spacer

ClustalW Results - LuxR


Results of search
Number of sequences 24
Alignment score 67091
Sequence format Pearson
Sequence type aa
ClustalW version 1.83
JalView
Output file clustalw-20070603-01235771.output
Alignment file clustalw-20070603-01235771.aln
Guide tree file clustalw-20070603-01235771.dnd
Your input file clustalw-20070603-01235771.input

To save a result file right-click the file link in the above table and choose "Save Target As".
If you cannot see the JalView button, reload the page and check your browser settings to enable Java Applets.




Alignment

CLUSTAL W (1.83) multiple sequence alignment


LuxR_Agrobacterium_tumefacien_      --------------------------------------------------
LuxR_Rhizobium_vitis                --------------------------------------------------
LuxR_Agrobacterium_tumefaciens      --------------------------------------------------
LuxR_Ralstonia_solanacearum         --------------------------------------------------
LuxR_Ralstonia_solanacearum2        --------------------------------------------------
LuxR_Escherichia_coli               --------------------------------------------------
LuxR_Pseudomonas_aeruginosa2        --------------------------------------------------
LuxR_Pseudomonas_fluorescens        --------------------------------------------------
LuxR_Pseudomonas_chlororaphis       --------------------------------------------------
LuxR_Vibrio_fischeri                --------------------------------------------------
LuxR_Vibrio_fischeri2               --------------------------------------------------
LuxR_Listonella_anguillarum         --------------------------------------------------
LuxR_Erwinia_chrysanthemi           --------------------------------------------------
LuxR_Erwinia_chrysanthemi_str_      --------------------------------------------------
LuxR_Pectobacterium_carotovoru      --------------------------------------------------
LuxR_Yersinia_                      --------------------------------------------------
LuxR_Yersinia_ruckeri               --------------------------------------------------
LuxR_Pantoea_stewartii              --------------------------------------------------
LuxR_Aeromonas_hydrophila           --------------------------------------------------
LuxR_Pseudomonas_aeruginosa         --------------------------------------------------
LuxR_Rhizobium_sp_NGR234            MPDLHRLALSALQYRPVGAQSGNASSAAASCTGDYMAGDSSLERDCGRLA 50
LuxR_Rhizobium                      --------------------------------------------------
LuxR_Rhizobium_leguminosarum_b      --------------------------------------------------
LuxR_Rhizobium_etli                 --------------------------------------------------
                                                                                      

LuxR_Agrobacterium_tumefacien_      ---------------------------------MQHWLDKLTDLAAIQGD 17
LuxR_Rhizobium_vitis                ---------------------------------MQHWLDKLTDLTAIEGD 17
LuxR_Agrobacterium_tumefaciens      ---------------------------------MQHWLDKLTDLAAIEGD 17
LuxR_Ralstonia_solanacearum         ---------------------------------MGPGFQDAYHAFHTAQD 17
LuxR_Ralstonia_solanacearum2        ---------------------------------MEPDFQDAYHAFRTAED 17
LuxR_Escherichia_coli               ---------------------------MQ-DKDFFSWRRTMLLRFQRMET 22
LuxR_Pseudomonas_aeruginosa2        ---------------------------MRNDGGFLLWWDGLRSEMQPIHD 23
LuxR_Pseudomonas_fluorescens        -------------------------MFKMELGQLLGWDAYFYSIFAQAMN 25
LuxR_Pseudomonas_chlororaphis       ----------------------------MELGQQLGWDAYFYSIFARTMD 22
LuxR_Vibrio_fischeri                ---------------------------MNIKNINANE--KIIDKIKTCNN 21
LuxR_Vibrio_fischeri2               -----------------------------MKNINADDTYRIINKIKACRS 21
LuxR_Listonella_anguillarum         -----------------------------MYKI-----LRLIQENQQITS 16
LuxR_Erwinia_chrysanthemi           ---------------------------------------MSISFSNFDFI 11
LuxR_Erwinia_chrysanthemi_str_      ---------------------------------------MSISFSNVDFI 11
LuxR_Pectobacterium_carotovoru      ---------------------------------------MSQLFYNNETI 11
LuxR_Yersinia_                      ---------------------------------------MIIDYFDNESI 11
LuxR_Yersinia_ruckeri               --------------------------------------------------
LuxR_Pantoea_stewartii              ---------------------------------------MFSFFLENQTI 11
LuxR_Aeromonas_hydrophila           --------------------------------MKQDQLLEYLEHFTSVTD 18
LuxR_Pseudomonas_aeruginosa         -----------------------------------MALVDGFLELERSSG 15
LuxR_Rhizobium_sp_NGR234            DGCSFPQVRGSATGVSDQSLGGSIHFSNAGRDEYVVELGRLLDLTDGVAQ 100
LuxR_Rhizobium                      -------------------------------MSVNGNLRSLIDMLEAAQD 19
LuxR_Rhizobium_leguminosarum_b      --------------------------MKEESSAVSNLVFDFLSESASAKS 24
LuxR_Rhizobium_etli                 -----------------------------MSPSHAEQFSFFLLSGPDLRI 21
                                                                                      

LuxR_Agrobacterium_tumefacien_      ECILKDGLADLAEHFGFTGYAYLHIQHK-----HTIAVT----NYHRDWR 58
LuxR_Rhizobium_vitis                GCILKTGLADVADHFGFTGYAYLHIQHK-----HIIAVT----NYHHDWR 58
LuxR_Agrobacterium_tumefaciens      ECILKTGLADIADHFGFTGYAYLHIQHR-----HITAVT----NYHRQWQ 58
LuxR_Ralstonia_solanacearum         ERQLFRQIASVVRQLGFDYCCYGIRVPLPVSKPAVAIFD----TYPAGWM 63
LuxR_Ralstonia_solanacearum2        EHQLFREIAAIARQLGFDYCCYGARMPLPVSKPAVAIFD----TYPAGWM 63
LuxR_Escherichia_coli               AEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFYT----NYPEAWV 68
LuxR_Pseudomonas_aeruginosa2        SQGVFAVLEKEVRRLGFDYYAYGVRHTIPFTRPKTEVHG----TYPKAWL 69
LuxR_Pseudomonas_fluorescens        MEEFTVVALRALRELRFDFFAYGMCSVTPFMRPKTYMYG----NYPEHWL 71
LuxR_Pseudomonas_chlororaphis       MQEFTAVALRALRELRFDFFRYGMCSVTPFMRPRTYMYG----NYPEDWV 68
LuxR_Vibrio_fischeri                NKDINQCLSEIAKIIHCEYYLFAIIYPHSIIKPDVSIID----NYPEKWR 67
LuxR_Vibrio_fischeri2               NNDINQCLSDMTKMVHCEYYLLAIIYPHSMVKSDISILD----NYPKKWR 67
LuxR_Listonella_anguillarum         HDDLENVLNGLNNLIGHEFFLFGLSFQPTLKTSETLVTD----NYPNSWR 62
LuxR_Erwinia_chrysanthemi           NSTIQNYLNRKLKSYGDLKYAYLIMNKK--KPTDVVIIS----NYPSEWV 55
LuxR_Erwinia_chrysanthemi_str_      NSTIQSYLNRKLKSYGDPKYAYLIMNKK--KPTDVVIIS----NYPTEWV 55
LuxR_Pectobacterium_carotovoru      SRIIKSQFDMALSHYGDIKYAYMVLNKK--KPTEILIIS----NHHDEWR 55
LuxR_Yersinia_                      NEDIKNYIQRRIKTYGDLCYSYLVMNKK--TPLHPTIIS----NYPLDWV 55
LuxR_Yersinia_ruckeri               -------IDRKLERYDSPRYTYMVIDKK--NPVDVFIVT----SYPDEWA 37
LuxR_Pantoea_stewartii              TDTLQTYIQRKLSPLGSPDYAYTVVSKK--NPSNVLIIS----SYPDEWI 55
LuxR_Aeromonas_hydrophila           GDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFN----QCPDSWV 64
LuxR_Pseudomonas_aeruginosa         KLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVG----NYPAAWR 61
LuxR_Rhizobium_sp_NGR234            PKKLFDLLSAFAFKFGCKWLAYGPLTSDHKALNRVKCDSEEILNYPDGWR 150
LuxR_Rhizobium                      GHMIKIALRSFAHSCGYDRFAYLQKDGT-----QVRTFH----SYPGPWE 60
LuxR_Rhizobium_leguminosarum_b      KDDVLLLFGKISQYFGFSYFAISGIPSPIERIDSYFVLG----NWSVGWF 70
LuxR_Rhizobium_etli                 ADIAGSGNDAGRSRPHLCDIAYGSPCDLAGATDSNPLLML---TYPPEWV 68
                                                                                    * 

LuxR_Agrobacterium_tumefacien_      SAYFENNFDKLDPVVKRAKSRKHVFAWSGEQERSRLSKE-ERAFYAHAAD 107
LuxR_Rhizobium_vitis                SLYFDKKFDALDPVVKRARSRKQVFAWSGEQERPKLSEE-ERAFYAQAAD 107
LuxR_Agrobacterium_tumefaciens      STYFDKKFEALDPVVKRARSRKHIFTWSGEHERPTLSKD-ERAFYDHASD 107
LuxR_Ralstonia_solanacearum         EHYQASGFLEIDPTVRTGASSSDLIIWPVSIRDEA------ARLWSDARD 107
LuxR_Ralstonia_solanacearum2        QHYQASGFLDIDPTVRAGASSSDLIVWPVSIRDDA------ARLWSDARD 107
LuxR_Escherichia_coli               SYYQAKNFLAIDPVLNPENFSQGHLMWNDDLFSEA------QPLWEAARA 112
LuxR_Pseudomonas_aeruginosa2        ERYQMQNYGAVDPAILNGLRSSEMVVWSDSLFDQS------RMLWNEARD 113
LuxR_Pseudomonas_fluorescens        QRYQAANYALIDPTVKHSKVSSAPILWSNELFRNC------PDLWSEAND 115
LuxR_Pseudomonas_chlororaphis       QRYQAANYAVIDPTVKHSKVSSSPILASNELFRGC------PDLWSEAND 112
LuxR_Vibrio_fischeri                KYYDDAGLLEYDPVVDYSKSHHSPINWNVFEKKTIKKE--SPNVIKEAQE 115
LuxR_Vibrio_fischeri2               QYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKK--SPNVIKEAKT 115
LuxR_Listonella_anguillarum         QQYDESGFMHIDPIVKYSITNFLPIRWD--DAKRVNND--GRVIFEEARC 108
LuxR_Erwinia_chrysanthemi           EIYRSNNYQHIDPVILTAINKISPFSWDDDLVISSKLK--FSRIFNLSKE 103
LuxR_Erwinia_chrysanthemi_str_      DIYRNNNYQHIDPVILTAINKISPFSWDDDLVISSKLK--FSRIFNLSKD 103
LuxR_Pectobacterium_carotovoru      EIYQANNYQHIDPVVIAALNKITPFPWDEDLLVSTQLK--MSKIFNLSRE 103
LuxR_Yersinia_                      KKYKKNSYHLIDPVILTAKDKVAPFAWDDNSVINKKST--DSAVFKLARE 103
LuxR_Yersinia_ruckeri               DIYTSQNYQHIDPIVLTAFKRISPFAWDENITILSDLK--SSKIFALSKK 85
LuxR_Pantoea_stewartii              RLYRANNFQLTDPVILTAFKRTSPFAWDENITLMSDLR--FTKIFSLSKQ 103
LuxR_Aeromonas_hydrophila           QAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAE 114
LuxR_Pseudomonas_aeruginosa         EHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQH----EFFEEASA 107
LuxR_Rhizobium_sp_NGR234            ERCLEMGYETIAPVIKESRMGAGPIRWSDMYSDASTTEY-ERRMFDEAAM 199
LuxR_Rhizobium                      SIYLGSDYFNIDPVLAEAKRRRDVFFWTADAWPARGSSP-LRRFRDEAIS 109
LuxR_Rhizobium_leguminosarum_b      DRYRENNYVHADPIVHLSKTCDHAFVWSEALRDQKLDRQ-SRRVMDEARE 119
LuxR_Rhizobium_etli                 KQYRDRDYFSIDPVVRLGRRGFLPVEWSASGWDSGRAYG----FFKEAMA 114
                                                * :         .                  .   :  

LuxR_Agrobacterium_tumefacien_      FGIRS-GITIPIKTANGSMSMFTLASERP------------AIDLDREID 144
LuxR_Rhizobium_vitis                FGIRS-GITIPIRTANGSMSMFTLASERT------------AIPLDREID 144
LuxR_Agrobacterium_tumefaciens      FGIRS-GITIPIKTANGFMSMFTMASDKP------------VIDLDREID 144
LuxR_Ralstonia_solanacearum         FGLNI-GVARSSWTAHGAFGLLTLARRAD----------PLTAAELEQLS 146
LuxR_Ralstonia_solanacearum2        AGLNI-GVARSSWTAHGAFGLLTLARHAD----------PLTAAELGQLS 146
LuxR_Escherichia_coli               HGLRR-GVTQYLMLPNRALGFLSFSRCSA----------REIPILSDELQ 151
LuxR_Pseudomonas_aeruginosa2        WGLCV-GATLPIRAPNNLLSVLSVARDQQ----------NISSFEREEIR 152
LuxR_Pseudomonas_fluorescens        SSLCH-GLAQPSFNTQGRVGVLSLARKDN----------AISLQEFEALK 154
LuxR_Pseudomonas_chlororaphis       SNLRH-GLAQPSFNTQGRVGVLSLARKDN----------PISLQEFEALK 151
LuxR_Vibrio_fischeri                SGLIT-GFSFPIHTASNGFGMLSFAHSDK---------DIYTDSLFLHAS 155
LuxR_Vibrio_fischeri2               SGLIT-GFSFPIHTANNGFGMLSFAHSEK---------DNYIDSLFLHAC 155
LuxR_Listonella_anguillarum         NGLKA-GFSIPIHGLRGEFGMISFATSDT---------KSY--DLNQQSI 146
LuxR_Erwinia_chrysanthemi           YDIVN-GYTFVLHDPGNNLATLSFMFEENRSGELEEIVQNNKEKLQMLLI 152
LuxR_Erwinia_chrysanthemi_str_      YDIVN-GYTFVLHSPGNNLAALSFMIEEHRSEELEEIIQNNKDKLQMLLI 152
LuxR_Pectobacterium_carotovoru      HNITN-GYTFVLHDHSNNLVMLSIMIDESNVSNIDDVIESNKDKLQMTLM 152
LuxR_Yersinia_                      YNIVN-GYTFVLHDNSNNMATLNISNGSDDSISFDERIEINKEKIQMLLI 152
LuxR_Yersinia_ruckeri               YNIVN-GFTFVLHDHMNNLAMLSLIMDNNADKGLNSRIESDKDRLQMNLI 134
LuxR_Pantoea_stewartii              YNIVN-GFTYVLHDHMNNLALLSVIIKGNDQTALEQRLAAEQGTMQMLLI 152
LuxR_Aeromonas_hydrophila           FGLRN-GISFPLHGAAGENGILSFITAER----------ASSDLLLESSP 153
LuxR_Pseudomonas_aeruginosa         AGLVY-GLTMPLHGARGELGALSLSVEAEN---------RAEANRFMESV 147
LuxR_Rhizobium_sp_NGR234            FGLRS-GITVPLRGPRGSCAIMSFARHCER--------------EFHDRT 234
LuxR_Rhizobium                      HGIRC-GVTIPVEGSYGSAMMLTFASPER------------KVDISGVLD 146
LuxR_Rhizobium_leguminosarum_b      FKLID-GFSVPLHTAAGFQSIVSFGAEKV------------ELSTCDRSA 156
LuxR_Rhizobium_etli                 FGVGRQGVTLPVRGPQGERSLFTVTSNHP----------DAYWRQFRMDS 154
                                      :   * :            ...                          

LuxR_Agrobacterium_tumefacien_      AAAAAGAVGQLHARISFLQTTPTVEDAAWLDPKEATYLRWIAVGMTMEEV 194
LuxR_Rhizobium_vitis                AVAAAAAVGQLHARISFLRITPTAEDAAWLDPKEATYLRWIAVGKTMEEI 194
LuxR_Agrobacterium_tumefaciens      AVAAAATIGQIHARISFLRTTPTAEDAAWLDPKEATYLRWIAVGKTMEEI 194
LuxR_Ralstonia_solanacearum         ATTNWLANLAHALMSPFLMPKLVPESSAALTAREREVLCWTGEGKTAYEI 196
LuxR_Ralstonia_solanacearum2        IATHWLANLAHTLMSPFLVPQLVPESNAVLTTREREVLCWTGEGKTAYEI 196
LuxR_Escherichia_coli               LKMQLLVRESLMALMRLNDEI-VMTPEMNFSKREKEILRWTAEGKTSAEI 200
LuxR_Pseudomonas_aeruginosa2        LRLRCMIELLTQKLTDLEHPM-LMSNPVCLSHREREILQWTADGKSSGEI 201
LuxR_Pseudomonas_fluorescens        PVTKAFAAAALEKISALETDVRAFNTDVEFSERECDVLRWTADGKTSEEI 204
LuxR_Pseudomonas_chlororaphis       VVTKAFAAAVHEKISELESDVRVFNTDVEFSGRECDVLRWTADGKTSEEI 201
LuxR_Vibrio_fischeri                TNVPLMLPSLVDNYQKIN--TTRKKSDSILTKREKECLAWASEGKSTWDI 203
LuxR_Vibrio_fischeri2               MNIPLIVPSLVDNYRKIN--IANNKSNNDLTKREKECLAWACEGKSSWDI 203
LuxR_Listonella_anguillarum         HTSQLIVPLLAHNIGNITRYHKDAKPRAVLTAREVQCLAWAAEGKSAWEI 196
LuxR_Erwinia_chrysanthemi           SAHEKLTSLYREMS-KNKNNS-KSQEPNIFSQRENEILYWASMGKTYQEI 200
LuxR_Erwinia_chrysanthemi_str_      SAHEKLTSLYREMS-RNRNNS-KSQEADLFSQRENEILHWASMGKTYQEI 200
LuxR_Pectobacterium_carotovoru      TIHAETISLYREMI-RNKEDE-RSNDKDIFSQRENEILYWASMGKTYQEI 200
LuxR_Yersinia_                      ITHEKMLGLYQSNSDKNENRN-TQIERDIFSPRENEILYWASVGKTYAEI 201
LuxR_Yersinia_ruckeri               KIHEKMLMLEQNKLGVSNGKNTDTSGKGILSPRENEVLHWASMGKTYPEI 184
LuxR_Pantoea_stewartii              DFNEQMYRLAGTEGERAPALN-QSADKTIFSSRENEVLYWASMGKTYAEI 201
LuxR_Aeromonas_hydrophila           ILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLFWASEGKTSGEI 203
LuxR_Pseudomonas_aeruginosa         LPTLWMLKDYALQSGAGLAFEHPVSKPVVLTSREKEVLQWCAIGKTSWEI 197
LuxR_Rhizobium_sp_NGR234            IAYLQLAATHFHLRVAKIANLNAVQKIPALSLREKECVLWVARGKSSWDI 284
LuxR_Rhizobium                      PKKAVQLLMMVHYQLKIIAAKTVLNPKQMLSPREMLCLVWASKGKTASVT 196
LuxR_Rhizobium_leguminosarum_b      LYLMAAYAHSLLRAQIGNDASRKIQALPMITTREREIIHWCAAGKTAIEI 206
LuxR_Rhizobium_etli                 MRDLQFLAHHLHDRAMVLSGMRKVADLPRLSRRELQCLEMTANGLLAKQI 204
                                                                 :  :*   :     *      

LuxR_Agrobacterium_tumefacien_      ADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI---------- 234
LuxR_Rhizobium_vitis                ADVEEVKYNSVRVKLREAMKRFDVRSKAHLTALAIKRKLI---------- 234
LuxR_Agrobacterium_tumefaciens      ADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI---------- 234
LuxR_Ralstonia_solanacearum         GQILRISERTVNFHVNNVLLKLAATNKVQAVVKAIAIGLI---------- 236
LuxR_Ralstonia_solanacearum2        GQILRISERTVNFHVNNVLLKLAATNKVQAVVKAIATGLI---------- 236
LuxR_Escherichia_coli               AMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI---------- 240
LuxR_Pseudomonas_aeruginosa2        AIILSISESTVNFHHKNIQKKFDAPNKTLAAAYAAALGLI---------- 241
LuxR_Pseudomonas_fluorescens        GVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAVALGYI---------- 244
LuxR_Pseudomonas_chlororaphis       GVIMGVCTDTVNYHHRNIQRKIGASNRVQASRYAVAMGYI---------- 241
LuxR_Vibrio_fischeri                SKILGCSERTVTFHLTNTQMKLNTTNRCQSISKAILTGAINCPYLKN--- 250
LuxR_Vibrio_fischeri2               SKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAILTGAIDCPYFKN--- 250
LuxR_Listonella_anguillarum         ATIINTSERTVKFHFSNACKKLGATNRYQAITKAILGGYIN-PYL----- 240
LuxR_Erwinia_chrysanthemi           ALILGITTSTVKFHIGNVVKKLGVLNAKHAIRLGVEMNLIKPVEPVKARS 250
LuxR_Erwinia_chrysanthemi_str_      ALILGITTSTVKFHIGNVVKKLGVLNAKHAIRLGVEMNLIKPVGPAKARS 250
LuxR_Pectobacterium_carotovoru      ALILDIKTGTVKFHIGNVVKKLGVLNAKHAIRLGIELQLIRPVQS----- 245
LuxR_Yersinia_                      SIILGIKRSTVKFHIGNVVRKLGVLNAKHAIRLGIELKLIKPI------- 244
LuxR_Yersinia_ruckeri               ALIAGITTRTVKHHMGNVVKKLGVINARQAIRLGVELELIKPVLV----- 229
LuxR_Pantoea_stewartii              AAITGISVSTVKFHIKNVVVKLGVSNARQAIRLGVELDLIRPAASAAR-- 249
LuxR_Aeromonas_hydrophila           ACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGILLPNLEQVVVT 253
LuxR_Pseudomonas_aeruginosa         SVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMAVNLGLITL-------- 239
LuxR_Rhizobium_sp_NGR234            GVIMRISENTVNFHIKNVMRKLGTSSRTVAAIKAISLGIIEL-------- 326
LuxR_Rhizobium                      ANLTGINARTVQHYLDKARAKLDAESVPQLVAIAKDRGLV---------- 236
LuxR_Rhizobium_leguminosarum_b      ATILGRSHRTIQNVILNIQRKLNVVNTPQMIAESFRLRIIR--------- 247
LuxR_Rhizobium_etli                 CARLSISVSAVQLYLASARRKLTVATTSEQLLGPRRSN------------ 242
                                              :     .   :    .                        

LuxR_Agrobacterium_tumefacien_      -------
LuxR_Rhizobium_vitis                -------
LuxR_Agrobacterium_tumefaciens      -------
LuxR_Ralstonia_solanacearum         -------
LuxR_Ralstonia_solanacearum2        -------
LuxR_Escherichia_coli               -------
LuxR_Pseudomonas_aeruginosa2        -------
LuxR_Pseudomonas_fluorescens        -------
LuxR_Pseudomonas_chlororaphis       -------
LuxR_Vibrio_fischeri                -------
LuxR_Vibrio_fischeri2               -------
LuxR_Listonella_anguillarum         -------
LuxR_Erwinia_chrysanthemi           -------
LuxR_Erwinia_chrysanthemi_str_      -------
LuxR_Pectobacterium_carotovoru      -------
LuxR_Yersinia_                      -------
LuxR_Yersinia_ruckeri               -------
LuxR_Pantoea_stewartii              -------
LuxR_Aeromonas_hydrophila           NFPKLMQ 260
LuxR_Pseudomonas_aeruginosa         -------
LuxR_Rhizobium_sp_NGR234            -------
LuxR_Rhizobium                      -------
LuxR_Rhizobium_leguminosarum_b      -------
LuxR_Rhizobium_etli                 -------
                                           
PLEASE NOTE: Showing colors on large alignments is slow.

spacer
spacer