Job Title: 2325926 2327269

Show Conserved Domains

RID=5NWF4XGA015, 2325926 2327269 BLASTP 2.2.16 (Mar-25-2007)
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 5NWF4XGA015


Database: Non-redundant SwissProt sequences
           245,534 sequences; 92,615,539 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports

Query=  2325926 2327269
Length=448


Distance tree of resultsNew  
Score E Sequences producing significant alignments: (Bits) Value sp|Q48543|PEPC_LACDL Aminopeptidase C (Bleomycin hydrolase) 552 5e-157 sp|Q10744|PEPC_LACHE Aminopeptidase C (Bleomycin hydrolase) 536 3e-152 sp|Q928V0|PEPC_LISIN Aminopeptidase C (Bleomycin hydrolase) 495 6e-140 sp|Q56115|PEPC_STRTR Aminopeptidase C (Bleomycin hydrolase) 494 1e-139 sp|O69192|PEPC_LISMO Aminopeptidase C (Bleomycin hydrolase) 491 1e-138 sp|Q9CEG3|PEPC_LACLA Aminopeptidase C (Bleomycin hydrolase) 448 8e-126 sp|Q04723|PEPC_LACLC Aminopeptidase C (Bleomycin hydrolase) 447 1e-125 sp|P94869|PEPG_LACDL Aminopeptidase G 403 3e-112 sp|P94870|PEPE_LACHE Aminopeptidase E 377 3e-104 sp|P94868|PEPW_LACDL Aminopeptidase W 368 1e-101 sp|Q8CPY3|ENO_STAES Enolase (2-phosphoglycerate dehydratase) ... 33.9 0.55 Gene info sp|Q9PGU3|PUR7_XYLFA Phosphoribosylaminoimidazole-succinocarb... 33.5 0.61 sp|Q4L4K7|ENO_STAHJ Enolase (2-phosphoglycerate dehydratase) ... 33.1 0.86 Gene info sp|P43851|PUR7_HAEIN Phosphoribosylaminoimidazole-succinocarb... 32.7 1.1 sp|Q8K9H5|PNP_BUCAP Polyribonucleotide nucleotidyltransferase... 31.6 2.9 sp|P57454|PNP_BUCAI Polyribonucleotide nucleotidyltransferase... 31.2 3.3 sp|P57276|RIR1_BUCAI Ribonucleoside-diphosphate reductase alp... 30.8 4.4 sp|Q8DTS9|ENO_STRMU Enolase (2-phosphoglycerate dehydratase) ... 30.8 5.0 sp|P57564|FMT_BUCAI Methionyl-tRNA formyltransferase 30.4 5.8 sp|P36917|XYNA_THESA Endo-1,4-beta-xylanase A precursor (Xyla... 30.0 7.1 sp|Q3L8P3|SCA2_RICSI Putative surface cell antigen sca2 precurso 30.0 7.4 sp|Q9ZD66|Y478_RICPR Hypothetical protein RP478 precursor 29.6 8.9
Alignments
>sp|Q48543|PEPC_LACDL Aminopeptidase C (Bleomycin hydrolase) Length=449 Score = 552 bits (1422), Expect = 5e-157, Method: Composition-based stats. Identities = 266/446 (59%), Positives = 331/446 (74%), Gaps = 0/446 (0%) Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS EI+ + F +L P A NGI +++T SKV + PTFS+E+DTGS Sbjct 1 MSKEISFDTIEDFTSNLSKHPAYGVAANAAQTNGIFKASQSTQSKVDLDPTFSVEIDTGS 60 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQKQSGRCWMF+ALNTMRH IQ +FK+K FELSQ+YTFFWDKFEKSN+F+ENV+ +AD Sbjct 61 VTNQKQSGRCWMFSALNTMRHSIQKEFKLKGFELSQSYTFFWDKFEKSNFFFENVIGSAD 120 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PL RKV+FL TPQ DGGQWDML LIEKYGIVPK V PET +S S LN LN L Sbjct 121 KPLGDRKVSFLFATPQSDGGQWDMLCGLIEKYGIVPKKVYPETANSENSRALNDTLNTML 180 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RK + LR LV + S ++EA K ++L +R+LA +LG PP F+FEY DDD YHID Sbjct 181 RKGGLELRALVNEGKSTEEVEAHKAELLDAIFRMLATSLGLPPKSFNFEYTDDDGNYHID 240 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 +++TPQ FFKKYV W+L++Y S+IN PT DKPYN +++VE LGNVVGGR+VRHLNL++ Sbjct 241 KDITPQDFFKKYVGWDLENYISVINGPTADKPYNKVFSVEYLGNVVGGRQVRHLNLELSK 300 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 FK L + QLK GE VWFGSDV + DR+ G++DT IY++D LF+ DF+M+KA+RLD GES Sbjct 301 FKELIINQLKQGEVVWFGSDVSKGGDREAGLLDTKIYQRDQLFDYDFSMSKADRLDSGES 360 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 +M HAMV+T VD+VD KPTKWK+ENSWGDK G KGYFV SD WFD+FVYQ V++K +L Sbjct 361 MMNHAMVITAVDLVDDKPTKWKIENSWGDKSGFKGYFVMSDEWFDQFVYQAVLNKAFLPE 420 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALA 446 D++ + P L PWDPMGALA Sbjct 421 DVKKAYDEGKENPIELLPWDPMGALA 446 >sp|Q10744|PEPC_LACHE Aminopeptidase C (Bleomycin hydrolase) Length=449 Score = 536 bits (1381), Expect = 3e-152, Method: Composition-based stats. Identities = 261/448 (58%), Positives = 336/448 (75%), Gaps = 0/448 (0%) Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M+ EI +A+F+ DL P + A NGI ++N +K+ + P FSIE+DTG Sbjct 1 MAKEINNDTIAKFENDLNNHPVFNVASHAAQENGIYKASQNLQTKIDLDPIFSIEIDTGK 60 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 A+QKQSGRCWMF+ALNTMRH +Q +FK++DFELSQNYT FWDKFEKSN+F+ENV+ TAD Sbjct 61 PADQKQSGRCWMFSALNTMRHPLQKKFKLQDFELSQNYTNFWDKFEKSNWFFENVIATAD 120 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 + L RKV+FL TPQQDGGQWDML +IEKYGIVPKSV PET +++ SS LN LN L Sbjct 121 KDLGDRKVSFLFATPQQDGGQWDMLCGIIEKYGIVPKSVYPETANATNSSALNDTLNTLL 180 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKD + LR+LV S+ +++A K++ML + +R+LA + PP KF+FEYRDD+ YHID Sbjct 181 RKDGLELRRLVNAGKSEDEVQARKEEMLNDVFRVLAISTCVPPKKFNFEYRDDNHNYHID 240 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 +++TP+ FF KYV +L ++ S INAPT DKP++ +++VE LGNV GGR+VRHLNL +D Sbjct 241 KDITPKEFFDKYVGMDLANHISTINAPTSDKPFHKVFSVEYLGNVEGGRQVRHLNLKVDE 300 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K L +KQL GE VWFGS+V + S+R+ G++ TN+Y++D LF+ DF+M+KA++LD GES Sbjct 301 MKDLIIKQLNNGEVVWFGSNVVKDSERRAGLLATNLYRRDQLFDVDFSMSKADKLDSGES 360 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 +M HAMV+TGVDIVDGKPTKWK+ENSWG+K G KGYFV SDSWFD FVYQ VI+K L Sbjct 361 MMDHAMVITGVDIVDGKPTKWKIENSWGEKPGFKGYFVMSDSWFDSFVYQAVINKDILPE 420 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALASK 448 DL+ D P L PWDPMGALA K Sbjct 421 DLKKAYDEGKDNPIQLLPWDPMGALAFK 448 >sp|Q928V0|PEPC_LISIN Aminopeptidase C (Bleomycin hydrolase) Length=441 Score = 495 bits (1274), Expect = 6e-140, Method: Composition-based stats. Identities = 245/446 (54%), Positives = 318/446 (71%), Gaps = 6/446 (1%) Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS EIT L F + + P Q ++M NGI A EN SK + P FS E+ T Sbjct 1 MSTEITFDQLESFSKKWRENPDKLVFQASIMKNGIKAATENPVSKATVQPVFSHEVHTDK 60 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V+NQ+QSGRCWMFAALNT RH + +KDFELSQNYT FWDK EK+NYF EN+++TA+ Sbjct 61 VSNQQQSGRCWMFAALNTFRHKLNGTLGLKDFELSQNYTNFWDKLEKANYFLENIIETAN 120 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 + DSR V++L+ TPQQDGGQWDML ++IEKYG+V KS MPET+ SSKS++LN LLN +L Sbjct 121 EDEDSRLVSWLLDTPQQDGGQWDMLVSIIEKYGVVSKSAMPETFQSSKSADLNHLLNERL 180 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 R DAV LRK V ++ D K++MLAE Y++L TLG PP FDFEYR+ D ++ D Sbjct 181 RTDAVILRKAVKEQK---DTAGLKEEMLAEVYQLLVMTLGEPPKVFDFEYRNKDNEFKQD 237 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 ++TP+ F+K+YV +L DY +INAPT DKP+N +TV+ LGN+V G +++LN+++D Sbjct 238 LQITPKEFYKRYVDMDLKDYIPLINAPTKDKPFNQAFTVDYLGNIVNGTPIKYLNVEMDV 297 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K Q+K GE+VWFG DVGQ S+R GIMDT+I+ + F MTKAERLDY S Sbjct 298 LKKATADQIKDGETVWFGCDVGQLSERTTGIMDTDIFLLNQAFGFKTAMTKAERLDYKHS 357 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 ++THAMVLTGV+IV+ + +WKVENSWG+K+G+ GYFVASD+W DEF +QVV+ KKYLS Sbjct 358 MLTHAMVLTGVNIVNNEVNRWKVENSWGEKIGNNGYFVASDAWMDEFTFQVVVHKKYLSK 417 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALA 446 +L + NE P L PWDPMG+LA Sbjct 418 ELIEAFSNE---PIALKPWDPMGSLA 440 >sp|Q56115|PEPC_STRTR Aminopeptidase C (Bleomycin hydrolase) Length=445 Score = 494 bits (1272), Expect = 1e-139, Method: Composition-based stats. Identities = 255/434 (58%), Positives = 316/434 (72%), Gaps = 4/434 (0%) Query 16 DLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAA 75 D +A A++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAA Sbjct 15 DYEANAKYGAIENAVTHNGLLKSIETRQSEVENDFVFSIDLTKDEVSNQKASGRCWMFAA 74 Query 76 LNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTP 135 LNT RH + + FK++ FELSQ +TFFWDK+EKSN+F E ++ TADQ + SRKV FL+ TP Sbjct 75 LNTFRHKLISDFKLESFELSQAHTFFWDKYEKSNWFLEQIIATADQEIGSRKVKFLLDTP 134 Query 136 QQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKA 195 QQDGGQWDM+ +L EKYG+VPKSV PE+ +SS S ELN LN LR+DA LR L+A A Sbjct 135 QQDGGQWDMVVSLFEKYGVVPKSVYPESVASSNSRELNQYLNKLLRQDAQILRDLIASGA 194 Query 196 SDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAW 255 A ++A K++ L E + LA TLG PP +FDF YRD D Y ++ +TP+ FF+KYV Sbjct 195 DQAAVQAKKEEFLQEIFNYLAMTLGLPPRQFDFAYRDKDDNYRSEKGITPRAFFEKYVGL 254 Query 256 NLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESV 315 L DY S+INAPT DKPY YTVEMLGNVVG VR++NL +D FK LA+ Q+KAGESV Sbjct 255 KLSDYVSVINAPTADKPYGKSYTVEMLGNVVGAPSVRYINLPMDRFKELAIAQMKAGESV 314 Query 316 WFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-V 374 WFGSDVGQ SDRQ GI+ TN+Y + ++T KA RLDY ESLMTHAMVLTGVD+ Sbjct 315 WFGSDVGQVSDRQKGILATNVYDFTASMDINWTQDKAGRLDYSESLMTHAMVLTGVDLDA 374 Query 375 DGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPT 434 DGKP KWK+ENSWGDKVG KGYFVASD+W DE+ YQ+V+ K +L+A +++ E D P Sbjct 375 DGKPIKWKIENSWGDKVGQKGYFVASDAWMDEYTYQIVVRKDFLTA--EELAAYEAD-PQ 431 Query 435 VLAPWDPMGALASK 448 VLAPWDPMG+LASK Sbjct 432 VLAPWDPMGSLASK 445 >sp|O69192|PEPC_LISMO Aminopeptidase C (Bleomycin hydrolase) Length=441 Score = 491 bits (1263), Expect = 1e-138, Method: Composition-based stats. Identities = 239/446 (53%), Positives = 317/446 (71%), Gaps = 6/446 (1%) Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M E+T L F + + P Q ++M NGI A EN SKV++ P FS E+ T Sbjct 1 MQTELTFEQLENFSRKWRENPDKLVFQASIMKNGIKAATENPTSKVSIQPVFSHEVATDK 60 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V+NQ+QSGRCWMFAALNT RH + +KDFELSQNYT FWDK EK+NYF EN+++TA Sbjct 61 VSNQQQSGRCWMFAALNTFRHKLNGTLGLKDFELSQNYTNFWDKLEKANYFLENIIETAS 120 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 + DSR V++L+ TPQQDGGQWDML ++IEKYG+VPKS MPET+ S KS++LN LLN +L Sbjct 121 EDEDSRLVSWLLDTPQQDGGQWDMLVSIIEKYGVVPKSAMPETFQSGKSADLNHLLNERL 180 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 R DAV LRK +K D K++MLAE Y++L TLG PP FDFEYR+ D ++ + Sbjct 181 RTDAVILRKAFTEKK---DTAGLKEEMLAEIYQLLVMTLGEPPKVFDFEYRNKDNEFKQE 237 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 ++TP+ F+++YV +L +Y +INAPT DKP+N +TV+ LGN+V G +++LN+++D Sbjct 238 LQITPKDFYERYVDMDLKNYIPLINAPTKDKPFNQAFTVDYLGNIVNGTPIKYLNVEMDV 297 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K A Q+K GE+VWFG DVGQ S++ GIMDT+I+ + F MTKAERLDY S Sbjct 298 LKKAATDQIKDGETVWFGCDVGQLSEKTTGIMDTDIFLLNQTFGFKTAMTKAERLDYKHS 357 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 ++THAMVLTGV++ +G+ +WKVENSWG+K+G+ GYFVASD+W DEF +QVV+ KKYLS Sbjct 358 MLTHAMVLTGVNVANGEVNRWKVENSWGEKIGNNGYFVASDAWMDEFTFQVVVHKKYLSK 417 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALA 446 +L + E P L PWDPMG+LA Sbjct 418 ELIEAFNQE---PIALKPWDPMGSLA 440 >sp|Q9CEG3|PEPC_LACLA Aminopeptidase C (Bleomycin hydrolase) Length=436 Score = 448 bits (1153), Expect = 8e-126, Method: Composition-based stats. Identities = 230/423 (54%), Positives = 295/423 (69%), Gaps = 10/423 (2%) Query 25 ALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQ 84 A++ AV NG+ ++ E S A P FSI+L V NQKQSGRCWMFAALNT RH Sbjct 23 AVENAVTKNGLLSSLEVRGSHAANLPEFSIDLTKDPVTNQKQSGRCWMFAALNTFRHKFI 82 Query 85 AQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDM 144 +FK +DFE SQ YTFFWDK+EKSN+F E ++ D +D R++ FL+ TPQQDGGQWDM Sbjct 83 NEFKTEDFEFSQAYTFFWDKYEKSNWFMEQII--GDIEMDDRRLKFLLQTPQQDGGQWDM 140 Query 145 LSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAK 204 + A+ EKYGIVPK+V PE+ +SS S ELN LN LR+DA LR + D+EA K Sbjct 141 MVAIFEKYGIVPKAVYPESQASSSSRELNQYLNKLLRQDAEILRYTIE---QGGDVEAVK 197 Query 205 QKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSII 264 +++L E + LA TLG PP F+F +R+ D +Y +P+ F+ +YV +L++Y S+I Sbjct 198 EELLQEVFNFLAVTLGLPPQNFEFAFRNKDNEYK-KFVGSPKEFYNEYVGIDLNNYVSVI 256 Query 265 NAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQS 324 NAPT DKPYN YTVE LGNVVGG+EV+HLN+++D FK LA+ Q++AGE+VWFG DVGQ Sbjct 257 NAPTADKPYNKSYTVEFLGNVVGGKEVKHLNVEMDRFKKLAIAQMQAGETVWFGCDVGQE 316 Query 325 SDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-VDGKPTKWKV 383 S+R G++ + Y + +FT +KA RLDYGESLMTHAMVL GVD+ DG TKWKV Sbjct 317 SNRSAGLLTMDSYDFKSSLDIEFTQSKAGRLDYGESLMTHAMVLAGVDLDADGNSTKWKV 376 Query 384 ENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVLAPWDPMG 443 ENSWG G KGYFVASD W DE+ YQ+V+ K L+ ++ + +KP VL PWDPMG Sbjct 377 ENSWGKDAGQKGYFVASDEWMDEYTYQIVVRKDLLT---EEELAAYEEKPQVLLPWDPMG 433 Query 444 ALA 446 ALA Sbjct 434 ALA 436 >sp|Q04723|PEPC_LACLC Aminopeptidase C (Bleomycin hydrolase) Length=436 Score = 447 bits (1151), Expect = 1e-125, Method: Composition-based stats. Identities = 230/423 (54%), Positives = 295/423 (69%), Gaps = 10/423 (2%) Query 25 ALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQ 84 A++ AV NG+ ++ E S A P FS++L V NQKQSGRCWMFAALNT RH Sbjct 23 AVENAVTKNGLLSSLEVRGSHAANLPEFSLDLTKDPVTNQKQSGRCWMFAALNTFRHKFI 82 Query 85 AQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDM 144 +FK +DFE SQ YTFFWDK+EKSN+F E ++ D +D R++ FL+ TPQQDGGQWDM Sbjct 83 NEFKTEDFEFSQAYTFFWDKYEKSNWFMEQII--GDVAMDDRRLKFLLQTPQQDGGQWDM 140 Query 145 LSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAK 204 + A+ +KYGIVPK+V PE+ +SS S ELN LN LR+DA LR + D D++A K Sbjct 141 MVAIFDKYGIVPKAVYPESQASSSSRELNQYLNKLLRQDAEILRYTIE---QDGDVQAVK 197 Query 205 QKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSII 264 +++L E + LA TLG PP F+F +R+ D +Y TP+ F+ +YV +L++Y S+I Sbjct 198 EELLQEVFNFLAVTLGLPPQNFEFAFRNKDNEYK-KFVGTPKEFYNEYVGIDLNNYVSVI 256 Query 265 NAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQS 324 NAPT DKPYN YTVE LGNVVGG+EV+HLN+++D FK LA+ Q++AGE+VWFG DVGQ Sbjct 257 NAPTADKPYNKSYTVEFLGNVVGGKEVKHLNVEMDRFKKLAIAQMQAGETVWFGCDVGQE 316 Query 325 SDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-VDGKPTKWKV 383 S+R G++ + Y + +FT +KA RLDYGESLMTHAMVL GVD+ DG TKWKV Sbjct 317 SNRSAGLLTMDSYDFKSSLDIEFTQSKAGRLDYGESLMTHAMVLAGVDLDADGNSTKWKV 376 Query 384 ENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVLAPWDPMG 443 ENSWG G KGYFVASD W DE+ YQ+V+ K LS ++ + KP VL PWDPMG Sbjct 377 ENSWGKDAGQKGYFVASDEWMDEYTYQIVVRKDLLS---EEELAAYEAKPQVLLPWDPMG 433 Query 444 ALA 446 ALA Sbjct 434 ALA 436 >sp|P94869|PEPG_LACDL Aminopeptidase G Length=437 Score = 403 bits (1035), Expect = 3e-112, Method: Composition-based stats. Identities = 206/443 (46%), Positives = 287/443 (64%), Gaps = 6/443 (1%) Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS E+T +LA+F + A P + +A +G+ + N +T FS EL T + Sbjct 1 MSHELTLQELAEFSANFNADPKNQVIARAAARSGVLEASYNERVAGRLTRVFSTELPTDN 60 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQKQSGRCW+F+ LN +RH A+ K K+F LSQ+Y FFWDK E++N FYE V++TAD Sbjct 61 VTNQKQSGRCWLFSTLNVLRHDFGAKHKAKNFTLSQSYNFFWDKLERANLFYEKVIETAD 120 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PLD R+V DGGQW M +L++KYG+VP VMPE++++S ++ L L K Sbjct 121 KPLDDREVRSYFDFAGHDGGQWHMAISLVKKYGVVPSYVMPESFNTSATNGLASALADKE 180 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKDA+ALR+L A +E A++ L E YR++A +G PP FD EYRDDDK YH++ Sbjct 181 RKDALALRRL-AQAGDQEGLEKARKTFLNEIYRMVAIAVGEPPKTFDLEYRDDDKNYHLE 239 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + LTP +FF KY +LDDY + NAP D Y LY + NV GG + LN+ ++ Sbjct 240 KNLTPVSFFNKYFDVDLDDYVVLTNAP--DHEYGKLYHLGAEDNVEGGSPILFLNVPMEY 297 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 + AV QLK GE+VWFG+DV + DR+ G +DT++YK +DLF+ D +++KA+RL G Sbjct 298 LEQTAVAQLKDGEAVWFGNDVLRQMDRKTGYLDTDLYKLEDLFDVDLSLSKADRLATGAG 357 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 ++HAM L GVD G +WKVENSWGDK G+KG+FV S +WF E+VY+VV+ KKYL+ Sbjct 358 EVSHAMTLVGVDEDKGDIRQWKVENSWGDKSGEKGFFVMSHNWFKEYVYEVVVHKKYLTK 417 Query 421 DLQDVIKNEYDKPTVLAPWDPMG 443 D Q+++ + P LAPWD + Sbjct 418 DQQELLSS---TPVELAPWDSLA 437 >sp|P94870|PEPE_LACHE Aminopeptidase E Length=438 Score = 377 bits (967), Expect = 3e-104, Method: Composition-based stats. Identities = 195/444 (43%), Positives = 282/444 (63%), Gaps = 7/444 (1%) Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M+ E+T +L +F D P + +A +G+ + N + +T FS ELDT + Sbjct 1 MAHELTVQELEKFSADFNKNPKNKVVARAAQRSGVLEASYNDRVQSELTRVFSTELDTDN 60 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQK SGRCW+FA LN +RH ++K KDF SQ Y FFWDK E++N FY +L +AD Sbjct 61 VTNQKHSGRCWLFATLNVLRHEFGKKYKAKDFTFSQAYNFFWDKIERANMFYNRILDSAD 120 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 PLDSR+V + DGGQ+ M +AL+EKYG+VP MPET++++ ++ L KL Sbjct 121 MPLDSRQVKTDLDFAGTDGGQFQMAAALVEKYGVVPSYAMPETFNTNDTTGFATALGDKL 180 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 +KDA+ LRKL + D +I+ ++K L+E Y++ A +G PP KFD EYRDDDK+YH++ Sbjct 181 KKDALVLRKL-KQEGKDDEIKKTREKFLSEVYQMTAIAVGEPPKKFDLEYRDDDKKYHLE 239 Query 241 RELTPQTFFKKYVAW-NLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDID 299 ++LTP F KY+ + DDY + NAP D Y+ LY + NV G ++ LN+ ++ Sbjct 240 KDLTPLEFLHKYLGGVDFDDYVVLTNAP--DHEYDKLYGLPAEDNVSGSIRIKLLNVPME 297 Query 300 TFKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGE 359 A ++ QLK GE+VWFG+DV + DR+ G +DTN+YK DDLF D M+KA+RL G Sbjct 298 YLTAASIAQLKDGEAVWFGNDVLRQMDRKTGYLDTNLYKLDDLFGVDLKMSKADRLKTGV 357 Query 360 SLMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLS 419 ++HAM L GVD +G+ +WKVENSWGDK G KGY+V ++ WF+++VY+VV+ KKYL+ Sbjct 358 GEVSHAMTLVGVDEDNGEVRQWKVENSWGDKSGAKGYYVMNNEWFNDYVYEVVVHKKYLT 417 Query 420 ADLQDVIKNEYDKPTVLAPWDPMG 443 +++ + T L WD + Sbjct 418 DKQKELAEGPI---TDLPAWDSLA 438 >sp|P94868|PEPW_LACDL Aminopeptidase W Length=437 Score = 368 bits (944), Expect = 1e-101, Method: Composition-based stats. Identities = 195/442 (44%), Positives = 276/442 (62%), Gaps = 6/442 (1%) Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M+ E++ L F +D A P + +A +G+ A N + TFSIELDT + Sbjct 1 MTHELSPQLLESFSRDFNADPKNQVISRAARRSGLLEAAYNPAVSQRLNRTFSIELDTDN 60 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQ+QSGRCW+F+ LN +RH K K+F SQ+Y FFWDK E++NYFY+ ++ TAD Sbjct 61 VTNQQQSGRCWLFSTLNVVRHNFGKANKAKNFTFSQSYNFFWDKIERANYFYDRIIATAD 120 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PL R V Q DGGQW M ++LI KYG+VP+ MPE+++S+ S L+ +L K Sbjct 121 RPLTDRTVRGYFDWCQTDGGQWHMAASLIAKYGVVPRYAMPESFNSNHSQALDMVLADKE 180 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKDA+ LR+L A +EAA+ L++ YRI+A LG PP FD E+RDDDK YH+D Sbjct 181 RKDALTLRRL-AQADDQEKLEAARTDFLSQIYRIMATALGEPPKTFDLEFRDDDKNYHLD 239 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + LTP F+KKY A +LDDY + NAP D N + + N+ GG +N+ ++ Sbjct 240 KGLTPVQFYKKYCATDLDDYVVLANAP--DHEMNRVLHLGFEDNIKGGYPNLFINVPMEY 297 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 + A+ QLK GE+VWFG+ VG+ DR+ G MD ++Y+ D L + D ++KA+RL G Sbjct 298 LEDAAIAQLKDGEAVWFGNAVGRQMDRKTGFMDLDLYQLDQLLDIDSHLSKADRLATGIG 357 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 +H M L GVD+ G+ +WKVENSWGDK G+KGYF S WF E+ Y+V + KK++ A Sbjct 358 ESSHDMALVGVDVDGGQVRQWKVENSWGDKSGEKGYFTMSADWFREYTYEVAVQKKHVPA 417 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 ++ D++KN+ P L PWD + Sbjct 418 EILDLLKNQ---PIELDPWDSL 436 >sp|Q8CPY3|ENO_STAES Gene info Enolase (2-phosphoglycerate dehydratase) (2-phospho-D-glycerate hydro-lyase) sp|Q5HQV0|ENO_STAEQ Gene info Enolase (2-phosphoglycerate dehydratase) (2-phospho-D-glycerate hydro-lyase) Length=434 Score = 33.9 bits (76), Expect = 0.55, Method: Composition-based stats. Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 6/100 (6%) Query 302 KALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESL 361 KA+ K GE V+ G D S + G+ D ++ + + AE++DY E L Sbjct 226 KAIEKAGYKPGEDVFLGFDCASSEFYENGVYDYTKFEGEH----GAKRSAAEQVDYLEEL 281 Query 362 MTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASD 401 + ++T D +D W+ D++GDK V D Sbjct 282 IGKYPIITIEDGMD--ENDWEGWKQLTDRIGDKVQLVGDD 319 >sp|Q9PGU3|PUR7_XYLFA Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR synthetase) Length=308 Score = 33.5 bits (75), Expect = 0.61, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 6/59 (10%) Query 224 TKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSIINAPTDDKPY--NHLYTVE 280 TKF+F D + Y +D LTP + +Y W +D+YQ + P+ DK + N+L T++ Sbjct 219 TKFEFGTDIDGRLYVMDEMLTPDS--SRY--WPIDEYQVGTSPPSYDKQFVRNYLETLD 273 >sp|Q4L4K7|ENO_STAHJ Gene info Enolase (2-phosphoglycerate dehydratase) (2-phospho-D-glycerate hydro-lyase) Length=434 Score = 33.1 bits (74), Expect = 0.86, Method: Composition-based stats. Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 6/100 (6%) Query 302 KALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESL 361 KA+ K GE V+ G D S + G+ D ++ + + AE++DY E L Sbjct 226 KAIEKAGYKPGEDVFLGFDCASSEFYENGVYDYTKFEGEH----GAKRSAAEQVDYLEEL 281 Query 362 MTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASD 401 + ++T D +D W D++GDK V D Sbjct 282 IGKYPIITIEDGMD--ENDWDGWKQLTDRIGDKVQLVGDD 319 >sp|P43851|PUR7_HAEIN Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR synthetase) Length=290 Score = 32.7 bits (73), Expect = 1.1, Method: Composition-based stats. Identities = 38/146 (26%), Positives = 64/146 (43%), Gaps = 8/146 (5%) Query 129 AFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALR 188 +L + +D Q + L G+V S +PE + S E G N + Sbjct 112 GYLTGSGLKDYKQTGTICGLKLPEGLVEASKLPEAIFTPSSKEEVG--NHDINISYAECE 169 Query 189 KLV-ADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQT 247 KL+ AD A+ +A +A +Y L + TKF+F ++ +D LTP + Sbjct 170 KLIGADLAAQVKEKAIALYTVAAEY-ALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDS 228 Query 248 FFKKYVAWNLDDYQSIINAPTDDKPY 273 ++ W++D YQ+ N P+ DK + Sbjct 229 --SRF--WSVDTYQAGTNPPSFDKQF 250 >sp|Q8K9H5|PNP_BUCAP Polyribonucleotide nucleotidyltransferase (Polynucleotide phosphorylase) (PNPase) Length=707 Score = 31.6 bits (70), Expect = 2.9, Method: Composition-based stats. Identities = 26/129 (20%), Positives = 60/129 (46%), Gaps = 20/129 (15%) Query 88 KIKDFELSQNYTFF--WDKFEKSNYFYENVLK---TADQPLDSRKVAFLMTTPQQ----- 137 K+ + ++S Y F +++EK N+ E ++K + + +D ++ + ++ Sbjct 248 KLAEKDISNAYLIFNKQERYEKLNFLKEEIIKLFFSENSNIDISEIEDIFEKIEKNIVRK 307 Query 138 ---------DGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALR 188 DG + DM+ AL + G++P++ ++ ++ L + L +DA L Sbjct 308 RILNNENRIDGREKDMIRALDIRTGVLPRTHGSSLFTRGETQSLVS-VTLGTSRDAQNLD 366 Query 189 KLVADKASD 197 +L+ DK + Sbjct 367 ELLGDKTDN 375 >sp|P57454|PNP_BUCAI Polyribonucleotide nucleotidyltransferase (Polynucleotide phosphorylase) (PNPase) Length=707 Score = 31.2 bits (69), Expect = 3.3, Method: Composition-based stats. Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 22/127 (17%) Query 89 IKDFE--LSQNYTFF--WDKFEKSNYFYENVLK---TADQPLDSRKVA------------ 129 I FE +S Y F D+ EK N EN++K + +D+ ++ Sbjct 247 INSFEKNISDAYVIFNKQDRIEKLNSIKENIIKLFLDENSNIDTLEIEDIFQKIEKKVVR 306 Query 130 --FLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVAL 187 L + DG + DM+ AL + GI+P++ ++ ++ L + L +DA L Sbjct 307 KRILSNQTRIDGREKDMIRALDVRTGILPRTHGSALFTRGETQSLVS-VTLGTSRDAQNL 365 Query 188 RKLVADK 194 +L+ D+ Sbjct 366 DELLGDR 372 >sp|P57276|RIR1_BUCAI Ribonucleoside-diphosphate reductase alpha subunit (Ribonucleotide reductase) Length=761 Score = 30.8 bits (68), Expect = 4.4, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 36/61 (59%), Gaps = 10/61 (16%) Query 142 WDMLSALIEKYGI---VPKSVMPETYSSSKSSELNGL------LNLKLRKDAVALRKLVA 192 W++L + I+KYG+ ++MP SS S+ NG+ +++K+ KD + LR++V Sbjct 599 WNLLRSKIKKYGLRNSTLSALMPSETSSQISNATNGIEPPRGFISIKVSKDGI-LRQVVP 657 Query 193 D 193 + Sbjct 658 E 658 >sp|Q8DTS9|ENO_STRMU Enolase (2-phosphoglycerate dehydratase) (2-phospho-D-glycerate hydro-lyase) Length=432 Score = 30.8 bits (68), Expect = 5.0, Method: Composition-based stats. Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 6/100 (6%) Query 302 KALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESL 361 KA+ K GE V+ G D S G+ D ++ + + AE++DY E L Sbjct 224 KAIETAGYKPGEEVFLGFDCASSEFYDNGVYDYTKFEGE----KGAKRSAAEQIDYIEEL 279 Query 362 MTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASD 401 + ++T D +D W + ++GD+ V D Sbjct 280 VNKYPIITIEDAMD--ENDWDGWKALTARLGDRVQLVGDD 317 >sp|P57564|FMT_BUCAI Methionyl-tRNA formyltransferase Length=314 Score = 30.4 bits (67), Expect = 5.8, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 8/65 (12%) Query 299 DTFKALAVKQLKAG--------ESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMT 350 DT K L++K +K G E + + + + + + I+ IYKKD L + + + Sbjct 162 DTTKTLSLKLIKIGIEALLEVLEKIILNTVIYKKQNEKNVILSKKIYKKDALLDWNLSAE 221 Query 351 KAERL 355 K ERL Sbjct 222 KLERL 226 >sp|P36917|XYNA_THESA Endo-1,4-beta-xylanase A precursor (Xylanase A) (1,4-beta-D-xylan xylanohydrolase A) Length=1157 Score = 30.0 bits (66), Expect = 7.1, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 0/41 (0%) Query 230 YRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSIINAPTDD 270 Y DD++Y I R+ T + KYV N D Y + + P +D Sbjct 764 YETDDERYTIKRDGTGSSDITKYVTSNADGYVAQLAIPIED 804 >sp|Q3L8P3|SCA2_RICSI Putative surface cell antigen sca2 precursor Length=1812 Score = 30.0 bits (66), Expect = 7.4, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Query 10 LAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQS 67 L FKQ+ +AT AS+ + N +E +DSK A++P L + N K S Sbjct 1334 LQSFKQENEATNDASSTKDDTQPEDSNKKSEQSDSKTALSPRL---LSSNDSKNDKSS 1388 >sp|Q9ZD66|Y478_RICPR Hypothetical protein RP478 precursor Length=554 Score = 29.6 bits (65), Expect = 8.9, Method: Composition-based stats. Identities = 23/81 (28%), Positives = 34/81 (41%), Gaps = 14/81 (17%) Query 189 KLVADKASDADIEAAKQKMLAEDYRILA--------YT-----LGNPPTKFDFEYRDDDK 235 K ++DK D+ QK+ ED+ IL YT L N P K +F Y + Sbjct 166 KFISDKTQIFDL-VDNQKLYEEDHTILTMLVDKRQYYTSKQDFLNNIPQKLEFYYETEII 224 Query 236 QYHIDRELTPQTFFKKYVAWN 256 Q +++ + P AWN Sbjct 225 QSNLEDRIIPAGLLLYRPAWN 245
  Database: Non-redundant SwissProt sequences
    Posted date:  May 27, 2007  5:53 PM
  Number of letters in database: 36,638,593
  Number of sequences in database:  111,717
Lambda     K      H
   0.316    0.132    0.386 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 111717
Number of Hits to DB: 3022607
Number of extensions: 128057
Number of successful extensions: 346
Number of sequences better than 10: 4
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 357
Number of HSP's successfully gapped: 4
Length of query: 448
Length of database: 36638593
Length adjustment: 109
Effective length of query: 339
Effective length of database: 24461440
Effective search space: 8292428160
Effective search space used: 8292428160
T: 11
A: 40
X1: 16 (7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 65 (29.6 bits)