIHTLEHLYAGFMRKHLN-GASVEIIDISPMGCRTGFYMSLI 92
LuxS_Vibrio_cholerae_NEGATIU        KD-ILSERGIHTLEHLYAGFMRNHLN-GSQVEIIDISPMGCRTGFYMSLI 92
LuxS_Photobacterium_profundum_      MD-ILSERGIHTLEHLYAGFMRNHLN-SERVEIIDISPMGCRTGFYMSLI 92
LuxS_Shewanella_oneidensis_POS      KD-ILSERGIHTLEHLFAGFMRDHLN-GDDVEIIDISPMGCRTGFYMSLI 92
LuxS_Escherichia_coli_NEGATIU       KE-VMPERGIHTLEHLFAGFMRNHLN-GNGVEIIDISPMGCRTGFYMSLI 92
LuxS_Escherichia_coli_O157_H7_      KE-VMPERGIHTLEHLFAGFMRNHLN-GNGVEIIDISPMGCRTGFYMSLI 92
LuxS_Shigella_flexneri_NEGATIU      KE-VMPERGIHTLEHLFAGFMRNHLN-GNGVEIIDISPMGCRTGFYMSLI 92
LuxS_Escherichia_coli_O6_NEGAT      KE-VMPERGIHTLEHLFAGFMRNHLN-GNGVEIIDISPMGCRTGFYMSLI 92
LuxS_Salmonella_typhimurium_NE      KE-VMPEKGIHTLEHLFAGFMRDHLN-GNGVEIIDISPMGCRTGFYMSLI 92
LuxS_Salmonella_typhi_NEGATIU       KE-VMPEKGIHTLEHLFAGFMRDHLN-GNGVEIIDISPMGCRTGFYMSLI 92
LuxS_Serratia_marcescens_NEGAT      LE-VMPERGIHTLEHLFAGFMRDHLN-GQGVEIIDISPMGCRTGFYMSLI 92
LuxS_Yersinia_pestis_NEGATIU        KE-VMPEKGIHTLEHLFAGFMRDHLN-GDGVEIIDISPMGCRTGFYMSLI 92
LuxS_Pectobacterium_atroseptic      IE-VMPERGIHTLEHLFAGFMRDHLN-GDGVEIIDISPMGCRTGFYMSLI 92
LuxS_Proteus_mirabilis_NEGATIU      KK-AMPEKGIHTLEHLFAGFMRNHLN-GEGVEIIDISPMGCRTGFYMSLI 92
LuxS_Photorhabdus_luminescens_      KQ-VMPEKGIHTLEHLFAGFMRNHLN-GEGVEIIDISPMGCRTGFYMSLI 92
LuxS_2Neisseria_meningitidis_s      KE-ILPEKGIHTLEHLFAGFMRDHLN-GNGVEIIDISPMGCRTGFYMSLI 92
LuxS_Neisseria_meningitidis_se      KE-ILPGKGIHTLEHLFAGFMRDHLN-GNGVEIIDISPMGCRTGFYMSLI 92
LuxS_Haemophilus_influenzae_NE      KE-ILSPKGIHTLEHLFAGFMRDHLN-GDSIEIIDISPMGCRTGFYMSLI 92
LuxS_Mannheimia_succiniciprodu      KE-ILSPKGIHTLEHLFAGFMREHLN-GDSVEIIDISPMGCRTGFYMSLI 92
LuxS_Pasteurella_multocida_NEG      KE-ILSPKGIHTLEHLFAGFMRDHLN-GTEVEIIDISPMGCRTGFYMSLI 92
LuxS_Haemophilus_ducreyi_NEGAT      ME-IMSSKGIHTLEHLYAGFMRDHLN-SDKVEIIDISPMGCRTGFYMSLI 92
LuxS_Borrelia_burgdorferi_NEGA      IEPIIENAAIHTIEHIGATLLRNNEV--WTEKIVYFGPMGCRTGFYLIIF 90
LuxS_Borrelia_garinii_NEGATIU       IEPIIENAAIHTIEHIGATLLRNNEV--WTEKIVYFGPMGCRTGFYLIIF 90
LuxS_Desulfotalea_psychrophila      NEPALDGAASHTIEHIGATFLRNHKT--WADRTIYFGPMGCQTGFYLILA 90
LuxS_Clostridium_acetobutylicu      EEPVMNTAEVHTIEHLGATFLRNHGT--YAEKTVYFGPMGCRTGFYLILQ 90
                                                                     :  .*:**:** ::   

LuxS_Deinococcus_radiodurans_P      GEPDEQGVMKAFEAALKDTAGHDQ---PIPGVSELECGNYRDHDLAAARQ 138
LuxS_Thermus_thermophilus_HB27      GPVGEEKVLEAFAQALKDVLAHEG---EVPGASFRECGNYRDHDLPGAKA 134
LuxS_Lactobacillus_johnsonii_P      GTPSTTDVAKALKESLEEIRDNIT-WEDVPGTTIESCGNYRDHSLFSAKQ 137
LuxS_Lactobacillus_reuteri_POS      GEHSTTEVAKALKSSLEEIAYKTK-WEDVQGTTIESCGNYRDHSLFSAKE 137
LuxS_Lactobacillus_plantarum_P      GEHDTVEVAKALKSSLEFIAGPAK-WEDVQGTTIDSCGNYKDHSLFSAKE 137
LuxS_Streptococcus_gordonii_st      GRHTPSEIAQVIKSCLEEIAETTT-WEDVPGTTIESCGNYKDHSLFSAKE 140
LuxS_Streptococcus_pneumoniae_      GRHTSAKIAAVIKDSLKEIAETTT-WEDVPGTTIESCGNYKDHSLFSAKE 140
LuxS_Streptococcus_mutans_POSI      GKHTTTQIATVIKASLEEIANTIS-WKDVPGTTIESCGNYKDHSLFSAKE 140
LuxS_Streptococcus_pyogenes_se      GKHSSTDIAKVIKSSLEEIATGIT-WEDVPGTTLESCGNYKDHSLFAAKE 140
LuxS_Streptococcus_agalactiae_      GKQDATEIAKVIKSSLEAIAGGVT-WEDVPGTTIESCGNYKDHSLHSAQE 140
LuxS_Lactococcus_lactis_subsp_      GEHSSEEIAKVIKSSLEELASDEFGWDNVPGVAEKECGNYRNHSLFGAKE 138
LuxS_Enterococcus_faecalis_POS      DQHSPQEIRDALVNVLNKVINTEV----VPAVSAKECGNYKDHSLFAAKE 133
LuxS_Staphylococcus_aureus_sub      NHDNYDDVLNIVEATLNDVL----NATEVPACNEVQCGWAASHSLEGAKT 136
LuxS_Staphylococcus_epidermidi      NHDDYDDVLNIIDQTLHDVL----NASEVPACNEVQCGWAASHSLEGAKT 136
LuxS_Listeria_monocytogenes_st      NHSDYDDALEIIATTLTDVL----AATEVPACNEVQCGWAASHSLEGAKA 137
LuxS_Listeria_monocytogenes_PO      NHSDYDDALEIIATTLTDVL----VATEVPACNEVQCGWAASHSLEGAKA 137
LuxS_Listeria_innocua_POSITIU       NHNDYDDALEILATTLTDVL----AADSVPACNEVQCGWAASHSLEGAKE 137
LuxS_Oceanobacillus_iheyensis_      NHDDYDDVLTMIEKTLEDVL----QATEVPACNEVQCGWAANHSLLGAQE 137
LuxS_Helicobacter_pylori_J99_N      NHDNYTEILEVLEKTMQDVL----KAKEVPASNEKQCGWAANHTLEGAQN 135
LuxS_Helicobacter_pylori_POSIT      NHDNYTEILEVLEKTMQDVL----KATEVPASNEKQCGWAANHTLEGAKD 138
LuxS_Propionibacterium_acnes_P      GEPDVSGTCELVETTLRDIL----KLNTTPAANEVQCGWGANHSIKAAQE 137
LuxS_Bacillus_anthracis_POSITI      GTPTVREIIDLLELTLKDAV----QITEIPAANETQCGQAKLHDLEGAKR 139
LuxS_Bacillus_cereus_ATCC14579      GTPTVREIIDLLELTLKDAV----QITEIPAANETQCGQAKLHDLEGAQR 139
LuxS_Bacillus_subtilis_POSITIU      GEPTSAEIVDLLEDTMKEAV----EITEIPAANEKQCGQAKLHDLEGAKR 139
LuxS_Geobacillus_kaustophilus_      GSPTVDEIIDLLEEAMKDAL----AATEVPAATERQCGQAKLHDLEAAKQ 140
LuxS_Bacillus_halodurans_POSIT      GKPTVEEIIDVLEQTMKYSL----ELEEVPAANEKQCGQAKLHDLDGAKK 139
LuxS_Bacillus_clausii_POSITIU       GTPSVEEIIDVLEKTMTYSL----SIETVPAATEKECGQAALHDLEGTKE 139
LuxS_Clostridium_perfringens_P      GDIDVKDIIEALEYSLSKVL----EQEEIPAANELQCGSAKLHSLELAKS 134
LuxS_Wolinella_succinogenes_NE      GVPKNARVLEAWRRSMEDIL-TLKSEEEIPELNIYQCGTACMHSLKEAQE 141
LuxS_Helicobacter_hepaticus_NE      GAPNEYNVKEAWESSMRDVL-RICDEKDIPELNIYQCGTAKMHSLKEAQD 141
LuxS_Campylobacter_jejuni_NEGA      GTPDEKSIAKAWEAAMKDVL-SVSDQSKIPELNIYQCGTCAMHSLDEAKQ 141
LuxS_Campylobacter_jejuni_RM12      GTPDEKSVAKAWEEAMKDVL-SVSDQSKIPELNIYQCGTCAMHSLDEAKQ 141
LuxS_Vibrio_alginolyticus_NEGA      GTPSEQQVADAWIAAMEDVL-KVESQNKIPELNEYQCGTAAMHSLKEAQQ 71
LuxS_Vibrio_parahaemolyticus_N      GTPSEQQVADAWLASMEDVL-KVESQNKIPELNEYQCGTAAMHSLEEAQQ 141
LuxS_Vibrio_harveyi_NEGATIU         GTPSEQQVADAWIAAMEDVL-KVENQNKIPELNEYQCGTAAMHSLDEAKQ 141
LuxS_Vibrio_vulnificus_NEGATIU      GAPSEQDVASAWTASMEDVL-KVESQNKIPELNEYQCGTAAMHSLDEAKQ 141
LuxS_Vibrio_cholerae_NEGATIU        GAPTEQQVAQAWLAAMQDVL-KVESQEQIPELNEYQCGTAAMHSLEEAKA 141
LuxS_Photobacterium_profundum_      GTPSEQDVAAGWTAAMEDVL-NVESQDQIPELNEYQCGTYSMHSLEEAKD 141
LuxS_Shewanella_oneidensis_POS      GVPTERQVADAWLASMEDVL-KVVEQSEIPELNEYQCGTYEMHSLEQAQD 141
LuxS_Escherichia_coli_NEGATIU       GTPDEQRVADAWKAAMEDVL-KVQDQNQIPELNVYQCGTYQMHSLQEAQD 141
LuxS_Escherichia_coli_O157_H7_      GTPDEQRVADVWKAAMEDVL-KVQDQNQIPELNVYQCGTYQMHSLQEAQD 141
LuxS_Shigella_flexneri_NEGATIU      GTPDEQRVADAWKAAMEDVL-KVQDQNQIPELNVYQCGTYQMHSLQEAQD 141
LuxS_Escherichia_coli_O6_NEGAT      GTPDEQRVADAWKAAMEDVL-KVQDQNQIPELNVYQCGTYQMHSLQEAQD 141
LuxS_Salmonella_typhimurium_NE      GTPDEQRVADAWKAAMADVL-KVQDQNQIPELNVYQCGTYQMHSLSEAQD 141
LuxS_Salmonella_typhi_NEGATIU       GTPDEQRVADAWKAAMADVL-KVQDQNQIPELNVYQCGTYQMHSLSEAQD 141
LuxS_Serratia_marcescens_NEGAT      GVPEEQRVADAWKAAMADVL-KVTDQRKIPELNEYQCGTYHMHSLEEAQE 141
LuxS_Yersinia_pestis_NEGATIU        GTPDEQRVADAWKAAMADVL-KVTDQRKIPELNEYQCGTYHMHSLEEAQS 141
LuxS_Pectobacterium_atroseptic      GTPDEQRVAESWKAAMSDVL-KVTDQRKIPELNEYQCGTYDMHSLKEAQE 141
LuxS_Proteus_mirabilis_NEGATIU      GQPDEQRVANAWKAAMEDVL-KVKDQNHIPELNVYQCGTYEMHSLAEAQD 141
LuxS_Photorhabdus_luminescens_      GEPAEVRVADAWKAAMADVL-KVKDQSQIPELNIYQCGTYHMHSLTEAQD 141
LuxS_2Neisseria_meningitidis_s      GTPSEQQVADAWLASMQDVL-NVKDQSKIPELNEYQCGTYQMHSLAEAQQ 141
LuxS_Neisseria_meningitidis_se      GTPSEQQVADAWLASMQDVL-NVKDQSKIPELNEYQCGTYQMHSLAEAQQ 141
LuxS_Haemophilus_influenzae_NE      GTPNEQKVSEAWLASMQDVL-GVQDQASIPELNIYQCGSYTEHSLEDAHE 141
LuxS_Mannheimia_succiniciprodu      GTPNEQQVADAWLASMRDVL-TVQDQSTIPELNIYQCGTYTEHSLADAHE 141
LuxS_Pasteurella_multocida_NEG      GTPNEQQVADAWLASMRDVL-LVKDQAQIPELNAFQCGTYTEHSLAEAQQ 141
LuxS_Haemophilus_ducreyi_NEGAT      GEPSAQAVANAWKNAMHDILTKVSDVTQIPELNIYQCGTFSEHSLEDAHQ 142
LuxS_Borrelia_burgdorferi_NEGA      GDYESKDLVDLVSWLFSEIV---NFSEPIPGASDKECGNYKEHNLDMAK- 136
LuxS_Borrelia_garinii_NEGATIU       GNYESKDLIDLISWLFSEIV---NFSEPIPGASHKECGNYKDHNLDMAK- 136
LuxS_Desulfotalea_psychrophila      GDWKAKDIVPLMQEMFAYVA---QFTGTIPGESAVECGNFRFMDLIQAKE 137
LuxS_Clostridium_acetobutylicu      GDYTSNDIVPLLREMYKFIA---DFKGEVPGAAARDCGNYLDMNLPMAN- 136
                                    .                                  .**      :  :. 

LuxS_Deinococcus_radiodurans_P      HARDVLDQGLKVQETILLER----------- 158
LuxS_Thermus_thermophilus_HB27      WAEKVLKAGLRVQATVPLEAR---------- 155
LuxS_Lactobacillus_johnsonii_P      WSRDILEKGISDDPFERHVVE---------- 158
LuxS_Lactobacillus_reuteri_POS      WSKKILDEGISDKPFERHVVD---------- 158
LuxS_Lactobacillus_plantarum_P      WAKLILSQGISSDPFVRKVVE---------- 158
LuxS_Streptococcus_gordonii_st      WAKLILKQGISDNAFERHVI----------- 160
LuxS_Streptococcus_pneumoniae_      WAKLILEQGISDDAFERHVI----------- 160
LuxS_Streptococcus_mutans_POSI      WAKLILKQGISDDPFERHLV----------- 160
LuxS_Streptococcus_pyogenes_se      WAQLIIDQGISDDPFSRHVI----------- 160
LuxS_Streptococcus_agalactiae_      WAKLILSQGISDNAFERHIV----------- 160
LuxS_Lactococcus_lactis_subsp_      WSKKILSEGISTDPYERKVI----------- 158
LuxS_Enterococcus_faecalis_POS      YAKIVLDQGISLDPFERIL------------ 152
LuxS_Staphylococcus_aureus_sub      IAQAFLDK-RNEWHDVFGTGK---------- 156
LuxS_Staphylococcus_epidermidi      IAQAFLDK-REQWNDIYGEGK---------- 156
LuxS_Listeria_monocytogenes_st      LAAEFLDK-RDEWKNVFGE------------ 155
LuxS_Listeria_monocytogenes_PO      LAEEFLAK-RSEWKNVFGE------------ 155
LuxS_Listeria_innocua_POSITIU       LAEEFLAK-RSEWKNVFGE------------ 155
LuxS_Oceanobacillus_iheyensis_      IAKEMLNE-KASWSEVF-------------- 153
LuxS_Helicobacter_pylori_J99_N      LARAFLDK-RAEWSEVGV------------- 152
LuxS_Helicobacter_pylori_POSIT      LARAFLDK-RAEWSEVGV------------- 155
LuxS_Propionibacterium_acnes_P      AAHTMLNH-RDEWEQVMA------------- 154
LuxS_Bacillus_anthracis_POSITI      LMNFWLSQDKDELEKVFG------------- 157
LuxS_Bacillus_cereus_ATCC14579      LMNFWLSQDKDELEKVFG------------- 157
LuxS_Bacillus_subtilis_POSITIU      LMRFWLSQDKEELLKVFG------------- 157
LuxS_Geobacillus_kaustophilus_      LMRFWLSQEKEELKKVFG------------- 158
LuxS_Bacillus_halodurans_POSIT      LMTYWLSHEKDSLTKVFES------------ 158
LuxS_Bacillus_clausii_POSITIU       VMRKWLSEDKGSLKQVF-------------- 156
LuxS_Clostridium_perfringens_P      HAKQVLENGISDKFYVE-------------- 151
LuxS_Wolinella_succinogenes_NE      IARTVLDRGISIMDNEALKLQL--------- 163
LuxS_Helicobacter_hepaticus_NE      IAQVVLDKGVSVMNTQELLLKDFA------- 165
LuxS_Campylobacter_jejuni_NEGA      IAQKVLNLGISIINNKELKLENA-------- 164
LuxS_Campylobacter_jejuni_RM12      IAQKVLNLGISIMNNKELKLENA-------- 164
LuxS_Vibrio_alginolyticus_NEGA      IAKNILDAGVSVNKNDELALPESMLKELRID 102
LuxS_Vibrio_parahaemolyticus_N      IAKNILAAGVSVNKNDELALPESMLKELRVD 172
LuxS_Vibrio_harveyi_NEGATIU         IAKNILEVGVAVNKNDELALPESMLRELRID 172
LuxS_Vibrio_vulnificus_NEGATIU      IAQNILAAGISVNKNDELALPEAMLKELKVD 172
LuxS_Vibrio_cholerae_NEGATIU        IAKNVIAAGISVNRNDELALPESMLNELKVH 172
LuxS_Photobacterium_profundum_      IAKTILAEGINVNKNDELALPESMLKELDVK 172
LuxS_Shewanella_oneidensis_POS      IARNIIAAGVSVNRNDDLKLSDEILGKL--- 169
LuxS_Escherichia_coli_NEGATIU       IARSILERDVRINSNEELALPKEKLQELHI- 171
LuxS_Escherichia_coli_O157_H7_      IARSILERDVRINSNEELALPKEKLQELHI- 171
LuxS_Shigella_flexneri_NEGATIU      IARSILEREVRINSNEELALPKEKLQELHI- 171
LuxS_Escherichia_coli_O6_NEGAT      IARNILERDVRINSNEELALPKEKLQELHI- 171
LuxS_Salmonella_typhimurium_NE      IARHILERDVRVNSNKELALPKEKLQELHI- 171
LuxS_Salmonella_typhi_NEGATIU       IARHILERDVRVNSNKELALPKEKLQELHI- 171
LuxS_Serratia_marcescens_NEGAT      IAKHILDNGVVVNHNDELALPKEKLQELHI- 171
LuxS_Yersinia_pestis_NEGATIU        IAKDILDRDVRINHNEELALPKEKLTELHI- 171
LuxS_Pectobacterium_atroseptic      IAQHIVDHDIGINQNDDLALPKDKLAELHI- 171
LuxS_Proteus_mirabilis_NEGATIU      IARDILSHTIGINHNDELALPEDKLKELQI- 171
LuxS_Photorhabdus_luminescens_      IAHHILDSDVLVNKNDELALPEEKLTELKV- 171
LuxS_2Neisseria_meningitidis_s      IAQNVLARKVAVNKNEELTLDEGLLNA---- 168
LuxS_Neisseria_meningitidis_se      IAQNVLARKVAVNKNEELTLDEGLLNA---- 168
LuxS_Haemophilus_influenzae_NE      IAKNVIARGIGVNKNEDLSLDNSLLK----- 167
LuxS_Mannheimia_succiniciprodu      TARHVIEKGIAINKNEDLLLDEKLLNL---- 168
LuxS_Pasteurella_multocida_NEG      IAHNVLERGVSVNKNEDLLLDEQLLSL---- 168
LuxS_Haemophilus_ducreyi_NEGAT      IARDVLAKGISVNLNEDLTLDEEWLNR---- 169
LuxS_Borrelia_burgdorferi_NEGA      YESSKYLQILNNIKEENLKYP---------- 157
LuxS_Borrelia_garinii_NEGATIU       YESSKYLQILNNIKEENLKYP---------- 157
LuxS_Desulfotalea_psychrophila      EAGKYFTEVLDNIAEKNLSYPS--------- 159
LuxS_Clostridium_acetobutylicu      YWGKKFSALLDNISEDRLNYPE--------- 158
                                                                   
PLEASE NOTE: Showing colors on large alignments is slow.

spacer
spacer