HOMOLOGIES GENÈTIQUES

     El nostre objectiu ha estat buscar homologies entre el gen de la immunitat que comparteixen les diferents colicines, donat que és l'únic gen que es troba en totes tres (ColicinaA, ColicinaV i ColicinaE1).

    Hem introduït les tres seqüències aminoacídiques per la immunitat dels tres tipus de Colicina en el programa ClustalW, per tal de veure les corresponents seqüències homòlogues i conservades.

El resultat ha estat el següent:

 

CLUSTAL W (1.83) multiple sequence alignment


P05701|IMMA_CITFR                 MMNEHSIDTDNRKANNALYLFIIIGLIPLLCIFVVYYKTPDALLLRKIAT 50
gi|84060909|ref|YP_444121.1|      --------MDRKRTK-----------LELLFAFIIN-------------- 17
gi|9507255|ref|NP_040357.1|       ----MSLRYYIKNILFGLY-------CTLIYIYLITKNS----------- 28
                                             :.               *:  :::               

P05701|IMMA_CITFR                 STENLPSITSSYNPLMTKVMDIYCKTAPFLALILYILTFKIRKLINNTDR 100
gi|84060909|ref|YP_444121.1|      ------------------------ATAIYIALAIYDCVFRGKDFLS---- 39
gi|9507255|ref|NP_040357.1|       ------------------------EGYYFLVSDKMLYAIVISTILCPYS- 53
                                                              ::.      .:    ::     

P05701|IMMA_CITFR                 NTVLRSCLLSPLVYAAIVYLFCFRNFELTTAGRPVRLMATNDATLLLFYI 150
gi|84060909|ref|YP_444121.1|      -----------------MHTFCFS-----------ALMSA-----ICYFV 56
gi|9507255|ref|NP_040357.1|       --------------KYAIEYIAFNFIKKDFFERRKNLNNAPVAKLNLFML 89
                                                   :  :.*             *  :       : :

P05701|IMMA_CITFR                 GLYSIIFFTTYITLFTPVTAFKLLKKRQ 178
gi|84060909|ref|YP_444121.1|      GDN---YYS--ISDKIKRRSYENSDSK- 78
gi|9507255|ref|NP_040357.1|       YNLLCLVLAIPFGLLGLFISIKNN---- 113
                                          :  :       : :      

 

Tal i com es pot veure suposem que no hi ha massa homologia entre elles, ja que són els asteriscs els que mostren homologia i no n'hi ha gaires. També observem que hi ha molts gaps.

A continuació el programa ens mostra mitjançant el score que l'homologia és poca.

SeqA Name                           Len(aa)  SeqB Name                           Len(aa)  Score
===============================================================================================
1    P05701|IMMA_CITFR              178      2    gi|84060909|ref|YP_444121.1|   78       11   
1    P05701|IMMA_CITFR              178      3    gi|9507255|ref|NP_040357.1|    113      10   
2    gi|84060909|ref|YP_444121.1|   78       3    gi|9507255|ref|NP_040357.1|    113      7    
===============================================================================================

Per veure un mapa més detallat de les seqüències més conservades i de les seqüències consens clickeu aqui

 

El gen d'immunitat de la colicina E1 només esta relacionat estructuralment amb 16 seqüències protèiques de la colicina E1 de gammaproteobacteris

La colicina A te estructures en comú amb unes altres 7 seqüències de diferents colicines

En el cas de la colicina V no s'ha trobat cap tipus de domis conservats. Només es troba en E.coli

 

S'han trobat dominis conservats relacionats amb 23 seqüències protèiques de la cloacina d'enterobacteriaceas 

Per altra banda els dominis estructurals dels gens caa de la colicina A i el gen cae de la colicina E1 mostren seqüències conservades en 53 gammaproteobacteria. Aquests en són alguns exemples:

En el cas del gen cal de la colicina A en 26 enterobacteriaceas es troben dominis estructurals conservats que coincideixen amb la proteina de lisis de la cloacina. Aquests en són alguns exemples:

                  Al veure les homologies que es donen entre les seqüències de les colicines A, E1 i V, entre elles considerem que no hi ha homologies significatives amb el gen de la immunitat que és el que hem comparat donat que és el que es troba en comú en els tres tipus de colicina.

                 D'altra banda, al comparar-les  amb altres seqüències de bacteriocines, es podria deduir que es donen homoliges amb colicines dins de la mateixa classe, com seria d'esperar i a més, observem que es troben homologies amb altres tipus de bacteriocines.

TORNAR