Job Title: gi|297489|emb|CAA68561.1| luxR [Vibrio fischeri]

Show Conserved Domains
  •  
  • Your search is limited to records matching entrez query: txid2 [ORGN].
  •  

RID=604B68S9014, gi|297489|emb|CAA68561.1| luxR [Vibrio fischeri] BLASTP 2.2.16 (Mar-25-2007)
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 604B68S9014


Database: Non-redundant SwissProt sequences
           245,584 sequences; 92,640,715 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports

Query=  gi|297489|emb|CAA68561.1| luxR [Vibrio fischeri]
Length=250


Distance tree of resultsNew  
Score E Sequences producing significant alignments: (Bits) Value sp|P12746|LUXR_VIBFI Transcriptional activator protein luxR 462 3e-130 sp|P35327|LUXS_VIBF1 Transcriptional activator protein luxR 374 1e-103 Gene info sp|P74946|VANR_VIBAN Transcriptional activator protein vanR 161 1e-39 sp|P0A3J5|AHYR_AERHY Transcriptional activator protein ahyR/a... 116 3e-26 sp|O30919|SOLR2_RALSO Transcriptional activator protein solR 109 4e-24 sp|P58590|SOLR1_RALSO Transcriptional activator protein solR 107 2e-23 sp|P25084|LASR_PSEAE Transcriptional activator protein lasR 97.1 3e-20 sp|P07026|SDIA_ECOLI Regulatory protein sdiA 95.5 6e-20 sp|P55629|Y4QH_RHISN Putative HTH-type transcriptional regulator 90.5 2e-18 Gene info sp|Q51786|PHZR_PSEFL Transcriptional activator protein phzR 88.6 9e-18 sp|Q03316|RHIR_RHILV Regulatory protein rhiR 79.7 4e-15 sp|P54303|PHZR_PSECL Transcriptional activator protein phzR 78.6 7e-15 sp|Q46751|CARR_PECCC Transcriptional activator protein carR 75.5 7e-14 sp|Q46967|ECHR_ERWCH Transcriptional activator protein echR 72.8 4e-13 sp|P54292|RHLR_PSEAE Regulatory protein rhlR (Elastase modulator 72.4 6e-13 sp|O87971|YUKR_YERRU Transcriptional activator protein yukR 72.4 7e-13 sp|Q47188|EXPR_DICD3 Transcriptional activator protein expR 67.4 2e-11 sp|P54295|YENR_YEREN Transcriptional activator protein yenR 66.2 4e-11 sp|Q47189|EXPR_PECCC Transcriptional activator protein expR 64.7 1e-10 sp|P54293|ESAR_ERWST Transcriptional activator protein esaR 63.2 3e-10 sp|P55407|TRAR_RHISN Probable transcriptional activator protein 50.8 2e-06 Gene info sp|P54294|TRAR_AGRT5 Transcriptional activator protein traR 50.4 3e-06 Gene info sp|P33905|TRAR_AGRTU Transcriptional activator protein traR 48.1 1e-05 Gene info sp|P13800|DEGU_BACSU Transcriptional regulatory protein degU ... 45.4 7e-05 sp|P33909|TRAR_AGRVI Transcriptional activator protein traR 45.4 8e-05 sp|P11470|GERE_BACSU Germination protein gerE 44.3 2e-04 sp|O54452|RAIR_RHIET Transcriptional activator protein raiR 43.9 2e-04 sp|P56644|SGAR_HYPME Probable transcriptional regulatory protein 43.5 3e-04 sp|P54662|DEGU_BREBE Transcriptional regulatory protein degU 42.4 7e-04 sp|O32197|LIAR_BACSU Sensory transduction protein liaR 40.4 0.003 sp|P59969|Y914_MYCBO Putative HTH-type transcriptional regulator 40.0 0.003 sp|Q10550|Y890_MYCTU Putative HTH-type transcriptional regulator 39.7 0.005 sp|P58664|YGEK_ECO57 Hypothetical response regulatory protein yg 39.3 0.006 sp|Q46791|YGEK_ECOLI Hypothetical response regulatory protein yg 38.9 0.007 sp|P31802|NARP_ECOLI Nitrate/nitrite response regulator protein 36.2 0.046 sp|P55184|YXJL_BACSU Hypothetical sensory transduction protein y 36.2 0.051 sp|Q87FQ5|MALT_VIBPA HTH-type transcriptional regulator malT ... 34.3 0.19 sp|Q9KNF3|MALT_VIBCH HTH-type transcriptional regulator malT ... 33.5 0.28 sp|Q7MG94|MALT_VIBVY HTH-type transcriptional regulator malT ... 33.5 0.31 Gene info sp|Q8D4P3|MALT_VIBVU HTH-type transcriptional regulator malT ... 33.5 0.31 sp|P37640|YHJB_ECOLI Putative HTH-type transcriptional regulator 33.5 0.33 sp|P54794|MOAR_KLEAE Monoamine regulon transcriptional regulator 33.1 0.35 sp|P17051|ALKS_PSEOL Regulatory protein alkS 32.7 0.46 sp|Q87FR0|GLGB_VIBPA 1,4-alpha-glucan branching enzyme (Glyco... 32.3 0.71 sp|Q4L7J5|VRAR_STAHJ Response regulator protein vraR 32.3 0.73 Gene info sp|Q5HEP0|VRAR_STAAC Response regulator protein vraR 32.3 0.73 Gene info sp|Q5HN50|VRAR_STAEQ Response regulator protein vraR >sp|Q8CN... 32.3 0.73 Gene info sp|Q6G850|VRAR_STAAS Response regulator protein vraR >sp|Q6GF... 32.3 0.73 Gene info sp|P0AGA8|UHPA_ECO57 Transcriptional regulatory protein uhpA ... 32.3 0.75 sp|Q49YS9|VRAR_STAS1 Response regulator protein vraR 31.6 1.1 Gene info sp|Q9KNE8|GLGB_VIBCH 1,4-alpha-glucan branching enzyme (Glyco... 31.6 1.2 sp|Q8CPN3|ODPA_STAES Pyruvate dehydrogenase E1 component subu... 31.6 1.3 Gene info sp|P27667|UHPA_SALTY Transcriptional regulatory protein uhpA 31.2 1.4 sp|P71301|YKGK_ECOLI Putative HTH-type transcriptional regulator 30.8 1.8 sp|P26487|FIXJ_AZOCA Transcriptional regulatory protein fixJ 30.8 1.8 sp|Q7MG90|GLGB_VIBVY 1,4-alpha-glucan branching enzyme (Glyco... 30.4 2.9 sp|Q8D4P0|GLGB_VIBVU 1,4-alpha-glucan branching enzyme (Glyco... 30.4 2.9 sp|Q6LHN1|GLGB_PHOPR 1,4-alpha-glucan branching enzyme (Glyco... 30.0 3.0 sp|P29369|AGMR_PSEAE Glycerol metabolism activator (Protein agmR 29.6 4.5 sp|P44285|Y1667_HAEIN Hypothetical protein HI1667 29.3 5.6 sp|Q3IHK6|SYE_PSEHT Glutamyl-tRNA synthetase (Glutamate--tRNA li 29.3 6.0 sp|O83497|Y484_TREPA Hypothetical protein TP_0484 28.9 7.3 sp|P0A4H2|BVGA_BORPE Virulence factors putative positive tran... 28.9 8.6 sp|P43803|SECA_HAEIN Preprotein translocase subunit secA 28.5 10.0
Alignments
>sp|P12746|LUXR_VIBFI Transcriptional activator protein luxR Length=250 Score = 462 bits (1188), Expect = 3e-130, Method: Composition-based stats. Identities = 247/251 (98%), Positives = 248/251 (98%), Gaps = 2/251 (0%) Query 1 MKNINADDTYRIINKIKACRAY-DINQCLSDMTKMVHCEYYLTLAIIYPHSMVKSDISIL 59 MKNINADDTYRIINKIKACR+ DINQCLSDMTKMVHCEYYL LAIIYPHSMVKSDISIL Sbjct 1 MKNINADDTYRIINKIKACRSNNDINQCLSDMTKMVHCEYYL-LAIIYPHSMVKSDISIL 59 Query 60 DNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSGLI 119 DNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSGLI Sbjct 60 DNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSGLI 119 Query 120 TGFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHACMNIPLIVPSLVDNYRKINIANNKS 179 TGFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHACMNIPLIVPSLVDNYRKINIANNKS Sbjct 120 TGFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHACMNIPLIVPSLVDNYRKINIANNKS 179 Query 180 NNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAIL 239 NNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAIL Sbjct 180 NNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAIL 239 Query 240 TGAIDCPYFKN 250 TGAIDCPYFKN Sbjct 240 TGAIDCPYFKN 250 >sp|P35327|LUXS_VIBF1 Gene info Transcriptional activator protein luxR Length=250 Score = 374 bits (959), Expect = 1e-103, Method: Composition-based stats. Identities = 188/251 (74%), Positives = 221/251 (88%), Gaps = 4/251 (1%) Query 1 MKNINADDTYRIINKIKACRA-YDINQCLSDMTKMVHCEYYLTLAIIYPHSMVKSDISIL 59 +KNINA++ +II+KIK C DINQCLS++ K++HCEYYL AIIYPHS++K D+SI+ Sbjct 3 IKNINANE--KIIDKIKTCNNNKDINQCLSEIAKIIHCEYYL-FAIIYPHSIIKPDVSII 59 Query 60 DNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSGLI 119 DNYP+KWR+YYDDA L++YDP+VDYS S+HSPINWN+FE + K+SPNVIKEA+ SGLI Sbjct 60 DNYPEKWRKYYDDAGLLEYDPVVDYSKSHHSPINWNVFEKKTIKKESPNVIKEAQESGLI 119 Query 120 TGFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHACMNIPLIVPSLVDNYRKINIANNKS 179 TGFSFPIHTA+NGFGMLSFAHS+KD Y DSLFLHA N+PL++PSLVDNY+KIN KS Sbjct 120 TGFSFPIHTASNGFGMLSFAHSDKDIYTDSLFLHASTNVPLMLPSLVDNYQKINTTRKKS 179 Query 180 NNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAIL 239 ++ LTKREKECLAWA EGKS+WDISKILGCSERTVTFHLTN QMKLNTTNRCQSISKAIL Sbjct 180 DSILTKREKECLAWASEGKSTWDISKILGCSERTVTFHLTNTQMKLNTTNRCQSISKAIL 239 Query 240 TGAIDCPYFKN 250 TGAI+CPY KN Sbjct 240 TGAINCPYLKN 250 >sp|P74946|VANR_VIBAN Transcriptional activator protein vanR Length=240 Score = 161 bits (407), Expect = 1e-39, Method: Composition-based stats. Identities = 93/228 (40%), Positives = 130/228 (57%), Gaps = 8/228 (3%) Query 23 DINQCLSDMTKMVHCEYYLTLAIIYPHSMVKSDISILDNYPKKWRQYYDDANLIKYDPIV 82 D+ L+ + ++ E++L + + ++ S+ + DNYP WRQ YD++ + DPIV Sbjct 19 DLENVLNGLNNLIGHEFFL-FGLSFQPTLKTSETLVTDNYPNSWRQQYDESGFMHIDPIV 77 Query 83 DYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGMLSFAHSE 142 YS +N PI W+ + VN + +EA+ +GL GFS PIH FGM+SFA S+ Sbjct 78 KYSITNFLPIRWD--DAKRVNNDGRVIFEEARCNGLKAGFSIPIHGLRGEFGMISFATSD 135 Query 143 KDNYIDSLFLHACMNIPLIVPSLVDNYRKINI--ANNKSNNDLTKREKECLAWACEGKSS 200 +Y L + LIVP L N I + K LT RE +CLAWA EGKS+ Sbjct 136 TKSY--DLNQQSIHTSQLIVPLLAHNIGNITRYHKDAKPRAVLTAREVQCLAWAAEGKSA 193 Query 201 WDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAILTGAIDCPYF 248 W+I+ I+ SERTV FH +NA KL TNR Q+I+KAIL G I+ PY Sbjct 194 WEIATIINTSERTVKFHFSNACKKLGATNRYQAITKAILGGYIN-PYL 240 >sp|P0A3J5|AHYR_AERHY Transcriptional activator protein ahyR/asaR sp|P0A3J6|AHYR_AERSA Transcriptional activator protein ahyR/asaR Length=260 Score = 116 bits (291), Expect = 3e-26, Method: Composition-based stats. Identities = 70/214 (32%), Positives = 110/214 (51%), Gaps = 17/214 (7%) Query 40 YLTLAIIYPHSMVKSDISILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFEN 99 Y A+I P SM + + + + P W Q Y +++ DPI+ + PI WN + Sbjct 37 YYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHMLACDPIIQLARKQTLPIYWNRLDE 96 Query 100 NA--VNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHACMN 157 A + + S +V+ A GL G SFP+H A G+LSF +E+ + L L + Sbjct 97 RARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENGILSFITAERAS--SDLLLESS-- 152 Query 158 IPLIVPSLVDNY--------RKINIANNKSNNDLTKREKECLAWACEGKSSWDISKILGC 209 P++ S + NY ++++ + LT RE ECL WA EGK+S +I+ ILG Sbjct 153 -PIL--SWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLFWASEGKTSGEIACILGI 209 Query 210 SERTVTFHLTNAQMKLNTTNRCQSISKAILTGAI 243 +ERTV +HL K + NR Q+I+K + +G + Sbjct 210 TERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243 >sp|O30919|SOLR2_RALSO Transcriptional activator protein solR Length=236 Score = 109 bits (272), Expect = 4e-24, Method: Composition-based stats. Identities = 68/207 (32%), Positives = 105/207 (50%), Gaps = 25/207 (12%) Query 48 PHSMVKSDISILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSP 107 P + K ++I D YP W Q+Y + + DP V S+ I W + ++ + Sbjct 44 PLPVSKPAVAIFDTYPAGWMQHYQASGFLDIDPTVRAGASSSDLIVWPV----SIRDDAA 99 Query 108 NVIKEAKTSGLITGFSFPIHTANNGFGMLSFA-HSEKDNYID----SLFLHACMNI---- 158 + +A+ +GL G + TA+ FG+L+ A H++ + S+ H N+ Sbjct 100 RLWSDARDAGLNIGVARSSWTAHGAFGLLTLARHADPLTAAELGQLSIATHWLANLAHTL 159 Query 159 --PLIVPSLVDNYRKINIANNKSNNDLTKREKECLAWACEGKSSWDISKILGCSERTVTF 216 P +VP LV +SN LT RE+E L W EGK++++I +IL SERTV F Sbjct 160 MSPFLVPQLVP----------ESNAVLTTREREVLCWTGEGKTAYEIGQILRISERTVNF 209 Query 217 HLTNAQMKLNTTNRCQSISKAILTGAI 243 H+ N +KL TN+ Q++ KAI TG I Sbjct 210 HVNNVLLKLAATNKVQAVVKAIATGLI 236 >sp|P58590|SOLR1_RALSO Transcriptional activator protein solR Length=236 Score = 107 bits (267), Expect = 2e-23, Method: Composition-based stats. Identities = 68/217 (31%), Positives = 108/217 (49%), Gaps = 29/217 (13%) Query 40 YLTLAIIYPHSMVKSDISILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFEN 99 Y I P + K ++I D YP W ++Y + ++ DP V S+ I W + Sbjct 36 YCCYGIRVPLPVSKPAVAIFDTYPAGWMEHYQASGFLEIDPTVRTGASSSDLIIWPV--- 92 Query 100 NAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGMLSFAH-------------SEKDNY 146 ++ ++ + +A+ GL G + TA+ FG+L+ A S N+ Sbjct 93 -SIRDEAARLWSDARDFGLNIGVARSSWTAHGAFGLLTLARRADPLTAAELEQLSATTNW 151 Query 147 IDSLFLHACMNIPLIVPSLVDNYRKINIANNKSNNDLTKREKECLAWACEGKSSWDISKI 206 + +L HA M+ P ++P LV +S+ LT RE+E L W EGK++++I +I Sbjct 152 LANL-AHALMS-PFLMPKLVP----------ESSAALTAREREVLCWTGEGKTAYEIGQI 199 Query 207 LGCSERTVTFHLTNAQMKLNTTNRCQSISKAILTGAI 243 L SERTV FH+ N +KL TN+ Q++ KAI G I Sbjct 200 LRISERTVNFHVNNVLLKLAATNKVQAVVKAIAIGLI 236 >sp|P25084|LASR_PSEAE Transcriptional activator protein lasR Length=239 Score = 97.1 bits (240), Expect = 3e-20, Method: Composition-based stats. Identities = 61/196 (31%), Positives = 96/196 (48%), Gaps = 20/196 (10%) Query 58 ILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINW--NIFENNAVNKKSPNVIKEAKT 115 I+ NYP WR++YD A + DP V + + PI W +I++ +K +EA Sbjct 52 IVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQT----RKQHEFFEEASA 107 Query 116 SGLITGFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHACMNIPLIVPSL--VDNYRKIN 173 +GL+ G + P+H A G LS + ++ + F+ + ++P+L + +Y + Sbjct 108 AGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMES------VLPTLWMLKDYALQS 161 Query 174 IANNKSNND------LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNT 227 A + LT REKE L W GK+SW+IS I CSE V FH+ N + K Sbjct 162 GAGLAFEHPVSKPVVLTSREKEVLQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGV 221 Query 228 TNRCQSISKAILTGAI 243 T+R + A+ G I Sbjct 222 TSRRVAAIMAVNLGLI 237 >sp|P07026|SDIA_ECOLI Regulatory protein sdiA Length=240 Score = 95.5 bits (236), Expect = 6e-20, Method: Composition-based stats. Identities = 66/208 (31%), Positives = 102/208 (49%), Gaps = 7/208 (3%) Query 38 EY-YLTLAIIYPHSMVKSDISILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNI 96 EY Y +L + +P + ++ NYP+ W YY N + DP+++ N + + WN Sbjct 38 EYDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSYYQAKNFLAIDPVLNPENFSQGHLMWN- 96 Query 97 FENNAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGMLSFAH-SEKDNYIDSLFLHAC 155 ++ ++ P + + A+ GL G + + N G LSF+ S ++ I S L Sbjct 97 --DDLFSEAQP-LWEAARAHGLRRGVTQYLMLPNRALGFLSFSRCSAREIPILSDELQLK 153 Query 156 MNIPLIVPSLVDNYRKINIANNKSNNDLTKREKECLAWACEGKSSWDISKILGCSERTVT 215 M + L+ SL+ R + + +KREKE L W EGK+S +I+ IL SE TV Sbjct 154 MQL-LVRESLMALMRLNDEIVMTPEMNFSKREKEILRWTAEGKTSAEIAMILSISENTVN 212 Query 216 FHLTNAQMKLNTTNRCQSISKAILTGAI 243 FH N Q K+N N+ Q A TG I Sbjct 213 FHQKNMQKKINAPNKTQVACYAAATGLI 240 >sp|P55629|Y4QH_RHISN Gene info Putative HTH-type transcriptional regulator y4qH Length=326 Score = 90.5 bits (223), Expect = 2e-18, Method: Composition-based stats. Identities = 63/198 (31%), Positives = 93/198 (46%), Gaps = 12/198 (6%) Query 52 VKSDISILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINW-NIFENNAVNKKSPNVI 110 VK D + NYP WR+ + P++ S PI W +++ + + + + Sbjct 135 VKCDSEEILNYPDGWRERCLEMGYETIAPVIKESRMGAGPIRWSDMYSDASTTEYERRMF 194 Query 111 KEAKTSGLITGFSFPIHTANNGFGMLSFA-HSEK---DNYIDSLFLHACMNIPLIVPSLV 166 EA GL +G + P+ ++SFA H E+ D I L L A + L V + Sbjct 195 DEAAMFGLRSGITVPLRGPRGSCAIMSFARHCEREFHDRTIAYLQL-AATHFHLRVAKIA 253 Query 167 DNYRKINIANNKSNNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLN 226 N+ + L+ REKEC+ W GKSSWDI I+ SE TV FH+ N KL Sbjct 254 ------NLNAVQKIPALSLREKECVLWVARGKSSWDIGVIMRISENTVNFHIKNVMRKLG 307 Query 227 TTNRCQSISKAILTGAID 244 T++R + KAI G I+ Sbjct 308 TSSRTVAAIKAISLGIIE 325 >sp|Q51786|PHZR_PSEFL Transcriptional activator protein phzR Length=244 Score = 88.6 bits (218), Expect = 9e-18, Method: Composition-based stats. Identities = 58/186 (31%), Positives = 86/186 (46%), Gaps = 9/186 (4%) Query 61 NYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSGLIT 120 NYP+ W Q Y AN DP V +S + +PI W+ N + + P++ EA S L Sbjct 65 NYPEHWLQRYQAANYALIDPTVKHSKVSSAPILWS----NELFRNCPDLWSEANDSSLCH 120 Query 121 GFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHACMNI-PLIVPSLVDNYRKINIANNKS 179 G + P G+LS A KDN I A + + ++ + Sbjct 121 GLAQPSFNTQGRVGVLSLA--RKDNAISLQEFEALKPVTKAFAAAALEKISALETDVRAF 178 Query 180 NNDLTKREKEC--LAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKA 237 N D+ E+EC L W +GK+S +I I+G TV +H N Q K+ +NR Q++S A Sbjct 179 NTDVEFSERECDVLRWTADGKTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYA 238 Query 238 ILTGAI 243 + G I Sbjct 239 VALGYI 244 >sp|Q03316|RHIR_RHILV Regulatory protein rhiR Length=247 Score = 79.7 bits (195), Expect = 4e-15, Method: Composition-based stats. Identities = 54/187 (28%), Positives = 90/187 (48%), Gaps = 14/187 (7%) Query 58 ILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWN-IFENNAVNKKSPNVIKEAKTS 116 +L N+ W Y + N + DPIV S + W+ + ++++S V+ EA+ Sbjct 61 VLGNWSVGWFDRYRENNYVHADPIVHLSKTCDHAFVWSEALRDQKLDRQSRRVMDEAREF 120 Query 117 GLITGFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHACMNIPL-IVPSLVDNYRKINIA 175 LI GFS P+HTA ++SF + + L C L ++ + + + I Sbjct 121 KLIDGFSVPLHTAAGFQSIVSFGAEKVE-------LSTCDRSALYLMAAYAHSLLRAQIG 173 Query 176 NNKSNN-----DLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNR 230 N+ S +T RE+E + W GK++ +I+ ILG S RT+ + N Q KLN N Sbjct 174 NDASRKIQALPMITTREREIIHWCAAGKTAIEIATILGRSHRTIQNVILNIQRKLNVVNT 233 Query 231 CQSISKA 237 Q I+++ Sbjct 234 PQMIAES 240 >sp|P54303|PHZR_PSECL Transcriptional activator protein phzR Length=241 Score = 78.6 bits (192), Expect = 7e-15, Method: Composition-based stats. Identities = 57/188 (30%), Positives = 86/188 (45%), Gaps = 13/188 (6%) Query 61 NYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSGLIT 120 NYP+ W Q Y AN DP V +S + SPI +N + + P++ EA S L Sbjct 62 NYPEDWVQRYQAANYAVIDPTVKHSKVSSSPI----LASNELFRGCPDLWSEANDSNLRH 117 Query 121 GFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHACMNIPLIVPSLVDNYRKI-----NIA 175 G + P G+LS A KDN I A + + V + KI ++ Sbjct 118 GLAQPSFNTQGRVGVLSLA--RKDNPISLQEFEALKVVTKAFAAAV--HEKISELESDVR 173 Query 176 NNKSNNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSIS 235 ++ + + RE + L W +GK+S +I I+G TV +H N Q K+ +NR Q+ Sbjct 174 VFNTDVEFSGRECDVLRWTADGKTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQASR 233 Query 236 KAILTGAI 243 A+ G I Sbjct 234 YAVAMGYI 241 >sp|Q46751|CARR_PECCC Transcriptional activator protein carR Length=244 Score = 75.5 bits (184), Expect = 7e-14, Method: Composition-based stats. Identities = 55/189 (29%), Positives = 94/189 (49%), Gaps = 8/189 (4%) Query 58 ILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSG 117 I+ NYP+ W + Y + DPI+ S + +P +W+ + + K+ +V + Sbjct 36 IISNYPEAWMKEYIKKEMFLSDPIIVASLARITPFSWDDNDIVTLRAKNQDVFISSVQHD 95 Query 118 LITGFSFPIHTANNGFGMLSFA-HSEKDNYIDSLFLHACMNIPLIV---PSLVDNYRKIN 173 + +G++F +H +N LS A H E N+ + H L+V ++ R IN Sbjct 96 ISSGYTFVLHDHDNNVATLSIANHLEDANFEKCMKNHENDLQMLLVNVHEKVMAYQRAIN 155 Query 174 IANNKSNND----LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTN 229 +N +N L+ RE E L G++ ++S+ILG SE TV FH+ N+ KL+ N Sbjct 156 DQDNPPDNSRNALLSPRETEVLFLVSSGRTYKEVSRILGISEVTVKFHINNSVRKLDVIN 215 Query 230 RCQSISKAI 238 +I+KA+ Sbjct 216 SRHAITKAL 224 >sp|Q46967|ECHR_ERWCH Transcriptional activator protein echR Length=250 Score = 72.8 bits (177), Expect = 4e-13, Method: Composition-based stats. Identities = 51/190 (26%), Positives = 90/190 (47%), Gaps = 9/190 (4%) Query 54 SDISILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEA 113 +D+ I+ NYP +W + Y N DP++ + + SP +W+ + K + + Sbjct 42 TDVVIISNYPSEWVEIYRSNNYQHIDPVILTAINKISPFSWDDDLVISSKLKFSRIFNLS 101 Query 114 KTSGLITGFSFPIHTANNGFGMLSFAHSE-KDNYIDSLFLHACMNIPLIVPS----LVDN 168 K ++ G++F +H N LSF E + ++ + + + +++ S L Sbjct 102 KEYDIVNGYTFVLHDPGNNLATLSFMFEENRSGELEEIVQNNKEKLQMLLISAHEKLTSL 161 Query 169 YRKINIANNKSN----NDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMK 224 YR+++ N S N ++RE E L WA GK+ +I+ ILG + TV FH+ N K Sbjct 162 YREMSKNKNNSKSQEPNIFSQRENEILYWASMGKTYQEIALILGITTSTVKFHIGNVVKK 221 Query 225 LNTTNRCQSI 234 L N +I Sbjct 222 LGVLNAKHAI 231 >sp|P54292|RHLR_PSEAE Regulatory protein rhlR (Elastase modulator) Length=241 Score = 72.4 bits (176), Expect = 6e-13, Method: Composition-based stats. Identities = 54/175 (30%), Positives = 81/175 (46%), Gaps = 16/175 (9%) Query 62 YPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSGLITG 121 YPK W + Y N DP + + + W+ +++ +S + EA+ GL G Sbjct 64 YPKAWLERYQMQNYGAVDPAILNGLRSSEMVVWS----DSLFDQSRMLWNEARDWGLCVG 119 Query 122 FSFPIHTANNGFGMLSFAHSEKDNYIDSL------FLHACMNIPLIVPSLVDNYRKINIA 175 + PI NN +LS A +++ I S CM I L+ L D + ++ Sbjct 120 ATLPIRAPNNLLSVLSVARDQQN--ISSFEREEIRLRLRCM-IELLTQKLTDLEHPMLMS 176 Query 176 NNKSNNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNR 230 N L+ RE+E L W +GKSS +I+ IL SE TV FH N Q K + N+ Sbjct 177 NPVC---LSHREREILQWTADGKSSGEIAIILSISESTVNFHHKNIQKKFDAPNK 228 >sp|O87971|YUKR_YERRU Transcriptional activator protein yukR Length=229 Score = 72.4 bits (176), Expect = 7e-13, Method: Composition-based stats. Identities = 59/193 (30%), Positives = 90/193 (46%), Gaps = 15/193 (7%) Query 55 DISILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAV--NKKSPNVIKE 112 D+ I+ +YP +W Y N DPIV + SP W+ EN + + KS + Sbjct 25 DVFIVTSYPDEWADIYTSQNYQHIDPIVLTAFKRISPFAWD--ENITILSDLKSSKIFAL 82 Query 113 AKTSGLITGFSFPIHTANNGFGMLSF-----AHSEKDNYIDSLFLHACMN-IPLIVPSLV 166 +K ++ GF+F +H N MLS A ++ I+S MN I + L+ Sbjct 83 SKKYNIVNGFTFVLHDHMNNLAMLSLIMDNNADKGLNSRIESDKDRLQMNLIKIHEKMLM 142 Query 167 DNYRKINIANNKSNND-----LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNA 221 K+ ++N K+ + L+ RE E L WA GK+ +I+ I G + RTV H+ N Sbjct 143 LEQNKLGVSNGKNTDTSGKGILSPRENEVLHWASMGKTYPEIALIAGITTRTVKHHMGNV 202 Query 222 QMKLNTTNRCQSI 234 KL N Q+I Sbjct 203 VKKLGVINARQAI 215 >sp|Q47188|EXPR_DICD3 Transcriptional activator protein expR Length=250 Score = 67.4 bits (163), Expect = 2e-11, Method: Composition-based stats. Identities = 50/190 (26%), Positives = 89/190 (46%), Gaps = 9/190 (4%) Query 54 SDISILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEA 113 +D+ I+ NYP +W Y + N DP++ + + SP +W+ + K + + Sbjct 42 TDVVIISNYPTEWVDIYRNNNYQHIDPVILTAINKISPFSWDDDLVISSKLKFSRIFNLS 101 Query 114 KTSGLITGFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHACMN-IPLIVPS----LVDN 168 K ++ G++F +H+ N LSF E + + + + +++ S L Sbjct 102 KDYDIVNGYTFVLHSPGNNLAALSFMIEEHRSEELEEIIQNNKDKLQMLLISAHEKLTSL 161 Query 169 YRKINIANNKSNND----LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMK 224 YR+++ N S + ++RE E L WA GK+ +I+ ILG + TV FH+ N K Sbjct 162 YREMSRNRNNSKSQEADLFSQRENEILHWASMGKTYQEIALILGITTSTVKFHIGNVVKK 221 Query 225 LNTTNRCQSI 234 L N +I Sbjct 222 LGVLNAKHAI 231 >sp|P54295|YENR_YEREN Transcriptional activator protein yenR Length=244 Score = 66.2 bits (160), Expect = 4e-11, Method: Composition-based stats. Identities = 55/196 (28%), Positives = 90/196 (45%), Gaps = 18/196 (9%) Query 57 SILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSPN--VIKEAK 114 +I+ NYP W + Y + DP++ + +P W+ +N+ +NKKS + V K A+ Sbjct 45 TIISNYPLDWVKKYKKNSYHLIDPVILTAKDKVAPFAWD--DNSVINKKSTDSAVFKLAR 102 Query 115 TSGLITGFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHACMNIPLIVPSLVDNYRKI-- 172 ++ G++F +H +N L+ ++ D+ S +N I L+ + K+ Sbjct 103 EYNIVNGYTFVLHDNSNNMATLNISNGSDDSI--SFDERIEINKEKIQMLLIITHEKMLG 160 Query 173 ----NIANNKSNND------LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQ 222 N N++ N + RE E L WA GK+ +IS ILG TV FH+ N Sbjct 161 LYQSNSDKNENRNTQIERDIFSPRENEILYWASVGKTYAEISIILGIKRSTVKFHIGNVV 220 Query 223 MKLNTTNRCQSISKAI 238 KL N +I I Sbjct 221 RKLGVLNAKHAIRLGI 236 >sp|Q47189|EXPR_PECCC Transcriptional activator protein expR Length=245 Score = 64.7 bits (156), Expect = 1e-10, Method: Composition-based stats. Identities = 52/194 (26%), Positives = 88/194 (45%), Gaps = 9/194 (4%) Query 54 SDISILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEA 113 ++I I+ N+ +WR+ Y N DP+V + + +P W+ + K + + Sbjct 42 TEILIISNHHDEWREIYQANNYQHIDPVVIAALNKITPFPWDEDLLVSTQLKMSKIFNLS 101 Query 114 KTSGLITGFSFPIHTANNGFGMLSFAHSEK-----DNYIDSLFLHACMNIPLIVPSLVDN 168 + + G++F +H +N MLS E D+ I+S M + I + Sbjct 102 REHNITNGYTFVLHDHSNNLVMLSIMIDESNVSNIDDVIESNKDKLQMTLMTIHAETISL 161 Query 169 YRKI--NIANNKSNND--LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMK 224 YR++ N + +SN+ ++RE E L WA GK+ +I+ IL TV FH+ N K Sbjct 162 YREMIRNKEDERSNDKDIFSQRENEILYWASMGKTYQEIALILDIKTGTVKFHIGNVVKK 221 Query 225 LNTTNRCQSISKAI 238 L N +I I Sbjct 222 LGVLNAKHAIRLGI 235 >sp|P54293|ESAR_ERWST Transcriptional activator protein esaR Length=249 Score = 63.2 bits (152), Expect = 3e-10, Method: Composition-based stats. Identities = 51/191 (26%), Positives = 84/191 (43%), Gaps = 10/191 (5%) Query 54 SDISILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEA 113 S++ I+ +YP +W + Y N DP++ + SP W+ + + + + Sbjct 42 SNVLIISSYPDEWIRLYRANNFQLTDPVILTAFKRTSPFAWDENITLMSDLRFTKIFSLS 101 Query 114 KTSGLITGFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHA---CMNIPLI-----VPSL 165 K ++ GF++ +H N +LS D L A M + LI + L Sbjct 102 KQYNIVNGFTYVLHDHMNNLALLSVIIKGNDQTALEQRLAAEQGTMQMLLIDFNEQMYRL 161 Query 166 VDNYRKINIANNKSNND--LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQM 223 + A N+S + + RE E L WA GK+ +I+ I G S TV FH+ N + Sbjct 162 AGTEGERAPALNQSADKTIFSSRENEVLYWASMGKTYAEIAAITGISVSTVKFHIKNVVV 221 Query 224 KLNTTNRCQSI 234 KL +N Q+I Sbjct 222 KLGVSNARQAI 232 >sp|P55407|TRAR_RHISN Gene info Probable transcriptional activator protein traR Length=236 Score = 50.8 bits (120), Expect = 2e-06, Method: Composition-based stats. Identities = 46/188 (24%), Positives = 80/188 (42%), Gaps = 8/188 (4%) Query 54 SDISILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSP--NVIK 111 + + +YP W Y ++ DP++ + W + SP Sbjct 47 TQVRTFHSYPGPWESIYLGSDYFNIDPVLAEAKRRRDVFFWTA-DAWPARGSSPLRRFRD 105 Query 112 EAKTSGLITGFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHACMNIPLIVPSLVDNYRK 171 EA + G+ G + P+ + ML+FA E+ I + L + L++ +V K Sbjct 106 EAISHGIRCGVTIPVEGSYGSAMMLTFASPERKVDISGV-LDPKKAVQLLM--MVHYQLK 162 Query 172 INIANNKSNND--LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTN 229 I A N L+ RE CL WA +GK++ + + G + RTV +L A+ KL+ + Sbjct 163 IIAAKTVLNPKQMLSPREMLCLVWASKGKTASVTANLTGINARTVQHYLDKARAKLDAES 222 Query 230 RCQSISKA 237 Q ++ A Sbjct 223 VPQLVAIA 230 >sp|P54294|TRAR_AGRT5 Gene info Transcriptional activator protein traR Length=234 Score = 50.4 bits (119), Expect = 3e-06, Method: Composition-based stats. Identities = 51/224 (22%), Positives = 89/224 (39%), Gaps = 32/224 (14%) Query 28 LSDMTKMVHCEYYLTLAIIYPHSMVKSDISILDNYPKKWRQYYDDANLIKYDPIVDYSNS 87 L+D+ + Y L I + H++ + NY + WR Y + N K DP+V + S Sbjct 25 LADLAEHFGFTGYAYLHIQHKHTIA------VTNYHRDWRSAYFENNFDKLDPVVKRAKS 78 Query 88 NHSPINWN-IFENNAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGMLSFAHSEK--- 143 W+ E + ++K+ A G+ +G + PI TAN M + A SE+ Sbjct 79 RKHVFAWSGEQERSRLSKEERAFYAHAADFGIRSGITIPIKTANGSMSMFTLA-SERPAI 137 Query 144 --DNYIDSLF-------LHACMNIPLIVPSLVDNYRKINIANNKSNNDLTKREKECLAWA 194 D ID+ LHA ++ P++ D L +E L W Sbjct 138 DLDREIDAAAAAGAVGQLHARISFLQTTPTVEDAAW------------LDPKEATYLRWI 185 Query 195 CEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAI 238 G + +++ + G +V L A + + ++ + AI Sbjct 186 AVGMTMEEVADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAI 229 >sp|P33905|TRAR_AGRTU Gene info Transcriptional activator protein traR Length=234 Score = 48.1 bits (113), Expect = 1e-05, Method: Composition-based stats. Identities = 42/188 (22%), Positives = 76/188 (40%), Gaps = 10/188 (5%) Query 56 ISILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWN-IFENNAVNKKSPNVIKEAK 114 I+ + NY ++W+ Y D DP+V + S W+ E ++K A Sbjct 47 ITAVTNYHRQWQSTYFDKKFEALDPVVKRARSRKHIFTWSGEHERPTLSKDERAFYDHAS 106 Query 115 TSGLITGFSFPIHTANNGFGMLSFAHSEK----DNYIDSLFLHACMNIPLIVPSLVDNYR 170 G+ +G + PI TAN M + A + D ID++ A + + + + R Sbjct 107 DFGIRSGITIPIKTANGFMSMFTMASDKPVIDLDREIDAVAAAATIG---QIHARISFLR 163 Query 171 KINIANNKSNNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNR 230 A + + L +E L W GK+ +I+ + G +V L A + + ++ Sbjct 164 TTPTAEDAAW--LDPKEATYLRWIAVGKTMEEIADVEGVKYNSVRVKLREAMKRFDVRSK 221 Query 231 CQSISKAI 238 + AI Sbjct 222 AHLTALAI 229 >sp|P13800|DEGU_BACSU Transcriptional regulatory protein degU (Protease production enhancer protein) Length=229 Score = 45.4 bits (106), Expect = 7e-05, Method: Composition-based stats. Identities = 24/62 (38%), Positives = 37/62 (59%), Gaps = 0/62 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAILTGA 242 LT+RE E L +GKS+ I + L SE+TV H++N K+N +R Q++ AI G Sbjct 166 LTRRECEVLQMLADGKSNRGIGESLFISEKTVKNHVSNILQKMNVNDRTQAVVVAIKNGW 225 Query 243 ID 244 ++ Sbjct 226 VE 227 >sp|P33909|TRAR_AGRVI Transcriptional activator protein traR Length=234 Score = 45.4 bits (106), Expect = 8e-05, Method: Composition-based stats. Identities = 49/205 (23%), Positives = 80/205 (39%), Gaps = 27/205 (13%) Query 47 YPHSMVKSDISILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWN-IFENNAVNKK 105 Y H K I++ NY WR Y D DP+V + S W+ E ++++ Sbjct 39 YLHIQHKHIIAV-TNYHHDWRSLYFDKKFDALDPVVKRARSRKQVFAWSGEQERPKLSEE 97 Query 106 SPNVIKEAKTSGLITGFSFPIHTANNGFGMLSFAHSEK-----DNYIDSLF-------LH 153 +A G+ +G + PI TAN M + A SE+ D ID++ LH Sbjct 98 ERAFYAQAADFGIRSGITIPIRTANGSMSMFTLA-SERTAIPLDREIDAVAAAAAVGQLH 156 Query 154 ACMNIPLIVPSLVDNYRKINIANNKSNNDLTKREKECLAWACEGKSSWDISKILGCSERT 213 A ++ I P+ D L +E L W GK+ +I+ + + Sbjct 157 ARISFLRITPTAEDAAW------------LDPKEATYLRWIAVGKTMEEIADVEEVKYNS 204 Query 214 VTFHLTNAQMKLNTTNRCQSISKAI 238 V L A + + ++ + AI Sbjct 205 VRVKLREAMKRFDVRSKAHLTALAI 229 >sp|P11470|GERE_BACSU Germination protein gerE Length=74 Score = 44.3 bits (103), Expect = 2e-04, Method: Composition-based stats. Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 0/67 (0%) Query 178 KSNNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKA 237 +S LTKRE+E + K++ +I+ L SE+TV H++NA KL R Q++ + Sbjct 7 QSKPSLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVEL 66 Query 238 ILTGAID 244 + G ++ Sbjct 67 LRMGELE 73 >sp|O54452|RAIR_RHIET Transcriptional activator protein raiR Length=242 Score = 43.9 bits (102), Expect = 2e-04, Method: Composition-based stats. Identities = 36/177 (20%), Positives = 70/177 (39%), Gaps = 8/177 (4%) Query 62 YPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSGL-IT 120 YP +W + Y D + DP+V P+ W+ + + ++ KEA G+ Sbjct 63 YPPEWVKQYRDRDYFSIDPVVRLGRRGFLPVEWS--ASGWDSGRAYGFFKEAMAFGVGRQ 120 Query 121 GFSFPIHTANNGFGMLSFAHSEKDNYIDSLFLHACMNIPLIVPSLVDNYRKINIANNKSN 180 G + P+ + + + D Y + + ++ + L D R + ++ + Sbjct 121 GVTLPVRGPQGERSLFTVTSNHPDAYWRQFRMDSMRDLQFLAHHLHD--RAMVLSGMRKV 178 Query 181 ND---LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSI 234 D L++RE +CL G + I L S V +L +A+ KL + + Sbjct 179 ADLPRLSRRELQCLEMTANGLLAKQICARLSISVSAVQLYLASARRKLTVATTSEQL 235 >sp|P56644|SGAR_HYPME Probable transcriptional regulatory protein sgaR Length=211 Score = 43.5 bits (101), Expect = 3e-04, Method: Composition-based stats. Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 0/67 (0%) Query 169 YRKINIANNKSNNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTT 228 Y I++ N+ LT RE+E LA G ++ I+ G S TV +HL N KL + Sbjct 134 YVDIDLLNHDPLESLTARERELLAALANGWTNLQIAARTGISRNTVKYHLKNLYDKLGVS 193 Query 229 NRCQSIS 235 NR +++ Sbjct 194 NRAMAVA 200 >sp|P54662|DEGU_BREBE Transcriptional regulatory protein degU Length=236 Score = 42.4 bits (98), Expect = 7e-04, Method: Composition-based stats. Identities = 26/97 (26%), Positives = 49/97 (50%), Gaps = 14/97 (14%) Query 159 PLIVPSLVDNYRKINIANNKSNND--------------LTKREKECLAWACEGKSSWDIS 204 P + +L+ YR++ + + +++ LT+RE E L +G S+ I Sbjct 135 PKVTHNLIKEYRRLVNEDEQESSEIGFKEVEYRKPLHILTRRECEVLQLMTDGYSNRMIG 194 Query 205 KILGCSERTVTFHLTNAQMKLNTTNRCQSISKAILTG 241 + L SE+TV H++N K+N +R Q++ ++I G Sbjct 195 EALYISEKTVKNHVSNILQKMNVNDRTQAVVESIKNG 231 >sp|O32197|LIAR_BACSU Sensory transduction protein liaR Length=211 Score = 40.4 bits (93), Expect = 0.003, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 0/58 (0%) Query 176 NNKSNNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQS 233 N + LTKRE E L EGK++ +I + L + +TV H+TN KL+ ++R Q+ Sbjct 143 NALPHESLTKRELEILCLIAEGKTNKEIGEELFITIKTVKTHITNILSKLDVSDRTQA 200 >sp|P59969|Y914_MYCBO Putative HTH-type transcriptional regulator Mb0914c Length=882 Score = 40.0 bits (92), Expect = 0.003, Method: Composition-based stats. Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 0/60 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAILTGA 242 LT E++ + EG S+ DI+K L S RTV HLT+ KL +R Q + +A G+ Sbjct 821 LTPTERDVVRLVSEGLSNKDIAKRLFVSPRTVQTHLTHVYAKLGLASRVQLVDEAARRGS 880 >sp|Q10550|Y890_MYCTU Putative HTH-type transcriptional regulator Rv0890c/MT0914 Length=882 Score = 39.7 bits (91), Expect = 0.005, Method: Composition-based stats. Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 0/60 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAILTGA 242 LT E++ + EG S+ DI+K L S RTV HLT+ KL +R Q + +A G+ Sbjct 821 LTPTERDVVRLVSEGLSNKDIAKRLFVSPRTVQTHLTHVYAKLGLPSRVQLVDEAARRGS 880 >sp|P58664|YGEK_ECO57 Hypothetical response regulatory protein ygeK Length=210 Score = 39.3 bits (90), Expect = 0.006, Method: Composition-based stats. Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 0/63 (0%) Query 179 SNNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAI 238 S+N LT RE E L +GK++ +I+ L S +TV H N KL+ + + I A+ Sbjct 144 SDNQLTNRESEILQLIADGKTNKEIANFLQLSRKTVETHRLNIMKKLDVHSGIELIKTAL 203 Query 239 LTG 241 G Sbjct 204 RMG 206 >sp|Q46791|YGEK_ECOLI Hypothetical response regulatory protein ygeK Length=210 Score = 38.9 bits (89), Expect = 0.007, Method: Composition-based stats. Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 0/63 (0%) Query 179 SNNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAI 238 S+N LT RE E L +GK++ +I+ L S +TV H N KL+ + + I A+ Sbjct 144 SDNQLTNRESEILQLIADGKTNKEIANFLQLSRKTVETHRLNIMKKLDVHSGIELIKTAL 203 Query 239 LTG 241 G Sbjct 204 RMG 206 >sp|P31802|NARP_ECOLI Nitrate/nitrite response regulator protein narP Length=215 Score = 36.2 bits (82), Expect = 0.046, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 0/48 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNR 230 LT+RE + L +G S+ I+ +L SE+TV H+ N KLN +R Sbjct 154 LTERELDVLHELAQGLSNKQIASVLNISEQTVKVHIRNLLRKLNVRSR 201 >sp|P55184|YXJL_BACSU Hypothetical sensory transduction protein yxjL Length=218 Score = 36.2 bits (82), Expect = 0.051, Method: Composition-based stats. Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 0/61 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAILTGA 242 TKRE E L G + DI++ L SE TV H+ K N +R Q++ AI G Sbjct 157 FTKRELEVLQQMAYGLRNEDIAEKLFVSESTVKTHVHRILQKCNAQDRTQAVVFAIRNGI 216 Query 243 I 243 + Sbjct 217 V 217 >sp|Q87FQ5|MALT_VIBPA HTH-type transcriptional regulator malT (ATP-dependent transcriptional activator malT) Length=902 Score = 34.3 bits (77), Expect = 0.19, Method: Composition-based stats. Identities = 30/111 (27%), Positives = 46/111 (41%), Gaps = 13/111 (11%) Query 127 HTANNGFGMLSFAHSEKDNYIDSLFLHACMNIPLIVPSLVDNYRKINIANNKSNNDLTKR 186 H A +S + + D F+ +N P VP LV + LT+R Sbjct 796 HRAQQLMKDISSNQRSRSIHFDEDFIEKLVNHP-NVPELV------------RTSPLTQR 842 Query 187 EKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKA 237 E + L G S+ I++ L + T+ H+ N KLN NR ++I A Sbjct 843 EWQVLGLIYSGFSNEQIAQELDVAGTTIKTHIRNLYQKLNIANRKEAIVTA 893 >sp|Q9KNF3|MALT_VIBCH HTH-type transcriptional regulator malT (ATP-dependent transcriptional activator malT) Length=902 Score = 33.5 bits (75), Expect = 0.28, Method: Composition-based stats. Identities = 29/111 (26%), Positives = 46/111 (41%), Gaps = 13/111 (11%) Query 127 HTANNGFGMLSFAHSEKDNYIDSLFLHACMNIPLIVPSLVDNYRKINIANNKSNNDLTKR 186 H A+ +S + + D F+ +N P I P LV + LT+R Sbjct 796 HRAHLLLKEISTTQRSRSIHFDEEFVEKLVNHPNI-PELV------------RTSPLTQR 842 Query 187 EKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKA 237 E + L G S+ I+ L + T+ H+ N KLN NR +++ A Sbjct 843 EWQVLGLIYSGFSNEQIAHELDVAGTTIKTHIRNLYQKLNIANRKEAVQTA 893 >sp|Q7MG94|MALT_VIBVY Gene info HTH-type transcriptional regulator malT (ATP-dependent transcriptional activator malT) Length=902 Score = 33.5 bits (75), Expect = 0.31, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 0/55 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKA 237 LT+RE + L G S+ I++ L + T+ H+ N KLN NR ++++ A Sbjct 839 LTQREWQVLGLIYSGFSNEQIAQELDVAGTTIKTHIRNLYQKLNIANRKEAVTTA 893 >sp|Q8D4P3|MALT_VIBVU HTH-type transcriptional regulator malT (ATP-dependent transcriptional activator malT) Length=902 Score = 33.5 bits (75), Expect = 0.31, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 0/55 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKA 237 LT+RE + L G S+ I++ L + T+ H+ N KLN NR ++++ A Sbjct 839 LTQREWQVLGLIYSGFSNEQIAQELDVAGTTIKTHIRNLYQKLNIANRKEAVTTA 893 >sp|P37640|YHJB_ECOLI Putative HTH-type transcriptional regulator yhjB Length=200 Score = 33.5 bits (75), Expect = 0.33, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 0/56 (0%) Query 178 KSNNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQS 233 K L+ R++E L G+S+ +I + L S TV HL + +L NR Q+ Sbjct 137 KDLKSLSARQREILTMLAAGESNKEIGRALNISTGTVKAHLESLYRRLEVKNRTQA 192 >sp|P54794|MOAR_KLEAE Monoamine regulon transcriptional regulator Length=227 Score = 33.1 bits (74), Expect = 0.35, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 0/60 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAILTGA 242 LT +E+E + EG S+ I++ L S TV HL N K NR + +S+ + A Sbjct 162 LTAKEREIVGMVREGASNKLIARQLDISLSTVKTHLRNIFAKTEVVNRTELVSRTWMPAA 221 >sp|P17051|ALKS_PSEOL Regulatory protein alkS Length=882 Score = 32.7 bits (73), Expect = 0.46, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 0/69 (0%) Query 175 ANNKSNNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSI 234 A NK++ LT+++ L EG S+ I+ + +E + +H+ LN NR Q+ Sbjct 814 AENKADALLTRKQIAVLRLVKEGCSNKQIATNMHVTEDAIKWHMRKIFATLNVVNRTQAT 873 Query 235 SKAILTGAI 243 +A G I Sbjct 874 IEAERQGII 882 >sp|Q87FR0|GLGB_VIBPA 1,4-alpha-glucan branching enzyme (Glycogen branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) Length=755 Score = 32.3 bits (72), Expect = 0.71, Method: Composition-based stats. Identities = 24/92 (26%), Positives = 38/92 (41%), Gaps = 7/92 (7%) Query 77 KYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGM- 135 ++ P VD N N+ I + N V K PN + A+ S G S P GFG Sbjct 451 QWVPNVDGGNENYDAIATLKWMNEEVYKHFPNAMTIAEESTAFPGVSAPTFMGGLGFGFK 510 Query 136 --LSFAHSE----KDNYIDSLFLHACMNIPLI 161 + + H K++ + + H + PL+ Sbjct 511 WNMGWMHDSLSYVKEDPVHRKYHHNTITFPLV 542 >sp|Q4L7J5|VRAR_STAHJ Gene info Response regulator protein vraR Length=209 Score = 32.3 bits (72), Expect = 0.73, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 0/52 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSI 234 LT+RE E L +G S+ +I+ + +TV H++N KL +R Q++ Sbjct 148 LTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV 199 >sp|Q5HEP0|VRAR_STAAC Gene info Response regulator protein vraR Length=209 Score = 32.3 bits (72), Expect = 0.73, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 0/52 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSI 234 LT+RE E L +G S+ +I+ + +TV H++N KL +R Q++ Sbjct 148 LTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV 199 >sp|Q5HN50|VRAR_STAEQ Gene info Response regulator protein vraR sp|Q8CNP9|VRAR_STAES Gene info Response regulator protein vraR Length=209 Score = 32.3 bits (72), Expect = 0.73, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 0/52 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSI 234 LT+RE E L +G S+ +I+ + +TV H++N KL +R Q++ Sbjct 148 LTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV 199 >sp|Q6G850|VRAR_STAAS Gene info Response regulator protein vraR sp|Q6GFH3|VRAR_STAAR Gene info Response regulator protein vraR sp|Q7A0I0|VRAR_STAAW Gene info Response regulator protein vraR sp|Q7A2Q1|VRAR_STAAM Gene info Response regulator protein vraR sp|Q7A4R9|VRAR_STAAN Gene info Response regulator protein vraR sp|P0C0Z1|VRAR_STAAU Response regulator protein vraR Length=209 Score = 32.3 bits (72), Expect = 0.73, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 0/52 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSI 234 LT+RE E L +G S+ +I+ + +TV H++N KL +R Q++ Sbjct 148 LTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV 199 >sp|P0AGA8|UHPA_ECO57 Transcriptional regulatory protein uhpA sp|P0AGA7|UHPA_ECOL6 Transcriptional regulatory protein uhpA sp|P0AGA6|UHPA_ECOLI Transcriptional regulatory protein uhpA sp|P0AGA9|UHPA_SHIFL Transcriptional regulatory protein uhpA Length=196 Score = 32.3 bits (72), Expect = 0.75, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Query 172 INIANNKSNNDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTN 229 I +A+ + + LTKRE++ +G + +I+ LG S +TV H N KL +N Sbjct 128 IKLASGR-QDPLTKRERQVAEKLAQGMAVKEIAAELGLSPKTVHVHRANLMEKLGVSN 184 >sp|Q49YS9|VRAR_STAS1 Gene info Response regulator protein vraR Length=209 Score = 31.6 bits (70), Expect = 1.1, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 0/52 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSI 234 LT+RE E L +G S+ +I+ + +TV H++N KL +R Q++ Sbjct 148 LTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAV 199 >sp|Q9KNE8|GLGB_VIBCH 1,4-alpha-glucan branching enzyme (Glycogen branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) Length=666 Score = 31.6 bits (70), Expect = 1.2, Method: Composition-based stats. Identities = 26/100 (26%), Positives = 41/100 (41%), Gaps = 8/100 (8%) Query 77 KYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGM- 135 ++ P VD N+ I + N V K PN + A+ S G S P GFG Sbjct 361 QWIPNVDGGRENYDAIATFKWMNEEVYKHFPNAMTIAEESTAFPGVSAPTFMGGLGFGFK 420 Query 136 --LSFAHSE----KDNYIDSLFLHACMNIPLIVPSLVDNY 169 + + H K++ + + H + PLI + +NY Sbjct 421 WNMGWMHDSLSYIKEDPVHRKYHHNTLTFPLIY-AFSENY 459 >sp|Q8CPN3|ODPA_STAES Gene info Pyruvate dehydrogenase E1 component subunit alpha sp|Q5HQ76|ODPA_STAEQ Gene info Pyruvate dehydrogenase E1 component subunit alpha Length=370 Score = 31.6 bits (70), Expect = 1.3, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 7/66 (10%) Query 48 PHSMVKSDISILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVNKKSP 107 PH+M D P ++R +DA K DP+V + + WN + N V +++ Sbjct 272 PHTMAGDD-------PTRYRTSDEDAEWEKKDPLVRFRKYLEAKGLWNEDKENEVVERAK 324 Query 108 NVIKEA 113 + IK A Sbjct 325 SEIKAA 330 >sp|P27667|UHPA_SALTY Transcriptional regulatory protein uhpA Length=196 Score = 31.2 bits (69), Expect = 1.4, Method: Composition-based stats. Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 0/47 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTN 229 LTKRE++ +G + +I+ LG S +TV H N KL +N Sbjct 138 LTKRERQVAEKLAQGMAVKEIAAELGLSPKTVHVHRANLLEKLGVSN 184 >sp|P71301|YKGK_ECOLI Putative HTH-type transcriptional regulator ykgK Length=196 Score = 30.8 bits (68), Expect = 1.8, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 0/45 (0%) Query 181 NDLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKL 225 + +T RE E + +G I++I CS +TV H NA+ KL Sbjct 143 DKITDREMEIIRMTAQGMQPKSIARIENCSVKTVYTHRRNAEAKL 187 >sp|P26487|FIXJ_AZOCA Transcriptional regulatory protein fixJ Length=211 Score = 30.8 bits (68), Expect = 1.8, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 0/59 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAILTG 241 L++RE++ L G ++ I+ LG S RTV + N K+ + + + A+L G Sbjct 143 LSQRERQVLECLVNGLANKTIAYDLGISPRTVEVYRANVMTKMKAASLPELVRMALLAG 201 >sp|Q7MG90|GLGB_VIBVY 1,4-alpha-glucan branching enzyme (Glycogen branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) Length=715 Score = 30.4 bits (67), Expect = 2.9, Method: Composition-based stats. Identities = 23/92 (25%), Positives = 37/92 (40%), Gaps = 7/92 (7%) Query 77 KYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGM- 135 ++ P +D N N+ I + N V K PN + A+ S G S P GFG Sbjct 412 QWIPNMDGGNENYDAIATLKWMNEEVYKYFPNAMTIAEESTAFPGVSAPTFMGGLGFGFK 471 Query 136 --LSFAHSE----KDNYIDSLFLHACMNIPLI 161 + + H K+ + + H + PL+ Sbjct 472 WNMGWMHDSLSYIKEEPVHRKYHHNTLTFPLV 503 >sp|Q8D4P0|GLGB_VIBVU 1,4-alpha-glucan branching enzyme (Glycogen branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) Length=715 Score = 30.4 bits (67), Expect = 2.9, Method: Composition-based stats. Identities = 23/92 (25%), Positives = 37/92 (40%), Gaps = 7/92 (7%) Query 77 KYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGM- 135 ++ P +D N N+ I + N V K PN + A+ S G S P GFG Sbjct 412 QWIPNMDGGNENYDAIATLKWMNEEVYKYFPNAMTIAEESTAFPGVSAPTFMGGLGFGFK 471 Query 136 --LSFAHSE----KDNYIDSLFLHACMNIPLI 161 + + H K+ + + H + PL+ Sbjct 472 WNMGWMHDSLSYIKEEPVHRKYHHNTLTFPLV 503 >sp|Q6LHN1|GLGB_PHOPR 1,4-alpha-glucan branching enzyme (Glycogen branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) Length=716 Score = 30.0 bits (66), Expect = 3.0, Method: Composition-based stats. Identities = 25/100 (25%), Positives = 41/100 (41%), Gaps = 8/100 (8%) Query 77 KYDPIVDYSNSNHSPINWNIFENNAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGM- 135 ++ P D N N+ I+ + N V PN + A+ S +G S P GFG Sbjct 410 QWIPNHDGGNQNYDAISLLRWMNEEVYSHYPNAMTIAEESTAFSGVSRPTDMGGLGFGFK 469 Query 136 --LSFAHSE----KDNYIDSLFLHACMNIPLIVPSLVDNY 169 + + H ++ + F H + PLI + +NY Sbjct 470 WNMGWMHDSLSYIQEEPVHRKFHHNTITFPLIY-AFSENY 508 >sp|P29369|AGMR_PSEAE Glycerol metabolism activator (Protein agmR) Length=221 Score = 29.6 bits (65), Expect = 4.5, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 3/62 (4%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAILTGA 242 LT+++ L +G+S+ I+ L +E TV H++ KL NR Q+I A G Sbjct 156 LTRKQLLVLERMTKGESNKQIAYNLDIAETTVKAHVSAILRKLKVHNRVQAILSA---GD 212 Query 243 ID 244 ID Sbjct 213 ID 214 >sp|P44285|Y1667_HAEIN Hypothetical protein HI1667 Length=489 Score = 29.3 bits (64), Expect = 5.6, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 0/46 (0%) Query 58 ILDNYPKKWRQYYDDANLIKYDPIVDYSNSNHSPINWNIFENNAVN 103 I N P QYY D +LI ++ +NS +P+ ++ N VN Sbjct 256 IFVNIPSYKLQYYRDGDLILESRVIVGTNSRRTPVMYSKLSNVVVN 301 >sp|Q3IHK6|SYE_PSEHT Glutamyl-tRNA synthetase (Glutamate--tRNA ligase) (GluRS) Length=494 Score = 29.3 bits (64), Expect = 6.0, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 27/65 (41%), Gaps = 8/65 (12%) Query 153 HACMNIPLIVPSLVDNYRKINIANNKSNNDLTKREKECLAWACEGKSSWDISKILGCSER 212 H IP P+L + K++ D+ ++ + W EG S+D I ++ Sbjct 371 HFVGGIPTYDPAL--------LTAGKADEDVIRQALQFFVWQLEGLRSFDKPAIFAIAKE 422 Query 213 TVTFH 217 TFH Sbjct 423 VATFH 427 >sp|O83497|Y484_TREPA Hypothetical protein TP_0484 Length=671 Score = 28.9 bits (63), Expect = 7.3, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 0/44 (0%) Query 103 NKKSPNVIKEAKTSGLITGFSFPIHTANNGFGMLSFAHSEKDNY 146 NKK+ V++ A T+G+ F+ H F + AH+E++ Y Sbjct 596 NKKTDAVLQTATTTGVEFSFTNLAHLEEGSFHWVIQAHTEQEGY 639 >sp|P0A4H2|BVGA_BORPE Virulence factors putative positive transcription regulator bvgA sp|P0A4H3|BVGA_BORBR Virulence factors putative positive transcription regulator bvgA sp|P0A4H4|BVGA_BORPA Virulence factors putative positive transcription regulator bvgA Length=209 Score = 28.9 bits (63), Expect = 8.6, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 0/55 (0%) Query 183 LTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKA 237 L+ RE L +G S+ DI+ + S +TV+ + T KLN T+ + I A Sbjct 149 LSNRELTVLQLLAQGMSNKDIADSMFLSNKTVSTYKTRLLQKLNATSLVELIDLA 203 >sp|P43803|SECA_HAEIN Preprotein translocase subunit secA Length=901 Score = 28.5 bits (62), Expect = 10.0, Method: Composition-based stats. Identities = 30/122 (24%), Positives = 52/122 (42%), Gaps = 17/122 (13%) Query 83 DYSNSNHSPINWNIFE--NNAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGML--SF 138 DY + N +FE +V P + E K + ++ ++ GF L + Sbjct 131 DYLARRDAETNRPLFEFLGMSVGVNIPGLSPEEKRAAYAADITYATNS-ELGFDYLRDNL 189 Query 139 AHSEKDNY-----------IDSLFLHACMNIPLIVPSLVDNYRKINIANNKSNNDLTKRE 187 AHS+++ + +DS+ + PLI+ +N ++ IA NK L K+E Sbjct 190 AHSKEERFQRTLGYALVDEVDSILIDEA-RTPLIISGQAENSSELYIAVNKLIPSLIKQE 248 Query 188 KE 189 KE Sbjct 249 KE 250
  Database: Non-redundant SwissProt sequences
    Posted date:  May 31, 2007  5:55 PM
  Number of letters in database: 36,643,602
  Number of sequences in database:  111,733
Lambda     K      H
   0.319    0.133    0.409 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 111733
Number of Hits to DB: 5900484
Number of extensions: 237107
Number of successful extensions: 599
Number of sequences better than 10: 29
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 593
Number of HSP's successfully gapped: 30
Length of query: 250
Length of database: 36643602
Length adjustment: 103
Effective length of query: 147
Effective length of database: 25135103
Effective search space: 3694860141
Effective search space used: 3694860141
T: 11
A: 40
X1: 16 (7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 62 (28.5 bits)