Job Title: gi|30350260|gb|AAP22376.1| LuxI [Vibrio fischeri]

Show Conserved Domains
  •  
  • Your search is limited to records matching entrez query: txid2 [ORGN].
  •  

RID=5SNSP4XS012, gi|30350260|gb|AAP22376.1| LuxI [Vibrio fischeri] BLASTP 2.2.16 (Mar-25-2007)
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 5SNSP4XS012


Database: Non-redundant SwissProt sequences
           245,534 sequences; 92,615,539 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports

Query=  gi|30350260|gb|AAP22376.1| LuxI [Vibrio fischeri]
Length=193


Distance tree of resultsNew  
Score E Sequences producing significant alignments: (Bits) Value sp|P12747|LUXI_VIBFI Autoinducer synthesis protein luxI 383 1e-106 sp|P35328|LUXJ_VIBF1 Autoinducer synthesis protein luxI 354 6e-98 sp|P74945|VANI_VIBAN Autoinducer synthesis protein vanI 200 1e-51 sp|P70774|ASAI_AERSA Autoinducer synthesis protein asaI 117 9e-27 sp|Q44058|AHYI_AERHY Autoinducer synthesis protein ahyI 117 1e-26 sp|P55394|TRAI_RHISN Probable autoinducer synthesis protein traI 99.0 4e-21 Gene info sp|P33907|TRAI_AGRT5 Autoinducer synthesis protein traI 99.0 4e-21 Gene info sp|P33883|LASI_PSEAE Autoinducer synthesis protein lasI 98.2 7e-21 sp|P33904|TRAI_AGRTU Autoinducer synthesis protein traI 94.7 7e-20 Gene info sp|P54291|RHLI_PSEAE Autoinducer synthesis protein rhlI 87.4 1e-17 sp|P58584|SOLI1_RALSO Autoinducer synthesis protein solI 85.5 4e-17 sp|O30920|SOLI2_RALSO Autoinducer synthesis protein solI 84.3 9e-17 sp|P52990|PSYI_PSESZ Autoinducer synthesis protein psyI 66.2 3e-11 sp|Q51522|PHZI_PSECL Autoinducer synthesis protein phzI 63.9 1e-10 sp|Q51785|PHZI_PSEFL Autoinducer synthesis protein phzI 63.2 2e-10 sp|O54451|RAII_RHIET Autoinducer synthesis protein raiI 61.6 7e-10 sp|P33881|EAGI_ENTAG Autoinducer synthesis protein eagI 56.6 2e-08 sp|P52989|SWRI_SERLI Autoinducer synthesis protein swrI 55.8 4e-08 sp|P52988|YENI_YEREN Autoinducer synthesis protein yenI 55.1 7e-08 sp|P33880|CARI_PECCC Autoinducer synthesis protein carI 53.5 2e-07 sp|P33882|EXPI_PECCC Autoinducer synthesis protein expI 53.1 3e-07 sp|O87970|YUKI_YERRU Autoinducer synthesis protein yukI 48.1 8e-06 sp|Q46968|ECHI_ERWCH Autoinducer synthesis protein echI 42.7 3e-04 sp|Q47187|EXPI_DICD3 Autoinducer synthesis protein expI 42.4 4e-04 sp|P54656|ESAI_ERWST Autoinducer synthesis protein esaI 38.1 0.008 sp|Q8D2S7|HSLU_WIGBR ATP-dependent hsl protease ATP-binding subu 30.8 1.2 sp|Q8PEQ6|OPGD_XANAC Glucans biosynthesis protein D precursor 29.3 3.6 sp|Q1CZI7|HTPG_MYXXD Chaperone protein htpG (Heat shock prote... 28.9 4.6 Gene info
Alignments
>sp|P12747|LUXI_VIBFI Autoinducer synthesis protein luxI Length=193 Score = 383 bits (983), Expect = 1e-106, Method: Composition-based stats. Identities = 192/193 (99%), Positives = 192/193 (99%), Gaps = 0/193 (0%) Query 1 MTIMIKKSDFLAIPSEEYKGILSLRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACD 60 MTIMIKKSDFLAIPSEEYKGILSLRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACD Sbjct 1 MTIMIKKSDFLAIPSEEYKGILSLRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACD 60 Query 61 DTENVSGCWRLLPTTGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSKINNSASE 120 DTENVSGCWRLLPTTGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSKINNSASE Sbjct 61 DTENVSGCWRLLPTTGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSKINNSASE 120 Query 121 ITMKQFEAIYKHAVSQGITEYVTVTSTAIERFLKRIKVPCHRIGDKEIHVLGDTKSVVLS 180 ITMK FEAIYKHAVSQGITEYVTVTSTAIERFLKRIKVPCHRIGDKEIHVLGDTKSVVLS Sbjct 121 ITMKLFEAIYKHAVSQGITEYVTVTSTAIERFLKRIKVPCHRIGDKEIHVLGDTKSVVLS 180 Query 181 MPINEQFKKAVLN 193 MPINEQFKKAVLN Sbjct 181 MPINEQFKKAVLN 193 >sp|P35328|LUXJ_VIBF1 Autoinducer synthesis protein luxI Length=193 Score = 354 bits (908), Expect = 6e-98, Method: Composition-based stats. Identities = 170/193 (88%), Positives = 183/193 (94%), Gaps = 0/193 (0%) Query 1 MTIMIKKSDFLAIPSEEYKGILSLRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACD 60 M +MIKKSDFL IPSEEY+GILSLRYQVFK+RLEWDLV E+NLESDEYDNSNAEYIYACD Sbjct 1 MAVMIKKSDFLGIPSEEYRGILSLRYQVFKRRLEWDLVSEDNLESDEYDNSNAEYIYACD 60 Query 61 DTENVSGCWRLLPTTGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSKINNSASE 120 D E V+GCWRLLPTTGDYMLK+VFPELLG Q AP+DPNIVELSRFAVGKNSSKINNSASE Sbjct 61 DAEEVNGCWRLLPTTGDYMLKTVFPELLGDQVAPRDPNIVELSRFAVGKNSSKINNSASE 120 Query 121 ITMKQFEAIYKHAVSQGITEYVTVTSTAIERFLKRIKVPCHRIGDKEIHVLGDTKSVVLS 180 ITMK F+AIYKHAVSQGITEYVTVTS AIERFLKRIKVPCHRIGDKEIH+LG+T+SVVLS Sbjct 121 ITMKLFQAIYKHAVSQGITEYVTVTSIAIERFLKRIKVPCHRIGDKEIHLLGNTRSVVLS 180 Query 181 MPINEQFKKAVLN 193 MPIN+QF+KAV N Sbjct 181 MPINDQFRKAVSN 193 >sp|P74945|VANI_VIBAN Autoinducer synthesis protein vanI Length=193 Score = 200 bits (508), Expect = 1e-51, Method: Composition-based stats. Identities = 91/191 (47%), Positives = 129/191 (67%), Gaps = 0/191 (0%) Query 1 MTIMIKKSDFLAIPSEEYKGILSLRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACD 60 MTI I F ++P +Y +L LRY+VF QRL+W+L +E+DEYD A Y+YA + Sbjct 1 MTISIYSHTFQSVPQADYVSLLKLRYKVFSQRLQWELKTNRGMETDEYDVPEAHYLYAKE 60 Query 61 DTENVSGCWRLLPTTGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSKINNSASE 120 + ++ GCWR+LPTT YMLK F ELLG Q APK I ELSRFAV K+ S S Sbjct 61 EQGHLVGCWRILPTTSRYMLKDTFSELLGVQQAPKAKEIYELSRFAVDKDHSAQLGGVSN 120 Query 121 ITMKQFEAIYKHAVSQGITEYVTVTSTAIERFLKRIKVPCHRIGDKEIHVLGDTKSVVLS 180 +T++ F+++Y HA I YVTVTS ++E+ +KR+ +PC R+GDK++H+LG T+SV L Sbjct 121 VTLQMFQSLYHHAQQYHINAYVTVTSASVEKLIKRMGIPCERLGDKKVHLLGSTRSVALH 180 Query 181 MPINEQFKKAV 191 +P+NE ++ +V Sbjct 181 IPMNEAYRASV 191 >sp|P70774|ASAI_AERSA Autoinducer synthesis protein asaI Length=207 Score = 117 bits (294), Expect = 9e-27, Method: Composition-based stats. Identities = 58/169 (34%), Positives = 94/169 (55%), Gaps = 2/169 (1%) Query 24 LRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDTENVSGCWRLLPTTGDYMLKSV 83 R +VF RL WD+ LE D +D + ++ +D E + GC RLL DYML S+ Sbjct 23 FRNRVFSDRLGWDVESHRGLEQDSFDTPDTHWVL-IEDEEGLCGCIRLLSCAQDYMLPSI 81 Query 84 FPELLGQQSAPKDPNIVELSRFAVGKNSS-KINNSASEITMKQFEAIYKHAVSQGITEYV 142 FP L ++ P+ ++ EL+R A+ N + ++ N SE+T F +Y A ++GI E V Sbjct 82 FPTALAGEAPPRSSDVWELTRLAIDANRAPRMGNGVSELTCVIFREVYAFARAKGIRELV 141 Query 143 TVTSTAIERFLKRIKVPCHRIGDKEIHVLGDTKSVVLSMPINEQFKKAV 191 V S +ER +R+ +P R+G ++ LG + V + ++E+F +AV Sbjct 142 AVVSLPVERIFRRLGLPIERLGHRQAVDLGAVRGVGIRFHLDERFARAV 190 >sp|Q44058|AHYI_AERHY Autoinducer synthesis protein ahyI Length=207 Score = 117 bits (293), Expect = 1e-26, Method: Composition-based stats. Identities = 58/169 (34%), Positives = 94/169 (55%), Gaps = 2/169 (1%) Query 24 LRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDTENVSGCWRLLPTTGDYMLKSV 83 R +VF RL WD+ LE D +D + ++ +D E + GC RLL DYML S+ Sbjct 23 FRNRVFSDRLGWDVESHRGLEQDSFDTPDTHWVL-IEDEEGLCGCIRLLSCAKDYMLPSI 81 Query 84 FPELLGQQSAPKDPNIVELSRFAV-GKNSSKINNSASEITMKQFEAIYKHAVSQGITEYV 142 FP L ++ P+ ++ EL+R A+ + + ++ N SE+T F +Y A +QGI E V Sbjct 82 FPTALAGEAPPRSNDVWELTRLAIDAERAPRLGNGISELTCIIFREVYAFAKAQGIRELV 141 Query 143 TVTSTAIERFLKRIKVPCHRIGDKEIHVLGDTKSVVLSMPINEQFKKAV 191 V S +ER +R+ +P R+G ++ LG + V + ++E+F +AV Sbjct 142 AVVSLPVERIFRRLGLPIERLGHRQAVDLGAVRGVGIRFHLDERFARAV 190 >sp|P55394|TRAI_RHISN Gene info Probable autoinducer synthesis protein traI Length=208 Score = 99.0 bits (245), Expect = 4e-21, Method: Composition-based stats. Identities = 61/161 (37%), Positives = 82/161 (50%), Gaps = 4/161 (2%) Query 24 LRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDTENVSGCWRLLPTTGDYMLKSV 83 LR +VF RL W++ V ESD +D+ YI A + V GC RLLP G M+ +V Sbjct 24 LRARVFSDRLGWEVNVVGGCESDTFDDLQPTYILAVSSNDRVVGCARLLPALGPTMVANV 83 Query 84 FPELLGQQSAPKDPNIVELSRFAVGK--NSSKINNSASEITMKQFEAIYKHAVSQGITEY 141 FP LL ++VE SRF V S+ + S E T+ F I + +V+ TE Sbjct 84 FPSLLSAGHLNAHSSMVESSRFCVDTFLAESRGDGSIHEATLTMFAGIIEWSVANRYTEI 143 Query 142 VTVTSTAIERFLKRIKVPCHRIGDKEIHVLGDTKSVVLSMP 182 VTVT ER L R+ P RIG E +G T +V ++P Sbjct 144 VTVTDLRFERILARVGWPLQRIG--EPRPIGATVAVAGTLP 182 >sp|P33907|TRAI_AGRT5 Gene info Autoinducer synthesis protein traI Length=211 Score = 99.0 bits (245), Expect = 4e-21, Method: Composition-based stats. Identities = 64/174 (36%), Positives = 87/174 (50%), Gaps = 10/174 (5%) Query 16 EEYKGILS----LRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDTENVSGCWRL 71 E Y+ L LR VF RLEWD+ + E D+YDN Y+ A D+ V+GC RL Sbjct 12 ERYRSFLKQMHRLRATVFGGRLEWDVSIIAGEERDQYDNFKPSYLLAITDSGRVAGCVRL 71 Query 72 LPTTGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSKINNSASEI---TMKQFEA 128 LP G ML+ F +LL S +VE SRF V S AS++ T+ F Sbjct 72 LPACGPTMLEQTFSQLLEMGSLAAHSGMVESSRFCV-DTSLVSRRDASQLHLATLTLFAG 130 Query 129 IYKHAVSQGITEYVTVTSTAIERFLKRIKVPCHRIGDKEIHVLGDTKSVVLSMP 182 I + +++ G TE VT T ER LKR P R+G E +G+T ++ +P Sbjct 131 IIEWSMASGYTEIVTATDLRFERILKRAGWPMRRLG--EPTAIGNTIAIAGRLP 182 >sp|P33883|LASI_PSEAE Autoinducer synthesis protein lasI Length=201 Score = 98.2 bits (243), Expect = 7e-21, Method: Composition-based stats. Identities = 64/171 (37%), Positives = 100/171 (58%), Gaps = 7/171 (4%) Query 24 LRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDT--ENVSGCWRLLPTTGDYMLK 81 LR QVFK+R WD+ V + +E D YD + Y+ +DT V GCWR+L TTG YMLK Sbjct 22 LRAQVFKERKGWDVSVIDEMEIDGYDALSPYYMLIQEDTPEAQVFGCWRILDTTGPYMLK 81 Query 82 SVFPELLGQQSAPKDPNIVELSRFAVGKNSSKINNSASEITMKQFEAIYKHAVSQGITEY 141 + FPELL + AP P+I ELSRFA+ + K + S+ T++ A+ ++++ I Sbjct 82 NTFPELLHGKEAPCSPHIWELSRFAI-NSGQKGSLGFSDCTLEAMRALARYSLQNDIQTL 140 Query 142 VTVTSTAIERFLKRIKVPCHRIGDKEIHV-LGDTKSVVLSMPINEQFKKAV 191 VTVT+ +E+ + R + R G H+ +G ++V L + +N + + A+ Sbjct 141 VTVTTVGVEKMMIRAGLDVSRFGP---HLKIGIERAVALRIELNAKTQIAL 188 >sp|P33904|TRAI_AGRTU Gene info Autoinducer synthesis protein traI Length=212 Score = 94.7 bits (234), Expect = 7e-20, Method: Composition-based stats. Identities = 57/170 (33%), Positives = 85/170 (50%), Gaps = 4/170 (2%) Query 19 KGILSLRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDTENVSGCWRLLPTTGDY 78 K + LR +VF RL+WD+ +E+ E D+YD + YI A + V GC RLL +G Sbjct 19 KQMHRLRAEVFGNRLKWDVAIEDGGERDQYDELSPTYILATFGGQRVVGCARLLAPSGPT 78 Query 79 MLKSVFPELLGQQSAPKDPNIVELSRFAVGKN--SSKINNSASEITMKQFEAIYKHAVSQ 136 ML+ FP+LL S ++E SRF V + + T+ F I + +++ Sbjct 79 MLERTFPQLLATGSLSATTAMIETSRFCVDTTLPTGRAGRQLHLATLTMFAGIIEWSMAN 138 Query 137 GITEYVTVTSTAIERFLKRIKVPCHRIGDKEIHVLGDTKSVVLSMPINEQ 186 G E VT T ER LKR P R+G E +G+T +V +P + + Sbjct 139 GYDEIVTATDLRFERILKRAGWPMTRLG--EPVAIGNTVAVAGHLPADRK 186 >sp|P54291|RHLI_PSEAE Autoinducer synthesis protein rhlI Length=201 Score = 87.4 bits (215), Expect = 1e-17, Method: Composition-based stats. Identities = 58/165 (35%), Positives = 89/165 (53%), Gaps = 13/165 (7%) Query 25 RYQVFKQRLEWDLVVENNL---ESDEYDNSNAEYIYACDDTENVSGCWRLLPTTGDYMLK 81 R+QVF ++L WD+V + + E D++D+ YI A + + GC RLLPTT Y+LK Sbjct 24 RHQVFIEKLGWDVVSTSRVRDQEFDQFDHPQTRYIVAMS-RQGICGCARLLPTTDAYLLK 82 Query 82 SVFPELLGQQSAPKDPNIVELSRFAVGKNSSKINNSASEITMKQFEAIYKHAVSQGITEY 141 VF L ++ P DP++ ELSR+A ++ MK F + + A G + Sbjct 83 DVFAYLC-SETPPSDPSVWELSRYAASAADD------PQLAMKIFWSSLQCAWYLGASSV 135 Query 142 VTVTSTAIERFLKRIKVPCHRIGDKEIHVLGDTKSVVLSMPINEQ 186 V VT+TA+ER+ R V R+G + V G+T V +S P ++ Sbjct 136 VAVTTTAMERYFVRNGVILQRLGPPQ-KVKGET-LVAISFPAYQE 178 >sp|P58584|SOLI1_RALSO Autoinducer synthesis protein solI Length=204 Score = 85.5 bits (210), Expect = 4e-17, Method: Composition-based stats. Identities = 48/143 (33%), Positives = 75/143 (52%), Gaps = 3/143 (2%) Query 25 RYQVFKQRLEWDL-VVENNLESDEYDNSNAEYIYACDDTENVSGCWRLLPTTGDYMLKSV 83 R+Q+F +L W L + + E D+YD + Y+ A D + GC RLLPTT Y+LK V Sbjct 23 RHQIFVGQLGWQLPMADGRFERDQYDRDDTVYVVARDADGAICGCARLLPTTRPYLLKDV 82 Query 84 F-PELLGQQSAPKDPNIVELSRFAVGKNSSKINNSASEITMK-QFEAIYKHAVSQGITEY 141 F P L+ AP+ P + ELSRFA +S+ + + ++ ++ + A +G Sbjct 83 FAPLLMRGVPAPESPGVWELSRFAARSGASRARGARPDWAVRPMLASVVQCAAQRGARRL 142 Query 142 VTVTSTAIERFLKRIKVPCHRIG 164 + VT ++ R +RI V H G Sbjct 143 IGVTFVSMVRLFRRIGVRAHHAG 165 >sp|O30920|SOLI2_RALSO Autoinducer synthesis protein solI Length=204 Score = 84.3 bits (207), Expect = 9e-17, Method: Composition-based stats. Identities = 48/143 (33%), Positives = 73/143 (51%), Gaps = 3/143 (2%) Query 25 RYQVFKQRLEWDL-VVENNLESDEYDNSNAEYIYACDDTENVSGCWRLLPTTGDYMLKSV 83 R+QVF RL W L + + E D+YD + Y+ A D+ + GC RLLPTT Y+LK V Sbjct 23 RHQVFVGRLGWQLPMADGTFERDQYDRDDTVYVVARDEGGTICGCARLLPTTRPYLLKDV 82 Query 84 FPELLGQ-QSAPKDPNIVELSRFAVGKNSSKINNSASEITMK-QFEAIYKHAVSQGITEY 141 F LL P+ P + ELSRFA + + ++ ++ ++ + A +G Sbjct 83 FASLLMHGMPPPESPEVWELSRFAARSGAPCPRSGRADWAVRPMLASVVQCAAQRGARRL 142 Query 142 VTVTSTAIERFLKRIKVPCHRIG 164 + T ++ R +RI V HR G Sbjct 143 IGATFVSMVRLFRRIGVRAHRAG 165 >sp|P52990|PSYI_PSESZ Autoinducer synthesis protein psyI Length=226 Score = 66.2 bits (160), Expect = 3e-11, Method: Composition-based stats. Identities = 48/177 (27%), Positives = 86/177 (48%), Gaps = 5/177 (2%) Query 8 SDFLAIPSEEYKGILSLRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDTENVSG 67 + + +P + + S+R ++F RLEW + V + E DEYDN+ Y+ + ++G Sbjct 10 ASYTTMPVTLLETLYSMRKKIFSDRLEWKVRVSHAFEFDEYDNAATTYLVGSWNGVPLAG 69 Query 68 CWRLLPTTGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSK-INNSASEITMKQF 126 RL+ T YML+ F APK+ + E SRF V ++ + + +T Sbjct 70 L-RLINTCDPYMLEGPFRSFF-DCPAPKNAAMAESSRFFVDTARARSLGILHAPLTEMLL 127 Query 127 EAIYKHAVSQGITEYVTVTSTAIERFLKRIKVPCHRIGDKEIHVLGDTKSVVLSMPI 183 +++ HA G+ +TV S A+ R +++ H + E G+T ++L MP+ Sbjct 128 FSMHNHAALSGLQSIITVVSKAMARIVRKSGWEHHVLSTGEASP-GET-VLLLEMPV 182 >sp|Q51522|PHZI_PSECL Autoinducer synthesis protein phzI Length=196 Score = 63.9 bits (154), Expect = 1e-10, Method: Composition-based stats. Identities = 46/159 (28%), Positives = 75/159 (47%), Gaps = 14/159 (8%) Query 15 SEEYKGILS-LRYQVFKQRLEWDLVV---ENNLESDEYDNSNAEYIYACDDTENVSGCWR 70 S+E K +L R++ F ++L W L + E D+YD +A Y+ A ++ + GC R Sbjct 12 SDELKLMLGRFRHEQFVEKLGWRLPAHPSQAGCEWDQYDTEHARYLLAFNEDRAIVGCAR 71 Query 71 LLPTTGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSKINNSASEITMKQFEAIY 130 L+PTT +L+ VF + PK P I E++RF + ++ M F Sbjct 72 LIPTTFPNLLEGVFGHTCA-GAPPKHPAIWEMTRFTTRE---------PQLAMPLFWRSL 121 Query 131 KHAVSQGITEYVTVTSTAIERFLKRIKVPCHRIGDKEIH 169 K A G V + ++ +ER+ K V R+G +H Sbjct 122 KTASLAGADAIVGIVNSTMERYYKINGVHYERLGPVTVH 160 >sp|Q51785|PHZI_PSEFL Autoinducer synthesis protein phzI Length=196 Score = 63.2 bits (152), Expect = 2e-10, Method: Composition-based stats. Identities = 44/158 (27%), Positives = 76/158 (48%), Gaps = 14/158 (8%) Query 11 LAIPSEEYKGILS-LRYQVFKQRLEWDLVV---ENNLESDEYDNSNAEYIYACDDTENVS 66 L+ +E K +L R++ F ++L W L + + E D+YD +A Y+ A ++ ++ Sbjct 8 LSAMDDELKLMLGRFRHEQFVEKLGWRLPIPPHQAGYEWDQYDTEHARYLLAFNEHRSIV 67 Query 67 GCWRLLPTTGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSKINNSASEITMKQF 126 GC RL+PTT +L+ VF + P+ P I E++RF + ++ M F Sbjct 68 GCARLIPTTFPNLLEGVFSHACA-GAPPRHPAIWEMTRFTTRE---------PQLAMPLF 117 Query 127 EAIYKHAVSQGITEYVTVTSTAIERFLKRIKVPCHRIG 164 K A G V + ++ +ER+ K V R+G Sbjct 118 WKTLKTASLAGADAIVGIVNSTMERYYKINGVKYERLG 155 >sp|O54451|RAII_RHIET Autoinducer synthesis protein raiI Length=212 Score = 61.6 bits (148), Expect = 7e-10, Method: Composition-based stats. Identities = 42/155 (27%), Positives = 66/155 (42%), Gaps = 2/155 (1%) Query 3 IMIKKSDFLAIPSEEYKGILSLRYQVFKQRLEWDLVVENNLESDEYDNS-NAEYIYACDD 61 + I D L + + R VF+ RL W + V + E D YD + + Y+ Sbjct 2 LRILTKDMLETDRRAFDEMFRARAAVFRDRLGWQVDVRDQWERDRYDEAEDPVYLVTQQP 61 Query 62 TENVSGCWRLLPTTGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSKINNSASEI 121 + ++G RLLPTTG MLKS F Q P E +RF + ++ + S + + Sbjct 62 SGTLTGSLRLLPTTGATMLKSEFRHFFDQPIDVDSPTTWECTRFCLHPHAGDMKQSRA-V 120 Query 122 TMKQFEAIYKHAVSQGITEYVTVTSTAIERFLKRI 156 + + A+ GI V V A+ +RI Sbjct 121 ATELLSGLCDLALDTGIENIVGVYDVAMVAVYRRI 155 >sp|P33881|EAGI_ENTAG Autoinducer synthesis protein eagI Length=216 Score = 56.6 bits (135), Expect = 2e-08, Method: Composition-based stats. Identities = 42/136 (30%), Positives = 63/136 (46%), Gaps = 3/136 (2%) Query 21 ILSLRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDTENVSGCWRLLPTTGDYML 80 + LR FK RL+W + N++E DE+DNS Y+ D + V R + M+ Sbjct 20 LYKLRKITFKDRLDWAVNCSNDMEFDEFDNSGTRYMLGIYDNQLVCSV-RFIDLRLPNMI 78 Query 81 KSVFPELLGQQSAPKDPNIVELSRFAVGKNSSK-INNSASEITMKQFEAIYKHAVSQGIT 139 F L G P+ + +E SRF V KN +K + S I+ F ++ +A G T Sbjct 79 THTFQHLFGDVKLPEG-DYIESSRFFVDKNRAKALLGSRYPISYVLFLSMINYARHHGHT 137 Query 140 EYVTVTSTAIERFLKR 155 T+ S A+ KR Sbjct 138 GIYTIVSRAMLTIAKR 153 >sp|P52989|SWRI_SERLI Autoinducer synthesis protein swrI Length=200 Score = 55.8 bits (133), Expect = 4e-08, Method: Composition-based stats. Identities = 36/102 (35%), Positives = 49/102 (48%), Gaps = 3/102 (2%) Query 9 DFLAIPSEEYKGILSLRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDTENVSGC 68 D+ +P K + SLR + FK RL+W + ENN+E DEYDN +A YI+ + Sbjct 8 DYNLLPDNRSKELFSLRKKTFKDRLDWLVNCENNMEFDEYDNRHATYIFGTYQNHVICSL 67 Query 69 WRLLPTTGDYMLKS-VFPELLGQQSAPKDPNIVELSRFAVGK 109 R + T M+ VF P D N VE SR + K Sbjct 68 -RFIETKYPNMISDGVFDTYFNDIKLP-DGNYVEASRLFIDK 107 >sp|P52988|YENI_YEREN Autoinducer synthesis protein yenI Length=214 Score = 55.1 bits (131), Expect = 7e-08, Method: Composition-based stats. Identities = 46/149 (30%), Positives = 68/149 (45%), Gaps = 5/149 (3%) Query 9 DFLAIPSEEYKGILSLRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDTENVSGC 68 +F +P + I SLR FK RL+W + + ESD+YD+ N YI D V Sbjct 8 NFNNMPERKLDEIFSLREITFKDRLDWKVTCIDGKESDQYDDENTNYILGTIDDTIVCSV 67 Query 69 WRLLPTTGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSK--INNSASEITMKQF 126 R + M+ F S P D +E SRF V K ++ + N++S T+ F Sbjct 68 -RFIDMKYPTMITGPFAPYFSDVSLPID-GFIESSRFFVEKALARDMVGNNSSLSTI-LF 124 Query 127 EAIYKHAVSQGITEYVTVTSTAIERFLKR 155 A+ +A +G +TV S + LKR Sbjct 125 LAMVNYARDRGHKGILTVVSRGMFILLKR 153 >sp|P33880|CARI_PECCC Autoinducer synthesis protein carI Length=216 Score = 53.5 bits (127), Expect = 2e-07, Method: Composition-based stats. Identities = 48/183 (26%), Positives = 88/183 (48%), Gaps = 14/183 (7%) Query 15 SEEYKG-ILSLRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDTENVSGCWRLLP 73 SE G + +LR + FK RL W + + +E D+YDN+N Y++ D V R + Sbjct 13 SETKSGELFTLRKETFKDRLNWAVQCTDGMEFDQYDNNNTTYLFGIKDN-TVICSLRFIE 71 Query 74 TTGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSK-INNSASEITMKQFEAIYKH 132 T M+ F + + P+ N +E SRF V K+ +K I + I+ F ++ + Sbjct 72 TKYPNMITGTFFPYFKEINIPEG-NYLESSRFFVDKSRAKDILGNEYPISSMLFLSMINY 130 Query 133 AVSQGITEYVTVTSTAIERFLKR----IKVPCHRIGDKEIHVLGDTKSVVLSMPINEQFK 188 + +G T+ S + LKR I+V + +KE V ++ +P++++ + Sbjct 131 SKDKGYDGIYTIVSHPMLTILKRSGWGIRVVEQGLSEKEERVY------LVFLPVDDENQ 184 Query 189 KAV 191 +A+ Sbjct 185 EAL 187 >sp|P33882|EXPI_PECCC Autoinducer synthesis protein expI Length=217 Score = 53.1 bits (126), Expect = 3e-07, Method: Composition-based stats. Identities = 42/142 (29%), Positives = 68/142 (47%), Gaps = 6/142 (4%) Query 15 SEEYKGILSLRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDTENVSGCWRLLPT 74 SEE + +LR + FK RL W + N +E D+YD+ NA Y++ + + + RL+ T Sbjct 17 SEE---LFTLRKETFKDRLNWAVKCINGMEFDQYDDDNATYLFGVEGDQVICSS-RLIET 72 Query 75 TGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSK-INNSASEITMKQFEAIYKHA 133 M+ F + P+ +E SRF V K SK I ++ ++ F A ++ Sbjct 73 KYPNMITGTFFPYFEKIDIPEG-KYIESSRFFVDKARSKTILGNSYPVSTMFFLATVNYS 131 Query 134 VSQGITEYVTVTSTAIERFLKR 155 S+G T+ S + LKR Sbjct 132 KSKGYDGVYTIVSHPMLTILKR 153 >sp|O87970|YUKI_YERRU Autoinducer synthesis protein yukI Length=216 Score = 48.1 bits (113), Expect = 8e-06, Method: Composition-based stats. Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 3/133 (2%) Query 24 LRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDTENVSGCWRLLPTTGDYMLKSV 83 LR + FK RL+W + N++E DEYDN N Y+ + + R + M+ Sbjct 23 LRKKTFKDRLQWAVNCSNDMEFDEYDNPNTRYLLGIYGNQLICSV-RFIELHRPNMITHT 81 Query 84 FPELLGQQSAPKDPNIVELSRFAVGKNSSK-INNSASEITMKQFEAIYKHAVSQGITEYV 142 F P+ N +E SRF V K+ +K + + I+ F A+ + T Sbjct 82 FNAQFDDIILPEG-NYIESSRFFVDKSGAKTLLGNRYPISYVLFLAVINYTRHHKHTGIY 140 Query 143 TVTSTAIERFLKR 155 T+ S A+ LKR Sbjct 141 TIVSRAMLTILKR 153 >sp|Q46968|ECHI_ERWCH Autoinducer synthesis protein echI Length=212 Score = 42.7 bits (99), Expect = 3e-04, Method: Composition-based stats. Identities = 33/136 (24%), Positives = 59/136 (43%), Gaps = 3/136 (2%) Query 21 ILSLRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDTENVSGCWRLLPTTGDYML 80 + +LR FK RL+W + N +E DEYDN + Y+ + + + R + M+ Sbjct 20 VFTLRKDTFKDRLDWAVNCINGMEFDEYDNEHTTYLLGVKEGKVICSV-RFIEIKYPNMI 78 Query 81 KSVFPELLGQQSAPKDPNIVELSRFAVGKNSSK-INNSASEITMKQFEAIYKHAVSQGIT 139 F P+ N +E SRF V ++ + + + + + F A+ +A Sbjct 79 TGTFYSYFDNLKIPEG-NYIESSRFFVDRDRVRNLIGTRNPACVTLFLAMINYARKYHYD 137 Query 140 EYVTVTSTAIERFLKR 155 +T+ S + LKR Sbjct 138 GILTIVSHPMLTLLKR 153 >sp|Q47187|EXPI_DICD3 Autoinducer synthesis protein expI Length=212 Score = 42.4 bits (98), Expect = 4e-04, Method: Composition-based stats. Identities = 33/136 (24%), Positives = 60/136 (44%), Gaps = 3/136 (2%) Query 21 ILSLRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDTENVSGCWRLLPTTGDYML 80 + +LR FK RL+W + N +E DEYDN + Y+ + + + R + M+ Sbjct 20 VFALRKGTFKDRLDWTVNCINGMEFDEYDNEHTTYLLGVKEGKIICSV-RFIEMKYPNMI 78 Query 81 KSVFPELLGQQSAPKDPNIVELSRFAVGKNSSK-INNSASEITMKQFEAIYKHAVSQGIT 139 F + P+ N +E SRF V ++ + + + + + F A+ +A Sbjct 79 TGTFFSYFDGLNIPEG-NYIESSRFFVDRDRVRNLIGTRNPACLTLFLAMINYARKYHYD 137 Query 140 EYVTVTSTAIERFLKR 155 +T+ S + LKR Sbjct 138 GILTIVSHPMLTLLKR 153 >sp|P54656|ESAI_ERWST Autoinducer synthesis protein esaI Length=210 Score = 38.1 bits (87), Expect = 0.008, Method: Composition-based stats. Identities = 36/142 (25%), Positives = 56/142 (39%), Gaps = 7/142 (4%) Query 15 SEEYKGILSLRYQVFKQRLEWDLVVENNLESDEYDNSNAEYIYACDDTENVSGCWRLLPT 74 SEE + LR + F RL W+++ +ESDE+D YI + + V R Sbjct 17 SEE---LYKLRKKTFSDRLGWEVICSQGMESDEFDGPGTRYILGICEGQLVCSV-RFTSL 72 Query 75 TGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSK-INNSASEITMKQFEAIYKHA 133 M+ F + P E SRF V K ++ + I+ F A+ A Sbjct 73 DRPNMITHTFQHCFSDVTLPAYG--TESSRFFVDKARARALLGEHYPISQVLFLAMVNWA 130 Query 134 VSQGITEYVTVTSTAIERFLKR 155 + T+ S A+ + L R Sbjct 131 QNNAYGNIYTIVSRAMLKILTR 152 >sp|Q8D2S7|HSLU_WIGBR ATP-dependent hsl protease ATP-binding subunit hslU Length=443 Score = 30.8 bits (68), Expect = 1.2, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Query 80 LKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSKINNSASEITMKQFEAIYKHAV 134 L+S+F L GQ+ P+ I E R + + S+K+ N EI K EA+ ++ + Sbjct 199 LQSMFKNLAGQKQKPRKIKIKEAMRLLIEEESAKLIN-LEEIKEKAVEAVEQNGI 252 >sp|Q8PEQ6|OPGD_XANAC Glucans biosynthesis protein D precursor Length=533 Score = 29.3 bits (64), Expect = 3.6, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 35/67 (52%), Gaps = 0/67 (0%) Query 49 DNSNAEYIYACDDTENVSGCWRLLPTTGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVG 108 D+S+ +Y D+ +V+G +R T GD +L + L +++ + S + VG Sbjct 216 DDSDTVVVYGLLDSPSVAGAYRFAITNGDVLLMDIDSALYPRKAIERLGIGPCTSMYQVG 275 Query 109 KNSSKIN 115 +N ++++ Sbjct 276 ENDNRMD 282 >sp|Q1CZI7|HTPG_MYXXD Gene info Chaperone protein htpG (Heat shock protein htpG) (High temperature protein G) Length=654 Score = 28.9 bits (63), Expect = 4.6, Method: Composition-based stats. Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 4/76 (5%) Query 60 DDTENVSGCWRL---LPTTGDYMLKSVFPELLGQQSAPKDPNIVELSRFAVGKNSSKINN 116 +D + G WRL + DY+ + ++ + + D E S V K S+ Sbjct 187 EDQKEFLGEWRLRSLITQYSDYVGHPIKLQV-SKTTGTGDEAKTETSLEVVNKASALWQR 245 Query 117 SASEITMKQFEAIYKH 132 S SEIT +Q++ YKH Sbjct 246 SKSEITDEQYQEFYKH 261
  Database: Non-redundant SwissProt sequences
    Posted date:  May 28, 2007  5:52 PM
  Number of letters in database: 36,638,593
  Number of sequences in database:  111,717
Lambda     K      H
   0.316    0.132    0.376 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 111717
Number of Hits to DB: 4205289
Number of extensions: 161786
Number of successful extensions: 383
Number of sequences better than 10: 14
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 379
Number of HSP's successfully gapped: 14
Length of query: 193
Length of database: 36638593
Length adjustment: 100
Effective length of query: 93
Effective length of database: 25466893
Effective search space: 2368421049
Effective search space used: 2368421049
T: 11
A: 40
X1: 16 (7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 61 (28.1 bits)