spacer

ClustalW Results - LuxI


Results of search
Number of sequences 24
Alignment score 66907
Sequence format Pearson
Sequence type aa
ClustalW version 1.83
JalView
Output file clustalw-20070602-20274823.output
Alignment file clustalw-20070602-20274823.aln
Guide tree file clustalw-20070602-20274823.dnd
Your input file clustalw-20070602-20274823.input

To save a result file right-click the file link in the above table and choose "Save Target As".
If you cannot see the JalView button, reload the page and check your browser settings to enable Java Applets.




Alignment

CLUSTAL W (1.83) multiple sequence alignment


LuxI_Pseudomonas_chlororaphis       ----MHMEEHTLNQMSDELKLMLGRFRHEQFVEKLGWRLPAHPSQAGCEW 46
LuxI_Pseudomonas_fluorescens        ----MHMEEHALSAMDDELKLMLGRFRHEQFVEKLGWRLPIPPHQAGYEW 46
LuxI_Pseudomonas_aeruginosaa        ---MIELLSESLEGLSAAMIAELGRYRHQVFIEKLGWDVVSTSRVRDQEF 47
LuxI_Ralstonia_solanacearum         ----MQTFIHGGGRLPEAVDAALAHYRHQIFVGQLGWQLPMADGR--FER 44
LuxI_Ralstonia_solanacearumm        ----MRTFVHGGGRLPEGIDAALAHYRHQVFVGRLGWQLPMADGT--FER 44
LuxI_Vibrio_fischer                 -MTIMIKKSDFLAIPSEEYK-GILSLRYQVFKQRLEWDLVVENNL---ES 45
LuxI_Vibrio_fischeri_ES114          -MAVMIKKSDFLGIPSEEYR-GILSLRYQVFKRRLEWDLVSEDNL---ES 45
LuxI_Listonella_anguillarum         -MTISIYSHTFQSVPQADYV-SLLKLRYKVFSQRLQWELKTNRGM---ET 45
LuxI_Aeromonas_salmonicida          ---MLVFKGKLKEHPRWEVENELYRFRNRVFSDRLGWDVESHRGL---EQ 44
LuxI_Aeromonas_hydrophila           ---MLVFKGKLKEHPRWEVENELYRFRNRVFSDRLGWDVESHRGL---EQ 44
LuxI_Rhizobium_sp_NGR234            --MQILAISKPRNIEEAQLLRSHHELRARVFSDRLGWEVNVVGGC---ES 45
LuxI_Agrobacterium_tumefaciens      --MLILTVSPDQYQHQNSYLKQMHRLRAEVFGNRLKWDVAIEDGG---ER 45
LuxI_Pantoea_agglomerans            ---MLEIFDVSYNDLTERRSEDLYKLRKITFKDRLDWAVNCSNDM---EF 44
LuxI_Yersinia_ruckeri               ---MLEIFDVSYEELMDMRSDDLYRLRKKTFKDRLQWAVNCSNDM---EF 44
LuxI_Pantoea_stewartii              ---MLELFDVSYEELQTTRSEELYKLRKKTFSDRLGWEVICSQGM---ES 44
LuxI_Pectobacterium_carotovoru      ---MLEIFDVNHTLLSETKSGELFTLRKETFKDRLNWAVQCTDGM---EF 44
LuxI_2Pectobacterium_carotovor      ---MLEIFDVSYTLLSEKKSEELFTLRKETFKDRLNWAVKCINGM---EF 44
LuxI_Erwinia_chrysanthemi           ---MLEIFDVSFSLMSNNKLDEVFTLRKDTFKDRLDWAVNCINGM---EF 44
LuxI_Erwinia_chrysanthemi_str_      ---MLEIFDVSFSLMSNNKLDEVFALRKGTFKDRLDWTVNCINGM---EF 44
LuxI_Serratia_liquefaciens          ---MIELFDVDYNLLPDNRSKELFSLRKKTFKDRLDWLVNCENNM---EF 44
LuxI_Yersinia_enterocolitica        ---MLKLFNVNFNNMPERKLDEIFSLREITFKDRLDWKVTCIDGK---ES 44
LuxI_Pseudomonas_syringae_pv_t      MSSGFEFQLASYTTMPVTLLETLYSMRKKIFSDRLEWKVRVSHAF---EF 47
LuxI_Pseudomonas¬_aeruginosa       ----MIVQIGRREEFDKKLLGEMHKLRAQVFKERKGWDVSVIDEM---EI 43
LuxI_Rhizobium_etli                 ---MLRILTKDMLETDRRAFDEMFRARAAVFRDRLGWQVDVRDQW---ER 44
                                                              *   *  :  * :         * 

LuxI_Pseudomonas_chlororaphis       DQYDTEHARYLLAFNED--RAIVGCARLIPTTFPNLLE-GVFGHTCAG-- 91
LuxI_Pseudomonas_fluorescens        DQYDTEHARYLLAFNEH--RSIVGCARLIPTTFPNLLE-GVFSHACAG-- 91
LuxI_Pseudomonas_aeruginosaa        DQFDHPQTRYIVAMSR---QGICGCARLLPTTDAYLLK-DVFAYLCSE-- 91
LuxI_Ralstonia_solanacearum         DQYDRDDTVYVVARDAD--GAICGCARLLPTTRPYLLK-DVFAPLLMRGV 91
LuxI_Ralstonia_solanacearumm        DQYDRDDTVYVVARDEG--GTICGCARLLPTTRPYLLK-DVFASLLMHGM 91
LuxI_Vibrio_fischer                 DEYDNSNAEYIYACDDT--ENVSGCWRLLPTTGDYMLK-SVFPELLGQQ- 91
LuxI_Vibrio_fischeri_ES114          DEYDNSNAEYIYACDDA--EEVNGCWRLLPTTGDYMLK-TVFPELLGDQ- 91
LuxI_Listonella_anguillarum         DEYDVPEAHYLYAKEEQ--GHLVGCWRILPTTSRYMLK-DTFSELLGVQ- 91
LuxI_Aeromonas_salmonicida          DSFDTPDTHWVLIEDE---EGLCGCIRLLSCAQDYMLP-SIFPTALAGE- 89
LuxI_Aeromonas_hydrophila           DSFDTPDTHWVLIEDE---EGLCGCIRLLSCAKDYMLP-SIFPTALAGE- 89
LuxI_Rhizobium_sp_NGR234            DTFDDLQPTYILAVSSN--DRVVGCARLLPALGPTMVA-NVFPSLLSAG- 91
LuxI_Agrobacterium_tumefaciens      DQYDELSPTYILATFGG--QRVVGCARLLAPSGPTMLE-RTFPQLLATG- 91
LuxI_Pantoea_agglomerans            DEFDNSGTRYMLGIYDN--QLVC-SVRFIDLRLPNMIT-HTFQHLFGDV- 89
LuxI_Yersinia_ruckeri               DEYDNPNTRYLLGIYGN--QLIC-SVRFIELHRPNMIT-HTFNAQFDDI- 89
LuxI_Pantoea_stewartii              DEFDGPGTRYILGICEG--QLVC-SVRFTSLDRPNMIT-HTFQHCFSDV- 89
LuxI_Pectobacterium_carotovoru      DQYDNNNTTYLFGIKDN--TVIC-SLRFIETKYPNMIT-GTFFPYFKEI- 89
LuxI_2Pectobacterium_carotovor      DQYDDDNATYLFGVEGD--QVIC-SSRLIETKYPNMIT-GTFFPYFEKI- 89
LuxI_Erwinia_chrysanthemi           DEYDNEHTTYLLGVKEG--KVIC-SVRFIEIKYPNMIT-GTFYSYFDNL- 89
LuxI_Erwinia_chrysanthemi_str_      DEYDNEHTTYLLGVKEG--KIIC-SVRFIEMKYPNMIT-GTFFSYFDGL- 89
LuxI_Serratia_liquefaciens          DEYDNRHATYIFGTYQN--HVIC-SLRFIETKYPNMISDGVFDTYFNDI- 90
LuxI_Yersinia_enterocolitica        DQYDDENTNYILGTIDD--TIVC-SVRFIDMKYPTMIT-GPFAPYFSDV- 89
LuxI_Pseudomonas_syringae_pv_t      DEYDNAATTYLVGSWNG--VPLA-GLRLINTCDPYMLE-GPFRSFFDCP- 92
LuxI_Pseudomonas¬_aeruginosa       DGYDALSPYYMLIQEDTPEAQVFGCWRILDTTGPYMLK-NTFPELLHGK- 91
LuxI_Rhizobium_etli                 DRYDEAEDPVYLVTQQPS-GTLTGSLRLLPTTGATMLK-SEFRHFFDQP- 91
                                    * :*                 :    *:       ::    *        

LuxI_Pseudomonas_chlororaphis       APPKHPAIWEMTRFTT-----------REPQLAMPLFWRSLKTASLAGAD 130
LuxI_Pseudomonas_fluorescens        APPRHPAIWEMTRFTT-----------REPQLAMPLFWKTLKTASLAGAD 130
LuxI_Pseudomonas_aeruginosaa        TPPSDPSVWELSRYAASA--------ADDPQLAMKIFWSSLQCAWYLGAS 133
LuxI_Ralstonia_solanacearum         PAPESPGVWELSRFAARSGASR-ARGARPDWAVRPMLASVVQCAAQRGAR 140
LuxI_Ralstonia_solanacearumm        PPPESPEVWELSRFAARSGAPC-PRSGRADWAVRPMLASVVQCAAQRGAR 140
LuxI_Vibrio_fischer                 SAPKDPNIVELSRFAVGKNSSK-INN-SASEITMKLFEAIYKHAVSQGIT 139
LuxI_Vibrio_fischeri_ES114          VAPRDPNIVELSRFAVGKNSSK-INN-SASEITMKLFQAIYKHAVSQGIT 139
LuxI_Listonella_anguillarum         QAPKAKEIYELSRFAVDKDHSA-QLG-GVSNVTLQMFQSLYHHAQQYHIN 139
LuxI_Aeromonas_salmonicida          APPRSSDVWELTRLAIDANRAP-RMGNGVSELTCVIFREVYAFARAKGIR 138
LuxI_Aeromonas_hydrophila           APPRSNDVWELTRLAIDAERAP-RLGNGISELTCIIFREVYAFAKAQGIR 138
LuxI_Rhizobium_sp_NGR234            HLNAHSSMVESSRFCVDTFLAESRGDGSIHEATLTMFAGIIEWSVANRYT 141
LuxI_Agrobacterium_tumefaciens      SLSATTAMIETSRFCVDTTLPTGRAGRQLHLATLTMFAGIIEWSMANGYD 141
LuxI_Pantoea_agglomerans            -KLPEGDYIESSRFFVDKNRAK-ALLGSRYPISYVLFLSMINYARHHGHT 137
LuxI_Yersinia_ruckeri               -ILPEGNYIESSRFFVDKSGAK-TLLGNRYPISYVLFLAVINYTRHHKHT 137
LuxI_Pantoea_stewartii              -TLPAYG-TESSRFFVDKARAR-ALLGEHYPISQVLFLAMVNWAQNNAYG 136
LuxI_Pectobacterium_carotovoru      -NIPEGNYLESSRFFVDKSRAK-DILGNEYPISSMLFLSMINYSKDKGYD 137
LuxI_2Pectobacterium_carotovor      -DIPEGKYIESSRFFVDKARSK-TILGNSYPVSTMFFLATVNYSKSKGYD 137
LuxI_Erwinia_chrysanthemi           -KIPEGNYIESSRFFVDRDRVR-NLIGTRNPACVTLFLAMINYARKYHYD 137
LuxI_Erwinia_chrysanthemi_str_      -NIPEGNYIESSRFFVDRDRVR-NLIGTRNPACLTLFLAMINYARKYHYD 137
LuxI_Serratia_liquefaciens          -KLPDGNYVEASRLFIDKARIQ-ALQLHQAPISAMLFLSMINYARNCGYE 138
LuxI_Yersinia_enterocolitica        -SLPIDGFIESSRFFVEKALAR-DMVGNNSSLSTILFLAMVNYARDRGHK 137
LuxI_Pseudomonas_syringae_pv_t      -APKNAAMAESSRFFVDTARAR-SLGILHAPLTEMLLFSMHNHAALSGLQ 140
LuxI_Pseudomonas¬_aeruginosa       EAPCSPHIWELSRFAINSGQKG---SLGFSDCTLEAMRALARYSLQNDIQ 138
LuxI_Rhizobium_etli                 IDVDSPTTWECTRFCLHPHAGD---MKQSRAVATELLSGLCDLALDTGIE 138
                                             * :*                       :      :      

LuxI_Pseudomonas_chlororaphis       AIVGIVNSTMERYYKINGVHYERLG--PVTVHQNEKILAIKLSAHREHHR 178
LuxI_Pseudomonas_fluorescens        AIVGIVNSTMERYYKINGVKYERLG--SVIDHQNEKILAIKLSAHREHHR 178
LuxI_Pseudomonas_aeruginosaa        SVVAVTTTAMERYFVRNGVILQRLG--PPQKVKGETLVAISFPAYQERGL 181
LuxI_Ralstonia_solanacearum         RLIGVTFVSMVRLFRRIGVRAHHAG--PVRCIGGRPVVACWIDIDASTCA 188
LuxI_Ralstonia_solanacearumm        RLIGATFVSMVRLFRRIGVRAHRAG--PVRCIGGRPVVACWIDIDASTCA 188
LuxI_Vibrio_fischer                 EYVTVTSTAIERFLKRIKVPCHRIGDKEIHVLGDTKSVVLSMPIN-EQFK 188
LuxI_Vibrio_fischeri_ES114          EYVTVTSIAIERFLKRIKVPCHRIGDKEIHLLGNTRSVVLSMPIN-DQFR 188
LuxI_Listonella_anguillarum         AYVTVTSASVEKLIKRMGIPCERLGDKKVHLLGSTRSVALHIPMN-EAYR 188
LuxI_Aeromonas_salmonicida          ELVAVVSLPVERIFRRLGLPIERLGHRQAVDLGAVRGVGIRFHLD-ERFA 187
LuxI_Aeromonas_hydrophila           ELVAVVSLPVERIFRRLGLPIERLGHRQAVDLGAVRGVGIRFHLD-ERFA 187
LuxI_Rhizobium_sp_NGR234            EIVTVTDLRFERILARVGWPLQRIG--EPRPIGATVAVAGTLPAKADTFM 189
LuxI_Agrobacterium_tumefaciens      EIVTATDLRFERILKRAGWPMTRLG--EPVAIGNTVAVAGHLPADRKSFE 189
LuxI_Pantoea_agglomerans            GIYTIVSRAMLTIAKRSGWEIEVIK--EGFVSENEPIYLLRLPIDCHNQH 185
LuxI_Yersinia_ruckeri               GIYTIVSRAMLTILKRSGWQFDVIK--EAFVSEKERIYLLRLPVDKHNQA 185
LuxI_Pantoea_stewartii              NIYTIVSRAMLKILTRSGWQIKVIK--EAFLTEKERIYLLTLPAGQDDKQ 184
LuxI_Pectobacterium_carotovoru      GIYTIVSHPMLTILKRSGWGIRVVE--QGLSEKEERVYLVFLPVDDENQE 185
LuxI_2Pectobacterium_carotovor      GVYTIVSHPMLTILKRSGWKISIVE--QGMSEKHERVYLLFLPVDNESQD 185
LuxI_Erwinia_chrysanthemi           GILTIVSHPMLTLLKRSGWRISIIQ--QGLSEKQERIYLLHLPTDDDSRH 185
LuxI_Erwinia_chrysanthemi_str_      GILTIVSHPMLTLLKRSGWRISIIQ--QGLSEKQEKIYLLHLPTDDESRY 185
LuxI_Serratia_liquefaciens          GIYAIISHPMRIIFQRSGWHISVVK--TGCSEKNKNIYLIYMPIDDANRN 186
LuxI_Yersinia_enterocolitica        GILTVVSRGMFILLKRSGWNITVLN--QGESEKNEVIYLLHLGIDNDSQQ 185
LuxI_Pseudomonas_syringae_pv_t      SIITVVSKAMARIVRKSGWEHHVLS--TGEASPGETVLLLEMPVTADNHQ 188
LuxI_Pseudomonas¬_aeruginosa       TLVTVTTVGVEKMMIRAGLDVSRFG--PHLKIGIERAVALRIELNAKTQI 186
LuxI_Rhizobium_etli                 NIVGVYDVAMVAVYRRIGWRPTPLAR---SRPEIGKLYVGLWDVTADNCR 185
                                             .                                        

LuxI_Pseudomonas_chlororaphis       SAVAP--SAFMSDTLLRETA------------------- 196
LuxI_Pseudomonas_fluorescens        GARLP--SGFTSEALLEETA------------------- 196
LuxI_Pseudomonas_aeruginosaa        EMLLRYHPEWLQGVPLSMAV------------------- 201
LuxI_Ralstonia_solanacearum         ALGIPG-ASVVPGPALQ---------------------- 204
LuxI_Ralstonia_solanacearumm        ALGIPS-ASAAPGPVLQ---------------------- 204
LuxI_Vibrio_fischer                 KAVLN---------------------------------- 193
LuxI_Vibrio_fischeri_ES114          KAVSN---------------------------------- 193
LuxI_Listonella_anguillarum         ASVNA---------------------------------- 193
LuxI_Aeromonas_salmonicida          RAVGHPMQGEYADARELVTE------------------- 207
LuxI_Aeromonas_hydrophila           RAVGQPLQGAYDEARELVTE------------------- 207
LuxI_Rhizobium_sp_NGR234            RLRPANYRSQIISTFG---QSA----------------- 208
LuxI_Agrobacterium_tumefaciens      RVCPPGYRSIIADDNGRPLRSAA---------------- 212
LuxI_Pantoea_agglomerans            LLAKRIRDQSESNIAALCQWPMSLTVTPEQV-------- 216
LuxI_Yersinia_ruckeri               LLASQVNQVLQGSDSALLAWPISLPVIPELV-------- 216
LuxI_Pantoea_stewartii              QLGGDVVSRTGCPPVAVTTWPLTLPV------------- 210
LuxI_Pectobacterium_carotovoru      ALARRINRSGTFMSNELKQWPLRVPAAIAQA-------- 216
LuxI_2Pectobacterium_carotovor      VLVRRINHNQEFVESKLREWPLSFEPMTEPVG------- 217
LuxI_Erwinia_chrysanthemi           ALIERITQMTQAESEQLKTLPLLVPLA------------ 212
LuxI_Erwinia_chrysanthemi_str_      ALIERITRITNAESEQLTTLPLLVPLA------------ 212
LuxI_Serratia_liquefaciens          RLLARINQHATKMG------------------------- 200
LuxI_Yersinia_enterocolitica        QLINKILRVHQVEPKTLETWPIIVPGIIK---------- 214
LuxI_Pseudomonas_syringae_pv_t      RLLGNIALR-QPVTDDLLRWPIALGVSGSAPQACMHSAA 226
LuxI_Pseudomonas¬_aeruginosa       ALYGGVLVEQRLAVS------------------------ 201
LuxI_Rhizobium_etli                 TLRANLSRLLEQASPYPARVLVDGGMR------------ 212
                                                                           
PLEASE NOTE: Showing colors on large alignments is slow.

spacer
spacer