Job Title: gi|4325175|gb|AAD17292.1| autoinducer-2 production...

Show Conserved Domains
  •  
  • Your search is limited to records matching entrez query: txid2 [ORGN].
  •  

RID=604VFAJ4014, gi|4325175|gb|AAD17292.1| autoinducer-2 production protein LuxS [Vibrio harveyi] BLASTP 2.2.16 (Mar-25-2007)
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 604VFAJ4014


Database: Non-redundant SwissProt sequences
           245,584 sequences; 92,640,715 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports

Query=  gi|4325175|gb|AAD17292.1| autoinducer-2 production protein LuxS [Vibrio 
harveyi]
Length=172


Distance tree of resultsNew  
Score E Sequences producing significant alignments: (Bits) Value sp|Q9Z5X1|LUXS_VIBHA S-ribosylhomocysteine lyase (Autoinducer... 345 2e-95 sp|Q6TP45|LUXS_VIBAL S-ribosylhomocysteine lyase (Autoinducer... 335 3e-92 sp|Q87LS4|LUXS_VIBPA S-ribosylhomocysteine lyase (Autoinducer... 332 2e-91 sp|Q9AHK1|LUXS_VIBVU S-ribosylhomocysteine lyase (Autoinducer... 317 7e-87 sp|Q9KUG4|LUXS_VIBCH S-ribosylhomocysteine lyase (Autoinducer... 308 3e-84 sp|Q6LMV3|LUXS_PHOPR S-ribosylhomocysteine lyase (Autoinducer... 294 5e-80 sp|Q8EHW1|LUXS_SHEON S-ribosylhomocysteine lyase (Autoinducer... 279 1e-75 sp|Q9JWB0|LUXS_NEIMA S-ribosylhomocysteine lyase (Autoinducer... 279 1e-75 sp|Q9JXL8|LUXS_NEIMB S-ribosylhomocysteine lyase (Autoinducer... 278 3e-75 sp|Q8FEP8|LUXS_ECOL6 S-ribosylhomocysteine lyase (Autoinducer... 277 5e-75 sp|Q684Q1|LUXS_SERMA S-ribosylhomocysteine lyase (Autoinducer... 276 1e-74 sp|P45578|LUXS_ECOLI S-ribosylhomocysteine lyase (Autoinducer... 275 2e-74 sp|Q83JZ4|LUXS_SHIFL S-ribosylhomocysteine lyase (Autoinducer... 275 2e-74 sp|Q93LC7|LUXS_PROMI S-ribosylhomocysteine lyase (Autoinducer... 275 2e-74 sp|Q8X902|LUXS_ECO57 S-ribosylhomocysteine lyase (Autoinducer... 274 5e-74 sp|Q8KM01|LUXS_PHOLL S-ribosylhomocysteine lyase (Autoinducer... 273 6e-74 sp|Q9L4T0|LUXS_SALTY S-ribosylhomocysteine lyase (Autoinducer... 271 4e-73 sp|Q8ZBU3|LUXS_YERPE S-ribosylhomocysteine lyase (Autoinducer... 271 4e-73 sp|Q8Z4D7|LUXS_SALTI S-ribosylhomocysteine lyase (Autoinducer... 268 2e-72 sp|Q6D1T5|LUXS_ERWCT S-ribosylhomocysteine lyase (Autoinducer... 266 1e-71 sp|P44007|LUXS_HAEIN S-ribosylhomocysteine lyase (Autoinducer... 263 7e-71 sp|P57901|LUXS_PASMU S-ribosylhomocysteine lyase (Autoinducer... 259 1e-69 sp|Q9PN97|LUXS_CAMJE S-ribosylhomocysteine lyase (Autoinducer... 254 4e-68 sp|Q65VI4|LUXS_MANSM S-ribosylhomocysteine lyase (Autoinducer... 254 6e-68 Gene info sp|Q5HTR6|LUXS_CAMJR S-ribosylhomocysteine lyase (Autoinducer... 253 1e-67 Gene info sp|Q7VNV8|LUXS_HAEDU S-ribosylhomocysteine lyase (Autoinducer... 243 9e-65 sp|Q7MQP3|LUXS_WOLSU S-ribosylhomocysteine lyase (Autoinducer... 238 4e-63 sp|Q7VJR7|LUXS_HELHP S-ribosylhomocysteine lyase (Autoinducer... 233 1e-61 sp|Q9XDU6|LUXS_CLOPE S-ribosylhomocysteine lyase (Autoinducer... 147 1e-35 sp|Q9RRU8|LUXS_DEIRA S-ribosylhomocysteine lyase (Autoinducer... 142 2e-34 sp|P65330|LUXS_STAAN S-ribosylhomocysteine lyase (Autoinducer... 125 4e-29 Gene info sp|Q8CNI0|LUXS_STAES S-ribosylhomocysteine lyase (Autoinducer... 123 2e-28 Gene info sp|Q74HV0|LUXS_LACJO S-ribosylhomocysteine lyase (Autoinducer... 120 7e-28 sp|Q6AAL4|LUXS_PROAC S-ribosylhomocysteine lyase (Autoinducer... 120 7e-28 sp|Q72IE6|LUXS_THET2 S-ribosylhomocysteine lyase (Autoinducer... 120 1e-27 Gene info sp|Q9ZMW8|LUXS_HELPJ S-ribosylhomocysteine lyase (Autoinducer... 118 5e-27 Gene info sp|Q92C64|LUXS_LISIN S-ribosylhomocysteine lyase (Autoinducer... 117 6e-27 sp|O24931|LUXS_HELPY S-ribosylhomocysteine lyase (Autoinducer... 116 1e-26 sp|Q836D3|LUXS_ENTFA S-ribosylhomocysteine lyase (Autoinducer... 116 2e-26 sp|Q5QHW1|LUXS_LACRE S-ribosylhomocysteine lyase (Autoinducer... 115 3e-26 sp|Q720D3|LUXS_LISMF S-ribosylhomocysteine lyase (Autoinducer... 114 6e-26 Gene info sp|Q8Y7I9|LUXS_LISMO S-ribosylhomocysteine lyase (Autoinducer... 114 7e-26 sp|Q9CIU0|LUXS_LACLA S-ribosylhomocysteine lyase (Autoinducer... 113 1e-25 sp|Q8KQK6|LUXS_STRGC S-ribosylhomocysteine lyase (Autoinducer... 113 1e-25 sp|Q5KVY8|LUXS_GEOKA S-ribosylhomocysteine lyase (Autoinducer... 113 1e-25 sp|Q8CUK0|LUXS_OCEIH S-ribosylhomocysteine lyase (Autoinducer... 112 2e-25 sp|Q88YI6|LUXS_LACPL S-ribosylhomocysteine lyase (Autoinducer... 112 2e-25 sp|Q9K7K8|LUXS_BACHD S-ribosylhomocysteine lyase (Autoinducer... 112 2e-25 sp|Q8DVK8|LUXS_STRMU S-ribosylhomocysteine lyase (Autoinducer... 111 5e-25 sp|O34667|LUXS_BACSU S-ribosylhomocysteine lyase (Autoinducer... 111 5e-25 sp|Q81KF3|LUXS_BACAN S-ribosylhomocysteine lyase (Autoinducer... 111 5e-25 sp|Q816N5|LUXS_BACCR S-ribosylhomocysteine lyase (Autoinducer... 110 1e-24 Gene info sp|P65335|LUXS_STRR6 S-ribosylhomocysteine lyase (Autoinducer... 109 2e-24 Gene info sp|Q5WDW1|LUXS_BACSK S-ribosylhomocysteine lyase (Autoinducer... 109 2e-24 Gene info sp|P65333|LUXS_STRA5 S-ribosylhomocysteine lyase (Autoinducer... 107 8e-24 sp|Q5XAN3|LUXS_STRP6 S-ribosylhomocysteine lyase (Autoinducer... 106 2e-23 sp|O50164|LUXS_BORBU S-ribosylhomocysteine lyase (Autoinducer... 79.7 2e-15 sp|Q661P2|LUXS_BORGA S-ribosylhomocysteine lyase (Autoinducer... 79.0 3e-15 sp|Q6AQW6|LUXS_DESPS S-ribosylhomocysteine lyase (Autoinducer... 71.6 5e-13 sp|Q97F13|LUXS_CLOAB S-ribosylhomocysteine lyase (Autoinducer... 70.1 1e-12 sp|Q9RLS9|CARY_LACPL Carbamoyl-phosphate synthase arginine-sp... 30.0 1.8 sp|O52703|T2A1_ACEPA Type-2 restriction enzyme ApaLI (Type II... 29.6 2.5 sp|Q6NI36|ISPH_CORDI 4-hydroxy-3-methylbut-2-enyl diphosphate re 28.5 5.4
Alignments
>sp|Q9Z5X1|LUXS_VIBHA S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=172 Score = 345 bits (885), Expect = 2e-95, Method: Composition-based stats. Identities = 172/172 (100%), Positives = 172/172 (100%), Gaps = 0/172 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY Sbjct 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI Sbjct 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRID 172 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRID Sbjct 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRID 172 >sp|Q6TP45|LUXS_VIBAL S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=172 Score = 335 bits (858), Expect = 3e-92, Method: Composition-based stats. Identities = 165/172 (95%), Positives = 170/172 (98%), Gaps = 0/172 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY Sbjct 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVE+QNKI Sbjct 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVESQNKI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRID 172 PELNEYQCGTAAMHSL EA+QIAKNIL+ GV+VNKNDELALPESML+ELRID Sbjct 121 PELNEYQCGTAAMHSLKEAQQIAKNILDAGVSVNKNDELALPESMLKELRID 172 >sp|Q87LS4|LUXS_VIBPA S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=172 Score = 332 bits (851), Expect = 2e-91, Method: Composition-based stats. Identities = 162/172 (94%), Positives = 170/172 (98%), Gaps = 0/172 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY Sbjct 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAW+A+MEDVLKVE+QNKI Sbjct 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWLASMEDVLKVESQNKI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRID 172 PELNEYQCGTAAMHSL+EA+QIAKNIL GV+VNKNDELALPESML+ELR+D Sbjct 121 PELNEYQCGTAAMHSLEEAQQIAKNILAAGVSVNKNDELALPESMLKELRVD 172 >sp|Q9AHK1|LUXS_VIBVU S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|Q7MHS7|LUXS_VIBVY Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=172 Score = 317 bits (811), Expect = 7e-87, Method: Composition-based stats. Identities = 154/172 (89%), Positives = 164/172 (95%), Gaps = 0/172 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHTRM+APAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY Sbjct 1 MPLLDSFTVDHTRMHAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR HLNG SVEIIDISPMGCRTGFYMSLIG PSEQ VA AW A+MEDVLKVE+QNKI Sbjct 61 AGFMRKHLNGASVEIIDISPMGCRTGFYMSLIGAPSEQDVASAWTASMEDVLKVESQNKI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRID 172 PELNEYQCGTAAMHSLDEAKQIA+NIL G++VNKNDELALPE+ML+EL++D Sbjct 121 PELNEYQCGTAAMHSLDEAKQIAQNILAAGISVNKNDELALPEAMLKELKVD 172 >sp|Q9KUG4|LUXS_VIBCH S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=172 Score = 308 bits (789), Expect = 3e-84, Method: Composition-based stats. Identities = 147/171 (85%), Positives = 161/171 (94%), Gaps = 0/171 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFT PNKDILSE+GIHTLEHLY Sbjct 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTMPNKDILSERGIHTLEHLY 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMRNHLNG VEIIDISPMGCRTGFYMSLIG P+EQQVA AW+AAM+DVLKVE+Q +I Sbjct 61 AGFMRNHLNGSQVEIIDISPMGCRTGFYMSLIGAPTEQQVAQAWLAAMQDVLKVESQEQI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRI 171 PELNEYQCGTAAMHSL+EAK IAKN++ G++VN+NDELALPESML EL++ Sbjct 121 PELNEYQCGTAAMHSLEEAKAIAKNVIAAGISVNRNDELALPESMLNELKV 171 >sp|Q6LMV3|LUXS_PHOPR S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=172 Score = 294 bits (752), Expect = 5e-80, Method: Composition-based stats. Identities = 144/171 (84%), Positives = 154/171 (90%), Gaps = 0/171 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRF PN DILSE+GIHTLEHLY Sbjct 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFCRPNMDILSERGIHTLEHLY 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMRNHLN + VEIIDISPMGCRTGFYMSLIGTPSEQ VA W AAMEDVL VE+Q++I Sbjct 61 AGFMRNHLNSERVEIIDISPMGCRTGFYMSLIGTPSEQDVAAGWTAAMEDVLNVESQDQI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRI 171 PELNEYQCGT +MHSL+EAK IAK IL G+ VNKNDELALPESML+EL + Sbjct 121 PELNEYQCGTYSMHSLEEAKDIAKTILAEGINVNKNDELALPESMLKELDV 171 >sp|Q8EHW1|LUXS_SHEON S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=169 Score = 279 bits (714), Expect = 1e-75, Method: Composition-based stats. Identities = 132/169 (78%), Positives = 152/169 (89%), Gaps = 0/169 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHTRMNAPAVRVAK M TPKGD ITVFDLRF APNKDILSE+GIHTLEHL+ Sbjct 1 MPLLDSFTVDHTRMNAPAVRVAKHMTTPKGDAITVFDLRFCAPNKDILSERGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR+HLNGD VEIIDISPMGCRTGFYMSLIG P+E+QVADAW+A+MEDVLKV Q++I Sbjct 61 AGFMRDHLNGDDVEIIDISPMGCRTGFYMSLIGVPTERQVADAWLASMEDVLKVVEQSEI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLREL 169 PELNEYQCGT MHSL++A+ IA+NI+ GV+VN+ND+L L + +L +L Sbjct 121 PELNEYQCGTYEMHSLEQAQDIARNIIAAGVSVNRNDDLKLSDEILGKL 169 >sp|Q9JWB0|LUXS_NEIMA S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=168 Score = 279 bits (714), Expect = 1e-75, Method: Composition-based stats. Identities = 134/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSF VDHTRM+APAVRVAKTM TPKGDTITVFDLRF PNK+IL EKGIHTLEHL+ Sbjct 1 MPLLDSFKVDHTRMHAPAVRVAKTMTTPKGDTITVFDLRFCVPNKEILPEKGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR+HLNG+ VEIIDISPMGCRTGFYMSLIGTPSEQQVADAW+A+M+DVL V++Q+KI Sbjct 61 AGFMRDHLNGNGVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWLASMQDVLNVKDQSKI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESML 166 PELNEYQCGT MHSL EA+QIA+N+L VAVNKN+EL L E +L Sbjct 121 PELNEYQCGTYQMHSLAEAQQIAQNVLARKVAVNKNEELTLDEGLL 166 >sp|Q9JXL8|LUXS_NEIMB S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=168 Score = 278 bits (710), Expect = 3e-75, Method: Composition-based stats. Identities = 133/166 (80%), Positives = 149/166 (89%), Gaps = 0/166 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSF VDHTRM+APAVRVAKTM TPKGDTITVFDLRF PNK+IL KGIHTLEHL+ Sbjct 1 MPLLDSFKVDHTRMHAPAVRVAKTMTTPKGDTITVFDLRFCVPNKEILPGKGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR+HLNG+ VEIIDISPMGCRTGFYMSLIGTPSEQQVADAW+A+M+DVL V++Q+KI Sbjct 61 AGFMRDHLNGNGVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWLASMQDVLNVKDQSKI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESML 166 PELNEYQCGT MHSL EA+QIA+N+L VAVNKN+EL L E +L Sbjct 121 PELNEYQCGTYQMHSLAEAQQIAQNVLARKVAVNKNEELTLDEGLL 166 >sp|Q8FEP8|LUXS_ECOL6 S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=171 Score = 277 bits (709), Expect = 5e-75, Method: Composition-based stats. Identities = 133/171 (77%), Positives = 149/171 (87%), Gaps = 0/171 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHTRM APAVRVAKTM TP GD ITVFDLRF PNK+++ E+GIHTLEHL+ Sbjct 1 MPLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMRNHLNG+ VEIIDISPMGCRTGFYMSLIGTP EQ+VADAW AAMEDVLKV++QN+I Sbjct 61 AGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRI 171 PELN YQCGT MHSL EA+ IA+NILE V +N N+ELALP+ L+EL I Sbjct 121 PELNVYQCGTYQMHSLQEAQDIARNILERDVRINSNEELALPKEKLQELHI 171 >sp|Q684Q1|LUXS_SERMA S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=171 Score = 276 bits (705), Expect = 1e-74, Method: Composition-based stats. Identities = 133/171 (77%), Positives = 149/171 (87%), Gaps = 0/171 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHTRM APAVRVAKTM+TP GDTITVFDLRF PN +++ E+GIHTLEHL+ Sbjct 1 MPLLDSFTVDHTRMAAPAVRVAKTMKTPHGDTITVFDLRFCRPNLEVMPERGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR+HLNG VEIIDISPMGCRTGFYMSLIG P EQ+VADAW AAM DVLKV +Q KI Sbjct 61 AGFMRDHLNGQGVEIIDISPMGCRTGFYMSLIGVPEEQRVADAWKAAMADVLKVTDQRKI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRI 171 PELNEYQCGT MHSL+EA++IAK+IL+ GV VN NDELALP+ L+EL I Sbjct 121 PELNEYQCGTYHMHSLEEAQEIAKHILDNGVVVNHNDELALPKEKLQELHI 171 >sp|P45578|LUXS_ECOLI S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=171 Score = 275 bits (704), Expect = 2e-74, Method: Composition-based stats. Identities = 132/171 (77%), Positives = 149/171 (87%), Gaps = 0/171 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHTRM APAVRVAKTM TP GD ITVFDLRF PNK+++ E+GIHTLEHL+ Sbjct 1 MPLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMRNHLNG+ VEIIDISPMGCRTGFYMSLIGTP EQ+VADAW AAMEDVLKV++QN+I Sbjct 61 AGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRI 171 PELN YQCGT MHSL EA+ IA++ILE V +N N+ELALP+ L+EL I Sbjct 121 PELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI 171 >sp|Q83JZ4|LUXS_SHIFL S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=171 Score = 275 bits (703), Expect = 2e-74, Method: Composition-based stats. Identities = 132/171 (77%), Positives = 149/171 (87%), Gaps = 0/171 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHTRM APAVRVAKTM TP GD ITVFDLRF PNK+++ E+GIHTLEHL+ Sbjct 1 MPLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMRNHLNG+ VEIIDISPMGCRTGFYMSLIGTP EQ+VADAW AAMEDVLKV++QN+I Sbjct 61 AGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRI 171 PELN YQCGT MHSL EA+ IA++ILE V +N N+ELALP+ L+EL I Sbjct 121 PELNVYQCGTYQMHSLQEAQDIARSILEREVRINSNEELALPKEKLQELHI 171 >sp|Q93LC7|LUXS_PROMI S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=171 Score = 275 bits (703), Expect = 2e-74, Method: Composition-based stats. Identities = 133/171 (77%), Positives = 149/171 (87%), Gaps = 0/171 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHTRM+APAVRVAKTM+TP GDTITVFDLRFT PNK + EKGIHTLEHL+ Sbjct 1 MPLLDSFTVDHTRMSAPAVRVAKTMKTPSGDTITVFDLRFTVPNKKAMPEKGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMRNHLNG+ VEIIDISPMGCRTGFYMSLIG P EQ+VA+AW AAMEDVLKV++QN I Sbjct 61 AGFMRNHLNGEGVEIIDISPMGCRTGFYMSLIGQPDEQRVANAWKAAMEDVLKVKDQNHI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRI 171 PELN YQCGT MHSL EA+ IA++IL + +N NDELALPE L+EL+I Sbjct 121 PELNVYQCGTYEMHSLAEAQDIARDILSHTIGINHNDELALPEDKLKELQI 171 >sp|Q8X902|LUXS_ECO57 S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=171 Score = 274 bits (700), Expect = 5e-74, Method: Composition-based stats. Identities = 131/171 (76%), Positives = 148/171 (86%), Gaps = 0/171 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHTRM APAVRVAKTM TP GD ITVFDLRF PNK+++ E+GIHTLEHL+ Sbjct 1 MPLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMRNHLNG+ VEIIDISPMGCRTGFYMSLIGTP EQ+VAD W AAMEDVLKV++QN+I Sbjct 61 AGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADVWKAAMEDVLKVQDQNQI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRI 171 PELN YQCGT MHSL EA+ IA++ILE V +N N+ELALP+ L+EL I Sbjct 121 PELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI 171 >sp|Q8KM01|LUXS_PHOLL S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=171 Score = 273 bits (699), Expect = 6e-74, Method: Composition-based stats. Identities = 133/171 (77%), Positives = 149/171 (87%), Gaps = 0/171 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHTRMNAPAVRVAKTM+TP GDTITVFDLRF PNK ++ EKGIHTLEHL+ Sbjct 1 MPLLDSFTVDHTRMNAPAVRVAKTMKTPHGDTITVFDLRFCIPNKQVMPEKGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMRNHLNG+ VEIIDISPMGCRTGFYMSLIG P+E +VADAW AAM DVLKV++Q++I Sbjct 61 AGFMRNHLNGEGVEIIDISPMGCRTGFYMSLIGEPAEVRVADAWKAAMADVLKVKDQSQI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRI 171 PELN YQCGT MHSL EA+ IA +IL+ V VNKNDELALPE L EL++ Sbjct 121 PELNIYQCGTYHMHSLTEAQDIAHHILDSDVLVNKNDELALPEEKLTELKV 171 >sp|Q9L4T0|LUXS_SALTY S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|Q5PF11|LUXS_SALPA S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=171 Score = 271 bits (693), Expect = 4e-73, Method: Composition-based stats. Identities = 131/171 (76%), Positives = 146/171 (85%), Gaps = 0/171 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSF VDHTRM APAVRVAKTM TP GD ITVFDLRF PNK+++ EKGIHTLEHL+ Sbjct 1 MPLLDSFAVDHTRMQAPAVRVAKTMNTPHGDAITVFDLRFCIPNKEVMPEKGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR+HLNG+ VEIIDISPMGCRTGFYMSLIGTP EQ+VADAW AAM DVLKV++QN+I Sbjct 61 AGFMRDHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMADVLKVQDQNQI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRI 171 PELN YQCGT MHSL EA+ IA++ILE V VN N ELALP+ L+EL I Sbjct 121 PELNVYQCGTYQMHSLSEAQDIARHILERDVRVNSNKELALPKEKLQELHI 171 >sp|Q8ZBU3|LUXS_YERPE S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|Q66E63|LUXS_YERPS S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=171 Score = 271 bits (692), Expect = 4e-73, Method: Composition-based stats. Identities = 132/171 (77%), Positives = 147/171 (85%), Gaps = 0/171 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHT M APAVRVAKTM+TP GD ITVFDLRF PNK+++ EKGIHTLEHL+ Sbjct 1 MPLLDSFTVDHTIMKAPAVRVAKTMKTPHGDEITVFDLRFCVPNKEVMPEKGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR+HLNGD VEIIDISPMGCRTGFYMSLIGTP EQ+VADAW AAM DVLKV +Q KI Sbjct 61 AGFMRDHLNGDGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMADVLKVTDQRKI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRI 171 PELNEYQCGT MHSL+EA+ IAK+IL+ V +N N+ELALP+ L EL I Sbjct 121 PELNEYQCGTYHMHSLEEAQSIAKDILDRDVRINHNEELALPKEKLTELHI 171 >sp|Q8Z4D7|LUXS_SALTI S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=171 Score = 268 bits (686), Expect = 2e-72, Method: Composition-based stats. Identities = 130/171 (76%), Positives = 145/171 (84%), Gaps = 0/171 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSF VDHTRM APAVR AKTM TP GD ITVFDLRF PNK+++ EKGIHTLEHL+ Sbjct 1 MPLLDSFAVDHTRMQAPAVRGAKTMNTPHGDAITVFDLRFCIPNKEVMPEKGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR+HLNG+ VEIIDISPMGCRTGFYMSLIGTP EQ+VADAW AAM DVLKV++QN+I Sbjct 61 AGFMRDHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMADVLKVQDQNQI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRI 171 PELN YQCGT MHSL EA+ IA++ILE V VN N ELALP+ L+EL I Sbjct 121 PELNVYQCGTYQMHSLSEAQDIARHILERDVRVNSNKELALPKEKLQELHI 171 >sp|Q6D1T5|LUXS_ERWCT S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=171 Score = 266 bits (680), Expect = 1e-71, Method: Composition-based stats. Identities = 126/171 (73%), Positives = 148/171 (86%), Gaps = 0/171 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSFTVDHTRM APAVRVAKTM+TP GD ITVFDLRF PN +++ E+GIHTLEHL+ Sbjct 1 MPLLDSFTVDHTRMAAPAVRVAKTMKTPHGDNITVFDLRFCRPNIEVMPERGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR+HLNGD VEIIDISPMGCRTGFYMSLIGTP EQ+VA++W AAM DVLKV +Q KI Sbjct 61 AGFMRDHLNGDGVEIIDISPMGCRTGFYMSLIGTPDEQRVAESWKAAMSDVLKVTDQRKI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLRELRI 171 PELNEYQCGT MHSL EA++IA++I++ + +N+ND+LALP+ L EL I Sbjct 121 PELNEYQCGTYDMHSLKEAQEIAQHIVDHDIGINQNDDLALPKDKLAELHI 171 >sp|P44007|LUXS_HAEIN S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=167 Score = 263 bits (673), Expect = 7e-71, Method: Composition-based stats. Identities = 121/167 (72%), Positives = 148/167 (88%), Gaps = 0/167 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSF VDHT+MNAPAVR+AKTM TPKGD ITVFDLRF PNK+ILS KGIHTLEHL+ Sbjct 1 MPLLDSFKVDHTKMNAPAVRIAKTMLTPKGDNITVFDLRFCIPNKEILSPKGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR+HLNGDS+EIIDISPMGCRTGFYMSLIGTP+EQ+V++AW+A+M+DVL V++Q I Sbjct 61 AGFMRDHLNGDSIEIIDISPMGCRTGFYMSLIGTPNEQKVSEAWLASMQDVLGVQDQASI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESMLR 167 PELN YQCG+ HSL++A +IAKN++ G+ VNKN++L+L S+L+ Sbjct 121 PELNIYQCGSYTEHSLEDAHEIAKNVIARGIGVNKNEDLSLDNSLLK 167 >sp|P57901|LUXS_PASMU S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=168 Score = 259 bits (662), Expect = 1e-69, Method: Composition-based stats. Identities = 123/156 (78%), Positives = 137/156 (87%), Gaps = 0/156 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSF VDHTRM APAVR+AKTM TPKGD ITVFDLRF PNK+ILS KGIHTLEHL+ Sbjct 1 MPLLDSFKVDHTRMKAPAVRIAKTMTTPKGDNITVFDLRFCIPNKEILSPKGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR+HLNG VEIIDISPMGCRTGFYMSLIGTP+EQQVADAW+A+M DVL V++Q +I Sbjct 61 AGFMRDHLNGTEVEIIDISPMGCRTGFYMSLIGTPNEQQVADAWLASMRDVLLVKDQAQI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKN 156 PELN +QCGT HSL EA+QIA N+LE GV+VNKN Sbjct 121 PELNAFQCGTYTEHSLAEAQQIAHNVLERGVSVNKN 156 >sp|Q9PN97|LUXS_CAMJE S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=164 Score = 254 bits (649), Expect = 4e-68, Method: Composition-based stats. Identities = 120/161 (74%), Positives = 139/161 (86%), Gaps = 0/161 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSF VDHT+M APAVR+AK M+TPKGD I+VFDLRF PNKDI+SEKG HTLEHL+ Sbjct 1 MPLLDSFKVDHTKMPAPAVRLAKVMKTPKGDDISVFDLRFCIPNKDIMSEKGTHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR+HLN +SVEIIDISPMGCRTGFYMSLIGTP E+ +A AW AAM+DVL V +Q+KI Sbjct 61 AGFMRDHLNSNSVEIIDISPMGCRTGFYMSLIGTPDEKSIAKAWEAAMKDVLSVSDQSKI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELAL 161 PELN YQCGT AMHSLDEAKQIA+ +L +G+++ N EL L Sbjct 121 PELNIYQCGTCAMHSLDEAKQIAQKVLNLGISIINNKELKL 161 >sp|Q65VI4|LUXS_MANSM Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=168 Score = 254 bits (648), Expect = 6e-68, Method: Composition-based stats. Identities = 119/156 (76%), Positives = 136/156 (87%), Gaps = 0/156 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSF VDHT M APAVRVAK M+TPKGD ITVFDLRF PNK+ILS KGIHTLEHL+ Sbjct 1 MPLLDSFKVDHTVMKAPAVRVAKIMRTPKGDDITVFDLRFCVPNKEILSPKGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR HLNGDSVEIIDISPMGCRTGFYMSLIGTP+EQQVADAW+A+M DVL V++Q+ I Sbjct 61 AGFMREHLNGDSVEIIDISPMGCRTGFYMSLIGTPNEQQVADAWLASMRDVLTVQDQSTI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKN 156 PELN YQCGT HSL +A + A++++E G+A+NKN Sbjct 121 PELNIYQCGTYTEHSLADAHETARHVIEKGIAINKN 156 >sp|Q5HTR6|LUXS_CAMJR Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=164 Score = 253 bits (646), Expect = 1e-67, Method: Composition-based stats. Identities = 120/161 (74%), Positives = 138/161 (85%), Gaps = 0/161 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSF VDHT+M APAVR+AK M+TPKGD I+VFDLRF PNKDI+SEKG HTLEHL+ Sbjct 1 MPLLDSFKVDHTKMPAPAVRLAKVMKTPKGDDISVFDLRFCIPNKDIMSEKGTHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR+HLN +SVEIIDISPMGCRTGFYMSLIGTP E+ VA AW AM+DVL V +Q+KI Sbjct 61 AGFMRDHLNSNSVEIIDISPMGCRTGFYMSLIGTPDEKSVAKAWEEAMKDVLSVSDQSKI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELAL 161 PELN YQCGT AMHSLDEAKQIA+ +L +G+++ N EL L Sbjct 121 PELNIYQCGTCAMHSLDEAKQIAQKVLNLGISIMNNKELKL 161 >sp|Q7VNV8|LUXS_HAEDU S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=169 Score = 243 bits (620), Expect = 9e-65, Method: Composition-based stats. Identities = 119/167 (71%), Positives = 137/167 (82%), Gaps = 1/167 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSF VDHTRMNAPAVRVAKT+ TPKGD ITVFDLRF PN +I+S KGIHTLEHLY Sbjct 1 MPLLDSFKVDHTRMNAPAVRVAKTITTPKGDLITVFDLRFCRPNMEIMSSKGIHTLEHLY 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVL-KVENQNK 119 AGFMR+HLN D VEIIDISPMGCRTGFYMSLIG PS Q VA+AW AM D+L KV + + Sbjct 61 AGFMRDHLNSDKVEIIDISPMGCRTGFYMSLIGEPSAQAVANAWKNAMHDILTKVSDVTQ 120 Query 120 IPELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPESML 166 IPELN YQCGT + HSL++A QIA+++L G++VN N++L L E L Sbjct 121 IPELNIYQCGTFSEHSLEDAHQIARDVLAKGISVNLNEDLTLDEEWL 167 >sp|Q7MQP3|LUXS_WOLSU S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=163 Score = 238 bits (606), Expect = 4e-63, Method: Composition-based stats. Identities = 109/161 (67%), Positives = 134/161 (83%), Gaps = 0/161 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSF VDHT+M APAVR+AKTM TPKGD I VFDLRF PN++ILSEKGIHTLEHL+ Sbjct 1 MPLLDSFKVDHTKMPAPAVRLAKTMTTPKGDEIAVFDLRFCRPNQEILSEKGIHTLEHLF 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR HLNG+ +EIIDISPMGCRTGFYMSLIG P +V +AW +MED+L ++++ +I Sbjct 61 AGFMREHLNGEGIEIIDISPMGCRTGFYMSLIGVPKNARVLEAWRRSMEDILTLKSEEEI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELAL 161 PELN YQCGTA MHSL EA++IA+ +L+ G+++ N+ L L Sbjct 121 PELNIYQCGTACMHSLKEAQEIARTVLDRGISIMDNEALKL 161 >sp|Q7VJR7|LUXS_HELHP S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=165 Score = 233 bits (594), Expect = 1e-61, Method: Composition-based stats. Identities = 111/163 (68%), Positives = 133/163 (81%), Gaps = 0/163 (0%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MPLLDSF VDHT+M APAVR+AKTMQTPKGDTI+VFDLRFT PN ++LSEKGIHT+EHL Sbjct 1 MPLLDSFKVDHTKMPAPAVRLAKTMQTPKGDTISVFDLRFTRPNCELLSEKGIHTMEHLI 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR HLN VEIIDISPMGCRTGFYMS++G P+E V +AW ++M DVL++ ++ I Sbjct 61 AGFMREHLNNTRVEIIDISPMGCRTGFYMSVVGAPNEYNVKEAWESSMRDVLRICDEKDI 120 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNKNDELALPE 163 PELN YQCGTA MHSL EA+ IA+ +L+ GV+V EL L + Sbjct 121 PELNIYQCGTAKMHSLKEAQDIAQVVLDKGVSVMNTQELLLKD 163 >sp|Q9XDU6|LUXS_CLOPE S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=151 Score = 147 bits (370), Expect = 1e-35, Method: Composition-based stats. Identities = 73/152 (48%), Positives = 103/152 (67%), Gaps = 7/152 (4%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 M ++SF +DHT++ AP VR A PKGD ++ FDLRF PNK++LS+KG+HTLEH Sbjct 1 MVKVESFELDHTKVKAPYVRKAGIKIGPKGDIVSKFDLRFVQPNKELLSDKGMHTLEHFL 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AGFMR L+ ++IDISPMGC+TGFY++ G + + +A ++ VL+ Q +I Sbjct 61 AGFMREKLD----DVIDISPMGCKTGFYLTSFGDIDVKDIIEALEYSLSKVLE---QEEI 113 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVA 152 P NE QCG+A +HSL+ AK AK +LE G++ Sbjct 114 PAANELQCGSAKLHSLELAKSHAKQVLENGIS 145 >sp|Q9RRU8|LUXS_DEIRA S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=158 Score = 142 bits (359), Expect = 2e-34, Method: Composition-based stats. Identities = 71/155 (45%), Positives = 102/155 (65%), Gaps = 6/155 (3%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 M ++SF +DHT++ AP VR+A TPKGD I+ +DLRF PN+ + IHTLEHL Sbjct 4 MANVESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLL 63 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AG+MR+HL G ++D+SPMGCRTG YM++IG P EQ V A+ AA++D + I Sbjct 64 AGYMRDHLEG----VVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDT--AGHDQPI 117 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVNK 155 P ++E +CG H L A+Q A+++L+ G+ V + Sbjct 118 PGVSELECGNYRDHDLAAARQHARDVLDQGLKVQE 152 >sp|P65330|LUXS_STAAN Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|P65331|LUXS_STAAW Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|P65329|LUXS_STAAM Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|Q6G7H6|LUXS_STAAS Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|Q6GEU1|LUXS_STAAR Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|Q5HE66|LUXS_STAAC Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=156 Score = 125 bits (313), Expect = 4e-29, Method: Composition-based stats. Identities = 65/145 (44%), Positives = 94/145 (64%), Gaps = 7/145 (4%) Query 4 LDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLYAGF 63 ++SF +DHT++ AP +R+A TM+ GD I +D+RF PNK+ + G+H+LEHL A Sbjct 6 VESFNLDHTKVVAPFIRLAGTMEGLNGDVIHKYDIRFKQPNKEHMDMPGLHSLEHLMAEN 65 Query 64 MRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKIPEL 123 +RNH S +++D+SPMGC+TGFY+S I + V + A + DVL N ++P Sbjct 66 IRNH----SDKVVDLSPMGCQTGFYVSFINHDNYDDVLNIVEATLNDVL---NATEVPAC 118 Query 124 NEYQCGTAAMHSLDEAKQIAKNILE 148 NE QCG AA HSL+ AK IA+ L+ Sbjct 119 NEVQCGWAASHSLEGAKTIAQAFLD 143 >sp|Q8CNI0|LUXS_STAES Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|Q5HM88|LUXS_STAEQ Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=156 Score = 123 bits (308), Expect = 2e-28, Method: Composition-based stats. Identities = 63/145 (43%), Positives = 93/145 (64%), Gaps = 7/145 (4%) Query 4 LDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLYAGF 63 ++SF +DHT++ AP +R+A TM+ GD I +D+RF PNK+ + G+H+LEHL A Sbjct 6 VESFNLDHTKVVAPFIRLAGTMEGLNGDVIHKYDIRFKQPNKEHMDMPGLHSLEHLMAEN 65 Query 64 MRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKIPEL 123 +RNH + +++D+SPMGC+TGFY+S I V + + DVL N +++P Sbjct 66 IRNHTD----KVVDLSPMGCQTGFYVSFINHDDYDDVLNIIDQTLHDVL---NASEVPAC 118 Query 124 NEYQCGTAAMHSLDEAKQIAKNILE 148 NE QCG AA HSL+ AK IA+ L+ Sbjct 119 NEVQCGWAASHSLEGAKTIAQAFLD 143 >sp|Q74HV0|LUXS_LACJO S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=158 Score = 120 bits (302), Expect = 7e-28, Method: Composition-based stats. Identities = 61/152 (40%), Positives = 91/152 (59%), Gaps = 4/152 (2%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 M ++SF +DHT++ AP VR+ + KGD I+ FDLR PN++ + G+HT+EHL Sbjct 1 MGKVESFELDHTKVKAPYVRLITVEEGQKGDKISNFDLRLVQPNENAIPTGGLHTIEHLL 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AG +R+ ++G ID SP GCRTGF++ + GTPS VA A ++E++ + Sbjct 61 AGLLRDRIDG----YIDCSPFGCRTGFHLLVWGTPSTTDVAKALKESLEEIRDNITWEDV 116 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVA 152 P CG HSL AKQ +++ILE G++ Sbjct 117 PGTTIESCGNYRDHSLFSAKQWSRDILEKGIS 148 >sp|Q6AAL4|LUXS_PROAC S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=154 Score = 120 bits (302), Expect = 7e-28, Method: Composition-based stats. Identities = 61/144 (42%), Positives = 86/144 (59%), Gaps = 7/144 (4%) Query 4 LDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLYAGF 63 ++SF +DHT++ AP VRVA P GDT+T +D+RF PNK+ L +H+LEH +A Sbjct 7 VESFNLDHTKVAAPFVRVADVKHLPAGDTLTKYDVRFCQPNKEHLDMPAVHSLEHSFAEC 66 Query 64 MRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKIPEL 123 +RNH S +ID PMGC+TGFY+ +IG P + + D+LK+ N P Sbjct 67 VRNH----SDAVIDFGPMGCQTGFYLIMIGEPDVSGTCELVETTLRDILKL---NTTPAA 119 Query 124 NEYQCGTAAMHSLDEAKQIAKNIL 147 NE QCG A HS+ A++ A +L Sbjct 120 NEVQCGWGANHSIKAAQEAAHTML 143 >sp|Q72IE6|LUXS_THET2 Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=155 Score = 120 bits (300), Expect = 1e-27, Method: Composition-based stats. Identities = 62/153 (40%), Positives = 96/153 (62%), Gaps = 7/153 (4%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 M ++SF++DHT++ AP VR+A + G + +DLR PN++ L +HTLEHL Sbjct 1 MAEVESFSLDHTKVKAPYVRLAGR-KALAGGVVEKYDLRLAQPNREALPTGALHTLEHLL 59 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AG++R+HL G +ID+SPMGCRTGFY+ + G E++V +A+ A++DVL E + + Sbjct 60 AGYLRDHLPG----VIDLSPMGCRTGFYLVVEGPVGEEKVLEAFAQALKDVLAHEGE--V 113 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVAV 153 P + +CG H L AK A+ +L+ G+ V Sbjct 114 PGASFRECGNYRDHDLPGAKAWAEKVLKAGLRV 146 >sp|Q9ZMW8|LUXS_HELPJ Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=152 Score = 118 bits (295), Expect = 5e-27, Method: Composition-based stats. Identities = 57/145 (39%), Positives = 92/145 (63%), Gaps = 7/145 (4%) Query 4 LDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLYAGF 63 ++SF +DHT++ AP VR+A + GD I +D+RF PN+D + +H+LEHL A Sbjct 5 VESFNLDHTKVKAPYVRIADRKKGVNGDLIVKYDVRFKQPNRDHMDMPSLHSLEHLVAEI 64 Query 64 MRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKIPEL 123 +RNH N ++D SPMGC+TGFY++++ + ++ + M+DVLK + ++P Sbjct 65 IRNHAN----YVVDWSPMGCQTGFYLTVLNHDNYTEILEVLEKTMQDVLKAK---EVPAS 117 Query 124 NEYQCGTAAMHSLDEAKQIAKNILE 148 NE QCG AA H+L+ A+ +A+ L+ Sbjct 118 NEKQCGWAANHTLEGAQNLARAFLD 142 >sp|Q92C64|LUXS_LISIN S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=155 Score = 117 bits (294), Expect = 6e-27, Method: Composition-based stats. Identities = 61/144 (42%), Positives = 87/144 (60%), Gaps = 7/144 (4%) Query 4 LDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLYAGF 63 ++SF +DHT++ AP VR+A T GD I +D+RF PNK+ + +H+LEHL A Sbjct 7 VESFNLDHTKVKAPFVRLAGTKVGVHGDEIYKYDVRFKQPNKEHMEMPALHSLEHLMAEL 66 Query 64 MRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKIPEL 123 RNH + +++DISPMGC+TGFYMS I + + DVL ++ +P Sbjct 67 ARNHTD----KLVDISPMGCQTGFYMSFINHNDYDDALEILATTLTDVLAADS---VPAC 119 Query 124 NEYQCGTAAMHSLDEAKQIAKNIL 147 NE QCG AA HSL+ AK++A+ L Sbjct 120 NEVQCGWAASHSLEGAKELAEEFL 143 >sp|O24931|LUXS_HELPY S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=155 Score = 116 bits (291), Expect = 1e-26, Method: Composition-based stats. Identities = 58/145 (40%), Positives = 91/145 (62%), Gaps = 7/145 (4%) Query 4 LDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLYAGF 63 ++SF +DHT++ AP VRVA + GD I +D+RF PN+D + +H+LEHL A Sbjct 8 VESFNLDHTKVKAPYVRVADRKKGVNGDLIVKYDVRFKQPNQDHMDMPSLHSLEHLVAEI 67 Query 64 MRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKIPEL 123 +RNH + ++D SPMGC+TGFY++++ + ++ + M+DVLK ++P Sbjct 68 IRNH----ASYVVDWSPMGCQTGFYLTVLNHDNYTEILEVLEKTMQDVLKA---TEVPAS 120 Query 124 NEYQCGTAAMHSLDEAKQIAKNILE 148 NE QCG AA H+L+ AK +A+ L+ Sbjct 121 NEKQCGWAANHTLEGAKDLARAFLD 145 >sp|Q836D3|LUXS_ENTFA S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=152 Score = 116 bits (291), Expect = 2e-26, Method: Composition-based stats. Identities = 68/155 (43%), Positives = 93/155 (60%), Gaps = 10/155 (6%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDT-ITVFDLRFTAPNKDILSEKGIHTLEHL 59 M ++SF +DH + AP VR+A T Q GD + +DLRF PNKD L +HTLEHL Sbjct 1 MARVESFELDHNTVKAPYVRLAGTEQN--GDALVEKYDLRFLQPNKDALPTGALHTLEHL 58 Query 60 YAGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNK 119 A MR+ L G IIDISPMGCRTGFYM + S Q++ DA + + KV N Sbjct 59 LAVNMRDELKG----IIDISPMGCRTGFYMIMWDQHSPQEIRDALVNVLN---KVINTEV 111 Query 120 IPELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVN 154 +P ++ +CG HSL AK+ AK +L+ G++++ Sbjct 112 VPAVSAKECGNYKDHSLFAAKEYAKIVLDQGISLD 146 >sp|Q5QHW1|LUXS_LACRE S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=158 Score = 115 bits (288), Expect = 3e-26, Method: Composition-based stats. Identities = 58/152 (38%), Positives = 90/152 (59%), Gaps = 4/152 (2%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 M ++SFT+DHT++ AP VR+ + KGD I+ +DLR PN++ + G+HT+EHL Sbjct 1 MAKVESFTLDHTKVKAPYVRLITVEEGAKGDKISNYDLRLVQPNENAIPTAGLHTIEHLL 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AG +R+ L+G +ID SP GCRTGF++ G S +VA A +++E++ + Sbjct 61 AGLLRDRLDG----VIDCSPFGCRTGFHLITWGEHSTTEVAKALKSSLEEIAYKTKWEDV 116 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVA 152 CG HSL AK+ +K IL+ G++ Sbjct 117 QGTTIESCGNYRDHSLFSAKEWSKKILDEGIS 148 >sp|Q720D3|LUXS_LISMF Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=155 Score = 114 bits (286), Expect = 6e-26, Method: Composition-based stats. Identities = 60/145 (41%), Positives = 85/145 (58%), Gaps = 7/145 (4%) Query 4 LDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLYAGF 63 ++SF +DHT++ AP VR+A T GD I +D+RF PNK+ + +H+LEHL A Sbjct 7 VESFNLDHTKVKAPFVRLAGTKVGVHGDEIYKYDVRFKQPNKEHMEMPALHSLEHLMAEL 66 Query 64 MRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKIPEL 123 RNH + +++DISPMGC+TGFY+S I + + DVL ++P Sbjct 67 ARNHTD----KLVDISPMGCQTGFYVSFINHSDYDDALEIIATTLTDVLAA---TEVPAC 119 Query 124 NEYQCGTAAMHSLDEAKQIAKNILE 148 NE QCG AA HSL+ AK +A L+ Sbjct 120 NEVQCGWAASHSLEGAKALAAEFLD 144 >sp|Q8Y7I9|LUXS_LISMO S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=155 Score = 114 bits (285), Expect = 7e-26, Method: Composition-based stats. Identities = 60/144 (41%), Positives = 85/144 (59%), Gaps = 7/144 (4%) Query 4 LDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLYAGF 63 ++SF +DHT++ AP VR+A T GD I +D+RF PNK+ + +H+LEHL A Sbjct 7 VESFNLDHTKVKAPFVRLAGTKVGVHGDEIYKYDVRFKQPNKEHMEMPALHSLEHLMAEL 66 Query 64 MRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKIPEL 123 RNH + +++DISPMGC+TGFY+S I + + DVL ++P Sbjct 67 ARNHTD----KLVDISPMGCQTGFYVSFINHSDYDDALEIIATTLTDVLVA---TEVPAC 119 Query 124 NEYQCGTAAMHSLDEAKQIAKNIL 147 NE QCG AA HSL+ AK +A+ L Sbjct 120 NEVQCGWAASHSLEGAKALAEEFL 143 >sp|Q9CIU0|LUXS_LACLA S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=158 Score = 113 bits (283), Expect = 1e-25, Method: Composition-based stats. Identities = 57/155 (36%), Positives = 94/155 (60%), Gaps = 5/155 (3%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 M ++SF +DHT++ AP VR+ + PKGD IT FD+RF PN + + +HT+EH Sbjct 1 MAEVESFQLDHTKVLAPYVRLIGSETGPKGDVITNFDVRFVQPNANAIGMAALHTIEHSM 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVE-NQNK 119 A +R+ ++G +ID SP GC+TGF+M + G S +++A +++E++ E + Sbjct 61 ASLIRDRIDG----MIDFSPFGCQTGFHMIMWGEHSSEEIAKVIKSSLEELASDEFGWDN 116 Query 120 IPELNEYQCGTAAMHSLDEAKQIAKNILEVGVAVN 154 +P + E +CG HSL AK+ +K IL G++ + Sbjct 117 VPGVAEKECGNYRNHSLFGAKEWSKKILSEGISTD 151 >sp|Q8KQK6|LUXS_STRGC S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=160 Score = 113 bits (283), Expect = 1e-25, Method: Composition-based stats. Identities = 57/152 (37%), Positives = 88/152 (57%), Gaps = 4/152 (2%) Query 3 LLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLYAG 62 +++SF +DHT + AP VR+ PKGD I+ FD+R PN+D + G+HT+EHL A Sbjct 6 IVESFELDHTIVKAPYVRLIGEESGPKGDVISNFDIRLVQPNEDSIPTAGLHTIEHLLAM 65 Query 63 FMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKIPE 122 +R ++G +ID SP GCRTGF+M + G + ++A + +E++ + +P Sbjct 66 LIRKRIDG----MIDCSPFGCRTGFHMIMWGRHTPSEIAQVIKSCLEEIAETTTWEDVPG 121 Query 123 LNEYQCGTAAMHSLDEAKQIAKNILEVGVAVN 154 CG HSL AK+ AK IL+ G++ N Sbjct 122 TTIESCGNYKDHSLFSAKEWAKLILKQGISDN 153 >sp|Q5KVY8|LUXS_GEOKA S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=158 Score = 113 bits (283), Expect = 1e-25, Method: Composition-based stats. Identities = 57/142 (40%), Positives = 82/142 (57%), Gaps = 4/142 (2%) Query 4 LDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLYAGF 63 ++SF +DH + AP VR + + FD+RF PNK+ + IHTLEHL A Sbjct 5 VESFELDHCAVKAPYVRHCGVHKVGSDGVVNKFDIRFCQPNKEAMDPAAIHTLEHLLAYT 64 Query 64 MRNHLNG-DSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKIPE 122 +R H D +IIDISPMGC+TGFY+ + G+P+ ++ D AM+D L ++P Sbjct 65 LRRHAAKYDHFDIIDISPMGCQTGFYLVVSGSPTVDEIIDLLEEAMKDALAA---TEVPA 121 Query 123 LNEYQCGTAAMHSLDEAKQIAK 144 E QCG A +H L+ AKQ+ + Sbjct 122 ATERQCGQAKLHDLEAAKQLMR 143 >sp|Q8CUK0|LUXS_OCEIH S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=153 Score = 112 bits (281), Expect = 2e-25, Method: Composition-based stats. Identities = 61/144 (42%), Positives = 86/144 (59%), Gaps = 7/144 (4%) Query 4 LDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLYAGF 63 ++SF +DHT++ AP VR+ + GD + +D+R PNK + G+H+LEHL A Sbjct 7 VESFNLDHTKVKAPYVRLVGVTEGANGDKVHKYDIRIKQPNKAHMEMPGLHSLEHLMAEN 66 Query 64 MRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKIPEL 123 +RNH S ++DI PMGC+TGFY+SLI V +EDVL+ ++P Sbjct 67 IRNH----SDAVLDIGPMGCQTGFYLSLINHDDYDDVLTMIEKTLEDVLQA---TEVPAC 119 Query 124 NEYQCGTAAMHSLDEAKQIAKNIL 147 NE QCG AA HSL A++IAK +L Sbjct 120 NEVQCGWAANHSLLGAQEIAKEML 143 >sp|Q88YI6|LUXS_LACPL S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=158 Score = 112 bits (281), Expect = 2e-25, Method: Composition-based stats. Identities = 60/152 (39%), Positives = 85/152 (55%), Gaps = 4/152 (2%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 M ++SFT+DHT++ AP VR PKGD IT FDLR PNK + G+HT+EH+ Sbjct 1 MAKVESFTLDHTKVLAPYVRKITVENGPKGDAITNFDLRLVQPNKTAIDTAGLHTIEHML 60 Query 61 AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI 120 AG +R+ ++G +ID SP GCRTGF++ G +VA A +++E + + Sbjct 61 AGLLRDRMDG----VIDCSPFGCRTGFHLITWGEHDTVEVAKALKSSLEFIAGPAKWEDV 116 Query 121 PELNEYQCGTAAMHSLDEAKQIAKNILEVGVA 152 CG HSL AK+ AK IL G++ Sbjct 117 QGTTIDSCGNYKDHSLFSAKEWAKLILSQGIS 148 >sp|Q9K7K8|LUXS_BACHD S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=158 Score = 112 bits (280), Expect = 2e-25, Method: Composition-based stats. Identities = 58/143 (40%), Positives = 85/143 (59%), Gaps = 4/143 (2%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MP ++SF +DHT + AP VR T + + FD+RF PNK + IHTLEHL Sbjct 1 MPTVESFELDHTIVKAPFVRPCGTHKVGTNGEVNKFDIRFFQPNKQAMKPDVIHTLEHLL 60 Query 61 AGFMRNHLNG-DSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNK 119 A +R D ++ID+SPMGC+TGFY+ + G P+ +++ D M+ L++E + Sbjct 61 ALNIRKFAEAYDHFDVIDLSPMGCQTGFYLIMSGKPTVEEIIDVLEQTMKYSLELE---E 117 Query 120 IPELNEYQCGTAAMHSLDEAKQI 142 +P NE QCG A +H LD AK++ Sbjct 118 VPAANEKQCGQAKLHDLDGAKKL 140 >sp|Q8DVK8|LUXS_STRMU S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=160 Score = 111 bits (278), Expect = 5e-25, Method: Composition-based stats. Identities = 57/149 (38%), Positives = 86/149 (57%), Gaps = 4/149 (2%) Query 4 LDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLYAGF 63 ++SF +DH + AP VR+ PKGD IT FD+R PN+D + G+HT+EHL A Sbjct 7 VESFELDHIAVKAPYVRLISEEFGPKGDLITNFDIRLVQPNEDSIPTAGLHTIEHLLAKL 66 Query 64 MRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKIPEL 123 +R ++G +ID SP GCRTGF++ + G + Q+A A++E++ + +P Sbjct 67 IRQRIDG----MIDCSPFGCRTGFHLIMWGKHTTTQIATVIKASLEEIANTISWKDVPGT 122 Query 124 NEYQCGTAAMHSLDEAKQIAKNILEVGVA 152 CG HSL AK+ AK IL+ G++ Sbjct 123 TIESCGNYKDHSLFSAKEWAKLILKQGIS 151 >sp|O34667|LUXS_BACSU S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=157 Score = 111 bits (278), Expect = 5e-25, Method: Composition-based stats. Identities = 56/145 (38%), Positives = 85/145 (58%), Gaps = 4/145 (2%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MP ++SF +DH + AP VR + + FD+RF PNK + IHTLEHL Sbjct 1 MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLL 60 Query 61 AGFMRNHLNG-DSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNK 119 A +R+H D +IIDISPMGC+TG+Y+ + G P+ ++ D M++ +++ + Sbjct 61 AFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEI---TE 117 Query 120 IPELNEYQCGTAAMHSLDEAKQIAK 144 IP NE QCG A +H L+ AK++ + Sbjct 118 IPAANEKQCGQAKLHDLEGAKRLMR 142 >sp|Q81KF3|LUXS_BACAN S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|Q632P8|LUXS_BACCZ Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|Q6HC89|LUXS_BACHK S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|Q72YS4|LUXS_BACC1 Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=157 Score = 111 bits (277), Expect = 5e-25, Method: Composition-based stats. Identities = 56/143 (39%), Positives = 86/143 (60%), Gaps = 4/143 (2%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MP ++SF +DHT + AP VR + FD+RF PNK + IHTLEHL Sbjct 1 MPSVESFELDHTIVKAPYVRHCGVHNVGSDGIVNKFDIRFCQPNKQAMKPDVIHTLEHLL 60 Query 61 AGFMRNHLNG-DSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNK 119 A +R +++ +IIDISPMGC+TG+Y+ + GTP+ +++ D ++D +++ + Sbjct 61 AFNLRKYIDRYPHFDIIDISPMGCQTGYYLVVSGTPTVREIIDLLELTLKDAVQI---TE 117 Query 120 IPELNEYQCGTAAMHSLDEAKQI 142 IP NE QCG A +H L+ AK++ Sbjct 118 IPAANETQCGQAKLHDLEGAKRL 140 >sp|Q816N5|LUXS_BACCR Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=157 Score = 110 bits (274), Expect = 1e-24, Method: Composition-based stats. Identities = 55/143 (38%), Positives = 86/143 (60%), Gaps = 4/143 (2%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MP ++SF +DHT + AP VR + FD+RF PNK + IHTLEHL Sbjct 1 MPSVESFELDHTIVKAPYVRHCGVHNVGSDGIVNKFDIRFCQPNKQAMKPDVIHTLEHLL 60 Query 61 AGFMRNHLNG-DSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNK 119 A +R +++ +IIDISPMGC+TG+Y+ + GTP+ +++ D ++D +++ + Sbjct 61 AFNLRKYIDRYPHFDIIDISPMGCQTGYYLVVSGTPTVREIIDLLELTLKDAVQI---TE 117 Query 120 IPELNEYQCGTAAMHSLDEAKQI 142 IP NE QCG A +H L+ A+++ Sbjct 118 IPAANETQCGQAKLHDLEGAQRL 140 >sp|P65335|LUXS_STRR6 Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|P65334|LUXS_STRPN S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=160 Score = 109 bits (273), Expect = 2e-24, Method: Composition-based stats. Identities = 55/150 (36%), Positives = 87/150 (58%), Gaps = 4/150 (2%) Query 3 LLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLYAG 62 +++SF +DHT + AP VR+ PKGD I+ +D+R PN+D + G+HT+EHL A Sbjct 6 IVESFELDHTIVKAPYVRLIGEETGPKGDIISNYDIRLVQPNEDSIPTAGLHTIEHLLAK 65 Query 63 FMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKIPE 122 +R ++G +ID SP GCRTGF+M + G + ++A +++++ + +P Sbjct 66 LIRTRIDG----MIDCSPFGCRTGFHMIMWGRHTSAKIAAVIKDSLKEIAETTTWEDVPG 121 Query 123 LNEYQCGTAAMHSLDEAKQIAKNILEVGVA 152 CG HSL AK+ AK ILE G++ Sbjct 122 TTIESCGNYKDHSLFSAKEWAKLILEQGIS 151 >sp|Q5WDW1|LUXS_BACSK Gene info S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=156 Score = 109 bits (272), Expect = 2e-24, Method: Composition-based stats. Identities = 58/148 (39%), Positives = 83/148 (56%), Gaps = 4/148 (2%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY 60 MP ++SF +DHT + AP VR + + FD+RF PNK+ L IHTLEHL Sbjct 1 MPSVESFELDHTIVKAPYVRHCGKHKIGSDGEVNKFDIRFCQPNKEALKPGVIHTLEHLL 60 Query 61 A-GFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNK 119 A R D ++IDISPMGC+TG+Y+ + GTPS +++ D M L +E Sbjct 61 AINIRRFSEEYDHFDVIDISPMGCQTGYYLIMSGTPSVEEIIDVLEKTMTYSLSIET--- 117 Query 120 IPELNEYQCGTAAMHSLDEAKQIAKNIL 147 +P E +CG AA+H L+ K++ + L Sbjct 118 VPAATEKECGQAALHDLEGTKEVMRKWL 145 >sp|P65333|LUXS_STRA5 S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|P65332|LUXS_STRA3 S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=160 Score = 107 bits (267), Expect = 8e-24, Method: Composition-based stats. Identities = 56/152 (36%), Positives = 84/152 (55%), Gaps = 4/152 (2%) Query 3 LLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLYAG 62 +++SF +DHT + AP VR+ P GD IT FD+R PN++ + G+HT+EHL A Sbjct 6 VVESFELDHTIVKAPYVRLISEEVGPVGDIITNFDIRLIQPNENAIDTAGLHTIEHLLAK 65 Query 63 FMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKIPE 122 +R +NG +ID SP GCRTGF+M + G ++A +++E + +P Sbjct 66 LIRQRING----LIDCSPFGCRTGFHMIMWGKQDATEIAKVIKSSLEAIAGGVTWEDVPG 121 Query 123 LNEYQCGTAAMHSLDEAKQIAKNILEVGVAVN 154 CG HSL A++ AK IL G++ N Sbjct 122 TTIESCGNYKDHSLHSAQEWAKLILSQGISDN 153 >sp|Q5XAN3|LUXS_STRP6 S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|P0A3P8|LUXS_STRP3 S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|P0A3P9|LUXS_STRP8 S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|P0C0C7|LUXS_STRPY S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) sp|P0C0C8|LUXS_STRP1 S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=160 Score = 106 bits (265), Expect = 2e-23, Method: Composition-based stats. Identities = 54/150 (36%), Positives = 86/150 (57%), Gaps = 4/150 (2%) Query 3 LLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLYAG 62 +++SF +DHT + AP VR+ PKGD IT FD+R PN++ + G+HT+EHL A Sbjct 6 IVESFELDHTIVKAPYVRLISEEFGPKGDRITNFDVRLVQPNQNSIETAGLHTIEHLLAK 65 Query 63 FMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKIPE 122 +R ++G +ID SP GCRTGF++ + G S +A +++E++ +P Sbjct 66 LIRQRIDG----MIDCSPFGCRTGFHLIMWGKHSSTDIAKVIKSSLEEIATGITWEDVPG 121 Query 123 LNEYQCGTAAMHSLDEAKQIAKNILEVGVA 152 CG HSL AK+ A+ I++ G++ Sbjct 122 TTLESCGNYKDHSLFAAKEWAQLIIDQGIS 151 >sp|O50164|LUXS_BORBU S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=157 Score = 79.7 bits (195), Expect = 2e-15, Method: Composition-based stats. Identities = 50/152 (32%), Positives = 82/152 (53%), Gaps = 10/152 (6%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPN-KDILSEKGIHTLEHL 59 M + SFT+DHT++N P + V++ T + T D+R APN + I+ IHT+EH+ Sbjct 1 MKKITSFTIDHTKLN-PGIYVSRK-DTFENVIFTTIDIRIKAPNIEPIIENAAIHTIEHI 58 Query 60 YAGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVAD--AWIAAMEDVLKVENQ 117 A +RN+ + +I+ PMGCRTGFY+ + G + + D +W+ + V Sbjct 59 GATLLRNN-EVWTEKIVYFGPMGCRTGFYLIIFGDYESKDLVDLVSWLFSE----IVNFS 113 Query 118 NKIPELNEYQCGTAAMHSLDEAKQIAKNILEV 149 IP ++ +CG H+LD AK + L++ Sbjct 114 EPIPGASDKECGNYKEHNLDMAKYESSKYLQI 145 >sp|Q661P2|LUXS_BORGA S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=157 Score = 79.0 bits (193), Expect = 3e-15, Method: Composition-based stats. Identities = 49/150 (32%), Positives = 79/150 (52%), Gaps = 6/150 (4%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPN-KDILSEKGIHTLEHL 59 M + SFT+DHT++N P + V++ T + T D+R APN + I+ IHT+EH+ Sbjct 1 MKKITSFTIDHTKLN-PGIYVSRK-DTFENVIFTTIDIRIKAPNIEPIIENAAIHTIEHI 58 Query 60 YAGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNK 119 A +RN+ + +I+ PMGCRTGFY+ + G + + D ++ V Sbjct 59 GATLLRNN-EVWTEKIVYFGPMGCRTGFYLIIFGNYESKDLIDLISWLFSEI--VNFSEP 115 Query 120 IPELNEYQCGTAAMHSLDEAKQIAKNILEV 149 IP + +CG H+LD AK + L++ Sbjct 116 IPGASHKECGNYKDHNLDMAKYESSKYLQI 145 >sp|Q6AQW6|LUXS_DESPS S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=159 Score = 71.6 bits (174), Expect = 5e-13, Method: Composition-based stats. Identities = 49/146 (33%), Positives = 73/146 (50%), Gaps = 10/146 (6%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKD-ILSEKGIHTLEHL 59 M + SFT+DHT++ V V++ + G+ IT FDLR PN + L HT+EH+ Sbjct 1 MEKIASFTIDHTKLKR-GVYVSRQDKV-AGNVITTFDLRLKEPNNEPALDGAASHTIEHI 58 Query 60 YAGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQ-- 117 A F+RNH I PMGC+TGFY+ L G + + + M+++ Q Sbjct 59 GATFLRNHKTWAD-RTIYFGPMGCQTGFYLILAGDWKAKDI----VPLMQEMFAYVAQFT 113 Query 118 NKIPELNEYQCGTAAMHSLDEAKQIA 143 IP + +CG L +AK+ A Sbjct 114 GTIPGESAVECGNFRFMDLIQAKEEA 139 >sp|Q97F13|LUXS_CLOAB S-ribosylhomocysteine lyase (Autoinducer-2 production protein luxS) (AI-2 synthesis protein) Length=158 Score = 70.1 bits (170), Expect = 1e-12, Method: Composition-based stats. Identities = 42/96 (43%), Positives = 60/96 (62%), Gaps = 8/96 (8%) Query 1 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDT-ITVFDLRFTAPNKD-ILSEKGIHTLEH 58 M + SFTV+H + P V V++ + GD IT FD+R T+PN++ +++ +HT+EH Sbjct 1 MEKIASFTVNHLTLQ-PGVYVSR--KDKFGDVVITTFDIRMTSPNEEPVMNTAEVHTIEH 57 Query 59 LYAGFMRNHLNGDSVE-IIDISPMGCRTGFYMSLIG 93 L A F+RNH G E + PMGCRTGFY+ L G Sbjct 58 LGATFLRNH--GTYAEKTVYFGPMGCRTGFYLILQG 91 >sp|Q9RLS9|CARY_LACPL Carbamoyl-phosphate synthase arginine-specific large chain (Carbamoyl-phosphate synthetase ammonia chain) Length=1020 Score = 30.0 bits (66), Expect = 1.8, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 3/66 (4%) Query 30 GDTITVFDLRFTAPN-KDILSEKGIHTLEHLYAGFMRN--HLNGDSVEIIDISPMGCRTG 86 GD+ITV+ + +P +D + +HL+ M N + D V +ID++P RT Sbjct 779 GDSITVYPPQHLSPAVQDKIVTIATKLAQHLHCVGMMNIQFVVTDDVYVIDVNPRASRTV 838 Query 87 FYMSLI 92 YMS + Sbjct 839 PYMSKV 844 >sp|O52703|T2A1_ACEPA Type-2 restriction enzyme ApaLI (Type II restriction enzyme ApaLI) (Endonuclease ApaLI) (R.ApaLI) Length=375 Score = 29.6 bits (65), Expect = 2.5, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 0/31 (0%) Query 130 TAAMHSLDEAKQIAKNILEVGVAVNKNDELA 160 TA M +L EA ++AK I V V + K+DE+A Sbjct 24 TANMRALMEASELAKVIALVAVDIGKSDEMA 54 >sp|Q6NI36|ISPH_CORDI 4-hydroxy-3-methylbut-2-enyl diphosphate reductase Length=333 Score = 28.5 bits (62), Expect = 5.4, Method: Composition-based stats. Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 5/75 (6%) Query 98 QQVADAWIAAMEDVLKV---ENQNKIPELNE--YQCGTAAMHSLDEAKQIAKNILEVGVA 152 +QVA IAA DV+ V +N + L E Q G A + +D A QI ++ L+ Sbjct 222 RQVAVKAIAAESDVVIVVGSQNSSNSKRLVEVALQAGAGASYLVDYAHQIDESWLDGATT 281 Query 153 VNKNDELALPESMLR 167 V + ++PE ++R Sbjct 282 VGVSSGASVPEILVR 296
  Database: Non-redundant SwissProt sequences
    Posted date:  May 31, 2007  5:55 PM
  Number of letters in database: 36,643,602
  Number of sequences in database:  111,733
Lambda     K      H
   0.317    0.133    0.381 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 111733
Number of Hits to DB: 4083580
Number of extensions: 161906
Number of successful extensions: 482
Number of sequences better than 10: 24
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 458
Number of HSP's successfully gapped: 24
Length of query: 172
Length of database: 36643602
Length adjustment: 99
Effective length of query: 73
Effective length of database: 25582035
Effective search space: 1867488555
Effective search space used: 1867488555
T: 11
A: 40
X1: 16 (7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 60 (27.7 bits)