Job Title: gi|116105931|gb|ABJ71073.1| Aminopeptidase...

RID=5G39ASM6014, gi|116105931|gb|ABJ71073.1| Aminopeptidase C [Lactobacillus casei ATCC 334] TBLASTN 2.2.16 (Mar-25-2007)
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

RID: 5G39ASM6014


Database: All GenBank+EMBL+DDBJ+PDB sequences (but no EST, STS,
GSS,environmental samples or phase 0, 1 or 2 HTGS sequences)
           5,293,483 sequences; 20,713,592,294 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports

Query=  gi|116105931|gb|ABJ71073.1| Aminopeptidase C [Lactobacillus casei ATCC 
334]
Length=448


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gb|CP000423.1|  Lactobacillus casei ATCC 334, complete genome       906    0.0   
emb|CR936503.1|  Lactobacillus sakei strain 23K complete genome     704    0.0   
gb|CP000416.1|  Lactobacillus brevis ATCC 367, complete genome      670    0.0   
emb|AL935253.1|  Lactobacillus plantarum strain WCFS1 complete...   646    0.0   
gb|CP000233.1|  Lactobacillus salivarius subsp. salivarius UCC...   639    0.0   
gb|CP000413.1|  Lactobacillus gasseri ATCC 33323, complete genome   582    1e-164
gb|AE017198.1|  Lactobacillus johnsonii NCC 533, complete genome    578    2e-163
gb|AE016830.1|  Enterococcus faecalis V583, complete genome         577    3e-163
gb|CP000033.2|  Lactobacillus acidophilus NCFM, complete genome     573    7e-162
emb|X80643.1|LDPEPC  L.delbrueckii pepC gene                        565    2e-159
gb|CP000422.1|  Pediococcus pentosaceus ATCC 25745, complete geno   564    3e-159
gb|CP000412.1|  Lactobacillus delbrueckii subsp. bulgaricus AT...   563    7e-159
emb|CR954253.1|  Lactobacillus delbrueckii subsp. bulgaricus A...   562    1e-158
gb|CP000414.1|  Leuconostoc mesenteroides subsp. mesenteroides...   555    2e-156
emb|Z30340.1|LHPEPCG  L.helveticus pepC gene for aminopeptidase C   548    2e-154
gb|CP000411.1|  Oenococcus oeni PSU-1, complete genome              537    4e-151
gb|L26223.1|LBAPEPC  Lactobacillus helveticus aminopeptidase C...   533    8e-150
gb|AE014074.1|  Streptococcus pyogenes MGAS315, complete genome     513    5e-144
dbj|BA000034.2|  Streptococcus pyogenes SSI-1 DNA, complete genom   513    5e-144
gb|AE004092.1|  Streptococcus pyogenes M1 GAS, complete genome      513    7e-144
gb|CP000261.1|  Streptococcus pyogenes MGAS2096, complete genome    513    7e-144
gb|CP000259.1|  Streptococcus pyogenes MGAS9429, complete genome    513    7e-144
gb|CP000017.1|  Streptococcus pyogenes MGAS5005, complete genome    513    7e-144
gb|CP000056.1|  Streptococcus pyogenes MGAS6180, complete genome    513    7e-144
gb|CP000262.1|  Streptococcus pyogenes MGAS10750, complete genome   513    9e-144
gb|AE017262.2|  Listeria monocytogenes str. 4b F2365, complete ge   512    1e-143
gb|CP000419.1|  Streptococcus thermophilus LMD-9, complete genome   512    2e-143
emb|Z30315.1|STPEPCGE  S.thermophilus (CNRZ 302) pepC gene for am   511    2e-143
gb|CP000024.1|  Streptococcus thermophilus CNRZ1066, complete gen   511    3e-143
gb|CP000023.1|  Streptococcus thermophilus LMG 18311, complete ge   511    3e-143
gb|CP000260.1|  Streptococcus pyogenes MGAS10270, complete genome   511    3e-143
gb|CP000408.1|  Streptococcus suis 98HAH33, complete genome         509    8e-143
gb|CP000407.1|  Streptococcus suis 05ZYH33, complete genome         509    8e-143
emb|AM295007.1|  Streptococcus pyogenes Manfredo complete genome    508    2e-142
gb|CP000003.1|  Streptococcus pyogenes MGAS10394, complete genome   508    2e-142
emb|AL596172.1|  Listeria innocua Clip11262 complete genome, segm   508    3e-142
gb|AE010078.1|  Streptococcus pyogenes strain MGAS8232, sectio...   507    4e-142 Gene info
gb|AE014133.1|  Streptococcus mutans UA159, complete genome         503    9e-141
emb|AM263198.1|  Listeria welshimeri serovar 6b str. SLCC5334 com   502    1e-140
gb|AF067409.1|AF067409  Listeria monocytogenes aminopeptidase ...   502    2e-140
emb|AL591983.1|  Listeria monocytogenes strain EGD, complete g...   502    2e-140
gb|CP000410.1|  Streptococcus pneumoniae D39, complete genome       501    3e-140
gb|AE008407.1|  Streptococcus pneumoniae R6 section 23 of 184 ...   501    3e-140 Gene info
gb|AE005672.2|  Streptococcus pneumoniae TIGR4, complete genome     501    3e-140
gb|CP000387.1|  Streptococcus sanguinis SK36, complete genome       494    3e-138
gb|CP000114.1|  Streptococcus agalactiae A909, complete genome      493    1e-137
gb|AE014205.1|  Streptococcus agalactiae 2603V/R section 15 of...   493    1e-137
emb|AL766844.1|SAG766844  Streptococcus agalactiae NEM316 complet   493    1e-137
emb|AM406671.1|  Lactococcus lactis subsp. cremoris MG1363, compl   459    2e-127
gb|CP000425.1|  Lactococcus lactis subsp. cremoris SK11, complete   459    2e-127
gb|M86245.1|LACAPEPC  Lactococcus lactis cysteine aminopeptida...   459    2e-127
gb|AE006417.1|  Lactococcus lactis subsp. lactis IL1403 sectio...   457    3e-127 Gene info
emb|AL935262.1|  Lactobacillus plantarum strain WCFS1 complete...   439    1e-121
gb|AY365130.1|  Lactobacillus helveticus CNRZ32 endopeptidase ...   426    1e-117
emb|Z71782.1|LDPEPGW  L.delbrueckii pepG and pepW genes and unkno   412    2e-113
gb|AE000520.1|  Treponema pallidum subsp. pallidum str. Nichols c   405    3e-111
gb|U77050.1|LHU77050  Lactobacillus helveticus endopeptidase gene   392    2e-107
gb|DQ221762.1|  Lactobacillus helveticus strain WSU19 endopept...   392    2e-107
gb|EF015485.1|  Streptococcus infantarius subsp. infantarius p...   385    2e-105
gb|AY665598.1|  Lactobacillus helveticus peptidase (pepCE) gene,    376    1e-102
dbj|AP009256.1|  Bifidobacterium adolescentis ATCC 15703 DNA, com   347    6e-94 
gb|AE014295.3|  Bifidobacterium longum NCC2705, complete genome     330    6e-89 
emb|CR626927.1|  Bacteroides fragilis NCTC 9343, complete genome    314    6e-84 
dbj|AP006841.1|  Bacteroides fragilis YCH46 DNA, complete genome    314    6e-84 
gb|AE015928.1|  Bacteroides thetaiotaomicron VPI-5482, complete g   303    8e-81 
gb|AE015924.1|  Porphyromonas gingivalis W83, complete genome       296    1e-78 
gb|AE015450.1|  Mycoplasma gallisepticum strain R complete genome   275    4e-72 
gb|AF121254.1|AF121254  Enterococcus faecium cysteine aminopep...   268    5e-70 
dbj|BA000026.2|  Mycoplasma penetrans HF-2 DNA, complete genome     256    1e-66 
gb|AF496529.1|  Lactobacillus delbrueckii subsp. lactis aminop...   149    3e-34 
emb|AJ866922.1|  Lactobacillus sanfranciscensis partial pepC g...   127    1e-27 
gb|AF496520.1|  Lactobacillus delbrueckii subsp. lactis aminop...  86.3    3e-15 
gb|U97360.1|TPU97360  Treponema pallidum HFLK homolog gene, compl  54.7    9e-06 
gb|CP000685.1|  Flavobacterium johnsoniae UW101, complete genome   51.6    7e-05 
emb|BX842650.1|  Bdellovibrio bacteriovorus complete genome, s...  51.2    1e-04 
emb|AJ293860.1|LRE293860  Lactobacillus reuteri mapA operon, stra  45.4    0.005 
gb|CP000284.1|  Methylobacillus flagellatus KT, complete genome    38.1    0.84  
gb|CP000383.1|  Cytophaga hutchinsonii ATCC 33406, complete genom  36.6    2.4   
gb|AE017340.1|  Idiomarina loihiensis L2TR, complete genome        36.6    2.4   
gb|CP000377.1|  Silicibacter sp. TM1040, complete genome           35.4    5.4   
gb|CP000494.1|  Bradyrhizobium sp. BTAi1, complete genome          35.0    7.1   
gb|CP000439.1|  Francisella tularensis subsp. novicida U112, comp  34.7    9.3   
Alignments
>gb|CP000423.1| Download subject sequence spanning the HSP Lactobacillus casei ATCC 334, complete genome Length=2895264 Features in this part of subject sequence: Aminopeptidase C Score = 906 bits (2341), Expect = 0.0 Identities = 448/448 (100%), Positives = 448/448 (100%), Gaps = 0/448 (0%) Frame = +2 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS Sbjct 2325926 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 2326105 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD Sbjct 2326106 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 2326285 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL Sbjct 2326286 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 2326465 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID Sbjct 2326466 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 2326645 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT Sbjct 2326646 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 2326825 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES Sbjct 2326826 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 2327005 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA Sbjct 2327006 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 2327185 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALASK 448 DLQDVIKNEYDKPTVLAPWDPMGALASK Sbjct 2327186 DLQDVIKNEYDKPTVLAPWDPMGALASK 2327269 Features in this part of subject sequence: Aminopeptidase C Score = 463 bits (1192), Expect = 6e-129 Identities = 233/438 (53%), Positives = 293/438 (66%), Gaps = 3/438 (0%) Frame = +3 Query 3 AEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVA 62 +EIT + F+ L P A A +AV N G A + M P FS++LDTG+VA Sbjct 2324379 SEITFDQIKDFQAQLAKQPAAGATARAVQNVGPQAASREPIDGEDMKPVFSLDLDTGTVA 2324558 Query 63 NQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQP 122 NQK+SGRCW+FA LNT+RHGI +F IKDFE SQNY F+D+ EK+N FYEN+L TAD+P Sbjct 2324559 NQKKSGRCWLFATLNTVRHGIADEFGIKDFEFSQNYNAFFDRLEKANLFYENILATADKP 2324738 Query 123 LDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRK 182 LD+R+VA ++ P QDGG +D ALIEKYG+VPKS+MPETY+S K+ ELN +LN KLRK Sbjct 2324739 LDAREVADYLSGPDQDGGHYDQAEALIEKYGLVPKSIMPETYNSEKTVELNSVLNEKLRK 2324918 Query 183 DAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRE 242 DA LR+L A D I A K++ L+ YRILAYT GNPPT+FDFEYRDD KQYH D Sbjct 2324919 DAKVLRELKQANAGDDAIAAKKREFLSVVYRILAYTFGNPPTQFDFEYRDDKKQYHRDTN 2325098 Query 243 LTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFK 302 LTPQ+FFKKYV W+ DDY + + P +K Y+ LYT+ VVGG + LNL D K Sbjct 2325099 LTPQSFFKKYVKWHFDDYVVVASDPEPNKKYHQLYTIASANTVVGGHPLTILNLPPDQLK 2325278 Query 303 ALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLM 362 LA+ QL+AGE+VWFG+DV DR+ G + +Y DLF+ D K +R+ E+ M Sbjct 2325279 KLALTQLQAGEAVWFGNDVLADMDRKSGTLKGGLYNYSDLFDLDLHFDKTDRIVTTEAEM 2325458 Query 363 THAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADL 422 +HAM LTG D+VDG+ TKWKVENSWG G GYFVA SWFD++VY+VV+ K L Sbjct 2325459 SHAMTLTGADVVDGEVTKWKVENSWGKDNGHDGYFVADASWFDQYVYEVVVRKDLLDPAD 2325638 Query 423 QDVIKNEYDKPTVLAPWD 440 Q +K P + WD Sbjct 2325639 QAALK---ATPINVPVWD 2325683 >emb|CR936503.1| Download subject sequence spanning the HSP Lactobacillus sakei strain 23K complete genome Length=1884661 Features in this part of subject sequence: Cysteine aminopeptidase C2 (Bleomycin hydrolase) Score = 704 bits (1817), Expect = 0.0 Identities = 335/448 (74%), Positives = 386/448 (86%), Gaps = 0/448 (0%) Frame = +3 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M IT D+ QFK D +A P ++ ++ VMN+G A+++NT SK M P FSI+LDTG+ Sbjct 1668975 MVQPITAKDIQQFKADFKAVPQSNVIKNTVMNSGFLASSQNTTSKALMDPVFSIDLDTGA 1669154 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V+NQKQSGRCWMFAALNTMRH +QAQFKIKDFELSQNYT FWDKFEKSNYFYENVLKTAD Sbjct 1669155 VSNQKQSGRCWMFAALNTMRHSLQAQFKIKDFELSQNYTNFWDKFEKSNYFYENVLKTAD 1669334 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 QP+ RKV FLMTTPQQDGGQWDML ALIEKYGIVPKSVMPETY+S KSSELN +LNLKL Sbjct 1669335 QPIGDRKVDFLMTTPQQDGGQWDMLCALIEKYGIVPKSVMPETYNSEKSSELNSVLNLKL 1669514 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKDAV LR+LVAD S+ADI+A K ML E YR+L + LG PP +FDFEYRDDD YHI+ Sbjct 1669515 RKDAVTLRQLVADGVSEADIQAKKDTMLTEVYRMLVFALGEPPVEFDFEYRDDDHNYHIE 1669694 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + LTPQTF++KYV W+L++Y S+IN+PT DKPYNHLY+VEMLGNVVGGREVRHLNLDID Sbjct 1669695 KGLTPQTFYQKYVGWDLENYVSLINSPTADKPYNHLYSVEMLGNVVGGREVRHLNLDIDD 1669874 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 FK LA+KQL+AGESVWFGSDVGQSSDR+LGIMDT IY+K L N D +++K ERLDYGES Sbjct 1669875 FKQLAIKQLQAGESVWFGSDVGQSSDRKLGIMDTKIYQKAALLNMDLSISKGERLDYGES 1670054 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 LMTHAMV+TGVDIVDG+PTKWKVENSWGDKVG KGYFV SDSWFDEFVYQ+VI+K++L+ Sbjct 1670055 LMTHAMVITGVDIVDGQPTKWKVENSWGDKVGTKGYFVMSDSWFDEFVYQIVINKRFLTP 1670234 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALASK 448 ++Q + K EYD PTVLAPWDPMGALAS+ Sbjct 1670235 EMQRIEKEEYDHPTVLAPWDPMGALASR 1670318 Features in this part of subject sequence: Cysteine aminopeptidase C1 (Bleomycin hydrolase) (N-termi... Cysteine aminopeptidase C1 (Bleomycin hydrolase) (C-termi... Score = 477 bits (1228), Expect = 4e-133 Identities = 229/442 (51%), Positives = 310/442 (70%), Gaps = 3/442 (0%) Frame = +1 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M+ EIT +L + +Q L P A L+ AVMNNGINA A+ D+ V + PT+SI+L TG Sbjct 1667449 MTQEITHANLIKMRQALADMPQAQTLRNAVMNNGINAVAQRPDAAVTLDPTYSIDLPTGD 1667628 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V+ QK+SGRCW+FA LNT+RH + Q+ +K+FELSQNY FWD+ EK+N FYE +L TA Sbjct 1667629 VSFQKKSGRCWLFATLNTLRHDFEQQYNVKNFELSQNYLSFWDRIEKANLFYEKILATAT 1667808 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +P+ R+VAF + P DGGQWD ALI+KYG VPKSVMPETY+S ++E N LNLKL Sbjct 1667809 KPITDREVAFALAGPDFDGGQWDNAVALIQKYGAVPKSVMPETYNSDLTTEFNSTLNLKL 1667988 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 R DA+ LR+LVA++A I + ML+E YR+ Y G P FDF YRD+D+QYH+D Sbjct 1667989 RTDAIKLRQLVANQAPSDKISETRTAMLSEIYRLSVYAFGEPVETFDFAYRDNDQQYHLD 1668168 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + LTP +F++KY+ N DDY +++++P K YN LY+++ VV G +R LNL D Sbjct 1668169 QGLTPLSFYQKYLNRNFDDYVTVVSSPQASKQYNQLYSLDSQDTVVEGHPMRLLNLPPDR 1668348 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 KALA++ LKAGE +WFG+DV DRQ G +D+N+Y LF+ D TM K +RLDY + Sbjct 1668349 LKALAIQSLKAGEPIWFGNDVLADLDRQKGWLDSNLYDYSSLFSIDLTMPKDQRLDYRQG 1668528 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 +++HAM LTGV++VD +PTKWKVEN+W DKVG+KGYF SD+ FD++VY+VVI K+YL+ Sbjct 1668529 VVSHAMTLTGVNLVDDQPTKWKVENTWSDKVGNKGYFSMSDA*FDDYVYEVVIKKEYLTK 1668708 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 + Q ++ P L PWD + Sbjct 1668709 EEQALLD---QTPIKLDPWDAL 1668765 >gb|CP000416.1| Download subject sequence spanning the HSP Lactobacillus brevis ATCC 367, complete genome Length=2291220 Features in this part of subject sequence: Aminopeptidase C Score = 670 bits (1729), Expect = 0.0 Identities = 324/446 (72%), Positives = 375/446 (84%), Gaps = 2/446 (0%) Frame = -3 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 +S EIT A+++Q L + A +++AV + GI ATA + S+ M+P FSI+LDTG Sbjct 606325 VSKEITADQTARYQQALASDASAKVIERAVTHQGILATAADYASEADMSPVFSIDLDTGK 606146 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 VANQKQSGRCWMFAALNTMRH + FK+ DFELSQNYT+FWDKFEK+NYFYENVL TAD Sbjct 606145 VANQKQSGRCWMFAALNTMRHHLADLFKLSDFELSQNYTYFWDKFEKANYFYENVLATAD 605966 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 QP SRKVAFLMTTPQQDGGQWDML A+IEKYGIVPKSVMPETY+SSKS+ELN LNLKL Sbjct 605965 QPTSSRKVAFLMTTPQQDGGQWDMLCAIIEKYGIVPKSVMPETYNSSKSNELNSTLNLKL 605786 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKDA LR+LVADKASD +I AAK KML EDYRILA+TLG P ++FDFEYRDDDK YHID Sbjct 605785 RKDATILRQLVADKASDDEIAAAKDKMLQEDYRILAFTLGEPVSEFDFEYRDDDKNYHID 605606 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + LTP+TFF KYV W+L+DY SIINAPT DKPYNH YTVEMLGNVVGGR V+HLN+ I+ Sbjct 605605 KGLTPKTFFDKYVGWDLNDYVSIINAPTADKPYNHTYTVEMLGNVVGGRAVKHLNVSIED 605426 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 FK LA+KQL+AG+SVWFG DVGQ S+RQ GIMDT Y KD LFN DF+MTKAE+LDYGES Sbjct 605425 FKQLAIKQLQAGQSVWFGCDVGQESERQKGIMDTKYYDKDALFNVDFSMTKAEKLDYGES 605246 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 LMTHAMVLTGVD+VDG+PTKWKVENSWG+KVG KGYFV SD+W D++ YQVV++K++L A Sbjct 605245 LMTHAMVLTGVDLVDGQPTKWKVENSWGEKVGTKGYFVMSDAWLDKYCYQVVVNKQFLPA 605066 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALA 446 DL+ E ++PTVLAPWDPMGALA Sbjct 605065 DLKTT--QETEEPTVLAPWDPMGALA 604994 Features in this part of subject sequence: cysteine aminopeptidase Score = 472 bits (1215), Expect = 1e-131 Identities = 221/439 (50%), Positives = 310/439 (70%), Gaps = 5/439 (1%) Frame = -1 Query 4 EITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVAN 63 E+T + A + D+Q P + +A + NG+ A +E+ + V + TFS+EL TG V+N Sbjct 2274819 ELTAAETADLRADVQQQPAHDVIARATIKNGVLAASEDPQAAVRLNRTFSVELPTGKVSN 2274640 Query 64 QKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPL 123 QK SGRCW+F+ LNT+RH A++ +KDFELSQ+Y FFWDK E++N FY+ +L+TADQP+ Sbjct 2274639 QKHSGRCWLFSTLNTIRHQFAAKYHVKDFELSQSYLFFWDKVERANIFYDRILRTADQPV 2274460 Query 124 DSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKD 183 DSR+VA ++ P DGGQW M ++L++KYG+VP S MPE+++++ ++ NLKLRKD Sbjct 2274459 DSREVAAILNNPGGDGGQWAMGASLVQKYGVVPVSAMPESFNTNDTTGFAATFNLKLRKD 2274280 Query 184 AVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDREL 243 A+ LR LVAD+AS+ I A + + L E YR+ AY+ G PPT FD EY+DD++QYH D L Sbjct 2274279 ALVLRDLVADQASEEQIAATRAQALKEVYRMAAYSFGEPPTTFDLEYKDDNQQYHRDAGL 2274100 Query 244 TPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKA 303 TPQ FF+KY +LDDY I N+P DK +N Y +E N+VGG+++ LNL + K Sbjct 2274099 TPQGFFEKYFDVDLDDYVVISNSP--DKAFNQRYRLESQENIVGGQQITFLNLPLAELKR 2273926 Query 304 LAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMT 363 A+ QLK GE+VWFG+DV Q R+ G +D+ +YK DLF D ++TKA+RL GE+ ++ Sbjct 2273925 AAIAQLKDGETVWFGNDVLQQMSRERGFLDSQLYKTADLFGIDLSLTKAQRLALGEAEVS 2273746 Query 364 HAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQ 423 HAM TGV++VD +PT+WKVENSWG+K GDKGYFV +D WF +FVY+VV++K+YL+AD Q Sbjct 2273745 HAMTFTGVNVVDDEPTRWKVENSWGEKNGDKGYFVMTDEWFSDFVYEVVVNKRYLTADQQ 2273566 Query 424 DVIKNEYDKPTVLAPWDPM 442 V+ PT L WD + Sbjct 2273565 AVLAT---TPTELPAWDSL 2273518 >emb|AL935253.1| Download subject sequence spanning the HSP Lactobacillus plantarum strain WCFS1 complete genome; segment 2/11 Length=324050 Features in this part of subject sequence: cysteine aminopeptidase Score = 646 bits (1666), Expect = 0.0 Identities = 307/446 (68%), Positives = 369/446 (82%), Gaps = 3/446 (0%) Frame = -3 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 +S I+ +A F+ DL P A ++++V NGI A++++ + TP FSI+LDTG Sbjct 231021 LSKAISMNQIANFQADLDQRPEAKVIERSVTKNGILASSQDIQAMSQTTPVFSIDLDTGD 230842 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 VANQKQSGRCWMFAALNTMRH + +F +K FELSQNYTFFWDKFEK+NYFYENVL TAD Sbjct 230841 VANQKQSGRCWMFAALNTMRHSLAEKFNLKHFELSQNYTFFWDKFEKANYFYENVLATAD 230662 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 Q SRKVA+LMTTPQQDGGQWDML A+I+KYGIVPKSVMPETY+SSKS+E+N LNLKL Sbjct 230661 QATSSRKVAWLMTTPQQDGGQWDMLVAIIQKYGIVPKSVMPETYNSSKSAEINSTLNLKL 230482 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKDAV LR+LVA SD I+ K+KML E YR+LAY G P + FD+EYRDD KQYHID Sbjct 230481 RKDAVELRELVAAGTSDDAIQERKEKMLNEVYRMLAYAFGEPVSHFDWEYRDDKKQYHID 230302 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + LTPQ+FF+KYV WNLDDY SIINAPTDDKPYNH YT+EMLGNV+GGREV+HLN+ + Sbjct 230301 QNLTPQSFFEKYVGWNLDDYVSIINAPTDDKPYNHTYTIEMLGNVLGGREVKHLNVSMAD 230122 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 FK LA+KQL+AG+SVWFG DVGQSSDRQ G+M T++Y KD+LF+ D +M+KAERLDYGES Sbjct 230121 FKQLAIKQLQAGQSVWFGCDVGQSSDRQKGVMATDVYSKDELFDVDLSMSKAERLDYGES 229942 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 LMTHAMV+TGVD+VDG+PTKWKVENSWGDKVG KG+FV SD+W DE+ YQVV++K++LS Sbjct 229941 LMTHAMVITGVDLVDGQPTKWKVENSWGDKVGTKGFFVMSDAWMDEYCYQVVVNKEFLSD 229762 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALA 446 DL+ + ++PTVLAPWDPMGALA Sbjct 229761 DLKAA---QAEEPTVLAPWDPMGALA 229693 >gb|CP000233.1| Download subject sequence spanning the HSP Lactobacillus salivarius subsp. salivarius UCC118, complete genome Length=1827111 Features in this part of subject sequence: Aminopeptidase C Score = 639 bits (1647), Expect = 0.0 Identities = 304/447 (68%), Positives = 371/447 (82%), Gaps = 4/447 (0%) Frame = +2 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 +S I++ L++F Q ++ P + L++AV NGI T+ + S+V M P FSI+LDTG Sbjct 1282931 VSEAISSEQLSKFHQLIEDDPKSRVLERAVSKNGILTTSADFHSEVNMDPVFSIDLDTGD 1283110 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKI-KDFELSQNYTFFWDKFEKSNYFYENVLKTA 119 VANQKQSGRCWMFAALNTMRH ++ +F + KDFELSQ+YTFFWDK EKSNYFYENV+KTA Sbjct 1283111 VANQKQSGRCWMFAALNTMRHDLKNRFGVAKDFELSQSYTFFWDKLEKSNYFYENVIKTA 1283290 Query 120 DQPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLK 179 P RKV++LMTTPQQDGGQWDM++A+I KYG+VPKSVMPE+Y+SSKS+ELN LNLK Sbjct 1283291 SLPTSDRKVSWLMTTPQQDGGQWDMITAIIRKYGVVPKSVMPESYNSSKSNELNSTLNLK 1283470 Query 180 LRKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHI 239 LRKDAV LR+LV AS ++ + K+K LAE YRIL YTLG PP KFDFEYRD D YHI Sbjct 1283471 LRKDAVDLRELVNSNASSEEVASFKEKKLAEIYRILVYTLGEPPVKFDFEYRDSDNNYHI 1283650 Query 240 DRELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDID 299 D++LTPQTFF+KYV WNLDDY SIINAPTDDKPYNH+YT+EMLGNV+G REVRHLN+D++ Sbjct 1283651 DQDLTPQTFFEKYVNWNLDDYVSIINAPTDDKPYNHMYTIEMLGNVLGEREVRHLNVDMN 1283830 Query 300 TFKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGE 359 TF+ +A+KQL++GESVWFG DVGQ SDR+ GIMDT +Y KD+LF+ DF+M+KAERLDY E Sbjct 1283831 TFRQVAIKQLESGESVWFGCDVGQESDRKKGIMDTELYHKDELFDVDFSMSKAERLDYSE 1284010 Query 360 SLMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLS 419 SLMTHAMVLTGVD+V+G PTKWKVENSWGDKVG KG+FV S++W +E+ YQVV++KK+L Sbjct 1284011 SLMTHAMVLTGVDLVNGTPTKWKVENSWGDKVGTKGFFVMSNNWMEEYCYQVVVNKKFLP 1284190 Query 420 ADLQDVIKNEYDKPTVLAPWDPMGALA 446 +LQ V+ E P VLAPWDPMG+LA Sbjct 1284191 EELQKVLTEE---PKVLAPWDPMGSLA 1284262 >gb|CP000413.1| Download subject sequence spanning the HSP Lactobacillus gasseri ATCC 33323, complete genome Length=1894360 Features in this part of subject sequence: Aminopeptidase C Score = 582 bits (1500), Expect = 1e-164 Identities = 278/446 (62%), Positives = 338/446 (75%), Gaps = 0/446 (0%) Frame = -1 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS EIT + F+ D ++ +A NGI ++N +K+ + PTFSIE+DTG Sbjct 359350 MSKEITNDLINDFENDFNSSKANKIAARAAQENGIFKASQNLQTKINLDPTFSIEIDTGK 359171 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 VANQKQSGRCWMF+ALNTMRH IQ FKIKDFELSQNYT FWDKFEKSN+F+ENV+ TAD Sbjct 359170 VANQKQSGRCWMFSALNTMRHSIQKNFKIKDFELSQNYTNFWDKFEKSNWFFENVIATAD 358991 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 + L RKV+FL TTPQQDGGQWDML +IEKYGI PK V PET +++ SS LN LN L Sbjct 358990 KDLGDRKVSFLFTTPQQDGGQWDMLCGIIEKYGIAPKKVYPETANATNSSALNDTLNTLL 358811 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKD + LRK+V D S+ +++A K +ML E YRILA +LG PP KFDFEY+DDD YH D Sbjct 358810 RKDGLELRKMVQDGKSEDEVQARKNEMLREVYRILAISLGVPPKKFDFEYKDDDGNYHRD 358631 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 +L+PQ FFKKYV W+L Y S INAPT DKP++ +++VE LGNV GGR+VRHLNL +D Sbjct 358630 ADLSPQDFFKKYVNWDLSQYISTINAPTKDKPFHKVFSVEYLGNVEGGRQVRHLNLPVDE 358451 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K L +KQLK GE VWFGS+V + S+RQ G++DT +YK+DDLF+ DF M+KA+ LD GES Sbjct 358450 MKDLIIKQLKNGEVVWFGSNVVKDSERQAGLLDTELYKRDDLFDVDFNMSKADMLDSGES 358271 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 +M HAMV+TGVD+VDGKPTKWK+ENSWG+K G KGYFV SD WFD+FVYQ VI+KKYLS Sbjct 358270 MMDHAMVITGVDLVDGKPTKWKIENSWGEKPGFKGYFVMSDKWFDKFVYQAVINKKYLSD 358091 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALA 446 DL+ + P L PWDPMGALA Sbjct 358090 DLKKAFEEGSKDPIQLLPWDPMGALA 358013 Features in this part of subject sequence: cysteine aminopeptidase Score = 419 bits (1077), Expect = 1e-115 Identities = 202/442 (45%), Positives = 288/442 (65%), Gaps = 6/442 (1%) Frame = +1 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M+ E+T ++A+F+QD Q + AV+NNG+ + N++ + TFSIE+ T + Sbjct 213730 MAHELTLDEIAKFQQDYQRNKQNKIAELAVVNNGVQKVSFNSEGIRDLNRTFSIEIPTDN 213909 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V +QKQSGRCW+FAALN +RH Q+ K+F SQ+Y FFWD+ E++N F+ ++L+TAD Sbjct 213910 VTDQKQSGRCWLFAALNVLRHKFAKQYHAKNFTFSQSYLFFWDRIERANIFFNHILETAD 214089 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +P+D R V F + P DGGQW M +LI KYG+VP E+++++ ++ N LN+KL Sbjct 214090 KPVDDRTVHFYLQAPDTDGGQWHMAISLIRKYGLVPTYAQDESFTANNTAAFNQALNMKL 214269 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 R+D + LRKL A + ++E +Q+ L+E YR+ G P KFD E++DDD Y +D Sbjct 214270 REDGLVLRKL-AQAGKNDEVEQKRQEFLSEVYRMAVIAFGQPVQKFDLEFKDDDGNYKLD 214446 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + L+P FF Y +LDDY + NAP D Y+ LY NV GG +R LN +I+ Sbjct 214447 QNLSPLDFFHNYFEDDLDDYVVLFNAP--DHEYDKLYAFPFEDNVEGGSPIRFLNTNIEN 214620 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K A+KQLK GE++WFG DVG+ SDRQ GI+ ++Y+ D +FN + ++K ERL+ G S Sbjct 214621 LKEAAIKQLKDGETIWFGCDVGKQSDRQKGILAADLYETDTIFNIETKLSKKERLETGAS 214800 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 THAM L GVD+VDGKP +WKVENSWG KVG+KGYFV D WF+E++++VV+ K+YL A Sbjct 214801 GSTHAMTLVGVDVVDGKPRQWKVENSWGTKVGEKGYFVMDDKWFNEYLFKVVVKKQYLPA 214980 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 L +K K T + WD M Sbjct 214981 KL---VKIAEGKATPVPCWDSM 215037 Features in this part of subject sequence: cysteine aminopeptidase Score = 412 bits (1060), Expect = 1e-113 Identities = 206/442 (46%), Positives = 288/442 (65%), Gaps = 7/442 (1%) Frame = -3 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS E+T ++ QF+ D + + +A M +G+ + N + FS+E++T + Sbjct 217088 MSHELTLQEIDQFRNDFDNSRN-EVVSRAAMRSGVLEASFNPAVTNRLNDVFSVEVETDN 216912 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQ QSGRCW+FA LNT+RH ++K K+F LSQ Y FFWDK E++N FY+ ++ +AD Sbjct 216911 VTNQMQSGRCWLFATLNTLRHDFGKKYKAKNFTLSQAYNFFWDKIERANIFYDAIIDSAD 216732 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PLD R V M DGGQW M ++L++KYG+VP + MPE+++++ ++ L L K Sbjct 216731 KPLDDRTVKAYMNFAGSDGGQWAMAASLVKKYGVVPTNAMPESFNTNHTAGLADALARKE 216552 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKDA+ LRKLV + +D ++E +++ L+E YR+ A +G PP FD EYRDDDK+ H+D Sbjct 216551 RKDALVLRKLVQEGKTD-EVEKKRKEFLSEIYRMTAIAVGEPPKTFDLEYRDDDKKLHLD 216375 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + LTP FF KY N DDY + NAP D Y LY++ NV GG + LN+ I+ Sbjct 216374 KNLTPVEFFNKYWDINFDDYVCLTNAP--DHEYGKLYSLPFEDNVNGGLPITFLNVPIEY 216201 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K AVKQLK GESVWFG+DV + DR+ G +DT +YK D+LF+ D MTKAERL GE Sbjct 216200 LKEAAVKQLKDGESVWFGNDVLKEMDRKTGYLDTELYKTDELFDVDTYMTKAERLATGEG 216021 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 ++HAM L GVD+ G+ KWKVENSW +K G KGYF SD WFDEFVY+VV+ K++L+ Sbjct 216020 EVSHAMTLVGVDLDKGEIRKWKVENSWSEKSGRKGYFTMSDKWFDEFVYEVVVRKEFLTD 215841 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 D + + ++ KPT L WD + Sbjct 215840 DQKKLAES---KPTPLPAWDSL 215784 Features in this part of subject sequence: Cysteine aminopeptidase Score = 381 bits (978), Expect = 4e-104 Identities = 195/437 (44%), Positives = 273/437 (62%), Gaps = 9/437 (2%) Frame = +3 Query 9 DLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSG 68 +LA F D +A NG+ + N + + TFS ELD G V +QK SG Sbjct 712794 ELAAFSADFNKNDKNKVASRAARRNGLFEASFNDEVSKRLNHTFSTELDIGGVTDQKHSG 712973 Query 69 RCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKV 128 RCW FA LN +RH ++ +KDF SQ Y FFWDK E++N FY+++++ AD+P+D R+V Sbjct 712974 RCWEFATLNVLRHHFGKKYHVKDFTFSQAYNFFWDKIERANAFYDSMIRLADKPVDDREV 713153 Query 129 AFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALR 188 + QDGG W M L++KYG+VP MPE +S+ ++ L L K RKDA+ LR Sbjct 713154 ETWLYFAGQDGGLWQMAINLVKKYGVVPSYAMPENATSNNTTALIDSLARKERKDALVLR 713333 Query 189 KLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTF 248 KLV + + + E AK++ L E YR+ A LG PP KFD EYRDDDK+YH++++LTP+ F Sbjct 713334 KLVQEGKLE-EAEKAKKEFLNEVYRMAAVALGEPPKKFDLEYRDDDKKYHLEKDLTPRQF 713510 Query 249 FKKYVA-WNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVK 307 +KY+ +N DDY ++N+P D YN Y + NV GG+ + LN+ I+ A Sbjct 713511 AEKYLKDFNWDDYVVLLNSPNYD--YNKRYHQGLYDNVAGGQPITGLNVPIEVLARAAAA 713684 Query 308 QLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMV 367 QLK G++V FG+DV + +R+ G +DT++YK DDLF+ D M+KA+RL GE TH M Sbjct 713685 QLKDGKAVIFGNDVLKQMERKTGFLDTDLYKTDDLFSVDTQMSKADRLATGEGSATHDMT 713864 Query 368 LTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIK 427 L GVD +G+ KWKVENSWGDK G KG++ S WF+E+VY VV+ KKYL DL + Sbjct 713865 LVGVDEDNGEIRKWKVENSWGDKYGHKGFYEMSQKWFEEYVYDVVVDKKYLPEDLVKL-- 714038 Query 428 NEYDKPTV-LAPWDPMG 443 +++P V L PW+ +G Sbjct 714039 --WEEPAVDLKPWEHIG 714083 >gb|AE017198.1| Download subject sequence spanning the HSP Lactobacillus johnsonii NCC 533, complete genome Length=1992676 Features in this part of subject sequence: aminopeptidase C Score = 578 bits (1489), Expect = 2e-163 Identities = 278/447 (62%), Positives = 337/447 (75%), Gaps = 0/447 (0%) Frame = -1 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS EIT + F+ D ++ +A NGI ++N +K+ + PTFSIE+DTG Sbjct 442939 MSKEITNDLINNFENDFNSSKANKIAARAAQENGIFKASQNLQTKIDLDPTFSIEIDTGK 442760 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 VANQKQSGRCWMF+ALNTMRH IQ FKIKDFELSQNYT FWDKFEKSN+F+ENV+ TAD Sbjct 442759 VANQKQSGRCWMFSALNTMRHSIQKNFKIKDFELSQNYTNFWDKFEKSNWFFENVIATAD 442580 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 + L RKVAFL TPQQDGGQWDML +IEKYGIVPK V PET +++ SS LN LN L Sbjct 442579 KDLGDRKVAFLFATPQQDGGQWDMLCGIIEKYGIVPKKVYPETANATNSSALNDTLNTLL 442400 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKD + LRK+V D S+ +++ K +ML E YRILA +LG PP FDFEY+DDD YH D Sbjct 442399 RKDGLELRKMVQDGKSEEEVQERKNEMLKEVYRILAISLGVPPKTFDFEYKDDDGNYHRD 442220 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 L+PQ FFKKYV W+L +Y S INAPT DKP++ +++VE LGNV GGR+VRHLNL ID Sbjct 442219 AALSPQDFFKKYVGWDLSEYISTINAPTKDKPFHKVFSVEYLGNVEGGRQVRHLNLPIDE 442040 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K L + QLK GE VWFGS+V + S+RQ G++DT +YK+DDLF+ DF M+KA+ LD GES Sbjct 442039 MKDLIITQLKNGEVVWFGSNVVKDSERQAGLLDTELYKRDDLFDVDFDMSKADMLDSGES 441860 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 LM HAMV+TGVD+VDGKPTKWK+ENSWG+K G KGYFV SDSWFD+FVYQ VI+KK+LS Sbjct 441859 LMDHAMVITGVDLVDGKPTKWKIENSWGEKPGFKGYFVMSDSWFDKFVYQAVINKKHLSD 441680 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALAS 447 DL+ + P L PWDPMGALA+ Sbjct 441679 DLKKTFEEGSKDPIQLLPWDPMGALAN 441599 Features in this part of subject sequence: aminopeptidase C Score = 416 bits (1070), Expect = 9e-115 Identities = 203/442 (45%), Positives = 281/442 (63%), Gaps = 6/442 (1%) Frame = +2 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M+ E+T ++A+F+QD Q + AV+NNG+ + N + + TFSIE+ T + Sbjct 209216 MTHELTLDEIAKFQQDYQQNKQNKIAELAVVNNGVQKASFNGEGIRDLNRTFSIEIPTDN 209395 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V +QKQSGRCW+FAALN +RH Q+ K+F SQ+Y FFWD+ E++N F+ ++L+TAD Sbjct 209396 VTDQKQSGRCWLFAALNVLRHKFAKQYHTKNFTFSQSYLFFWDRIERANIFFNHILETAD 209575 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +P+D R V F + P DGGQW M +LI KYG+VP E+++++ ++ N LN+KL Sbjct 209576 KPVDDRTVHFYLQAPDTDGGQWHMAISLIRKYGLVPTYAQDESFTANNTAAFNQALNMKL 209755 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 R+D + LRKL A + +IE +Q+ L+E YR+ G P KFD E++DDD Y +D Sbjct 209756 REDGLVLRKL-AQAGKNDEIEQKRQEYLSEIYRMAVIAFGQPVQKFDLEFKDDDGNYKLD 209932 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + +TP FF Y +LDDY + NAP D Y+ LY NV GG VR LN I+ Sbjct 209933 QNITPLDFFHNYFEDDLDDYVVLFNAP--DHEYDKLYAFPFEDNVEGGSPVRFLNTKIEN 210106 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K A+KQLK GE++WFG DVG+ SDRQ GI+ N+Y+ D +F + + K ERL G S Sbjct 210107 LKEAAIKQLKDGETIWFGCDVGKQSDRQKGILAANLYETDTIFGIETKLNKKERLQTGAS 210286 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 THAM GVD+VDGKP +WKVENSWG KVGDKGYFV D WFDE++++VV+ K+YL Sbjct 210287 GSTHAMTFVGVDVVDGKPRQWKVENSWGTKVGDKGYFVMDDEWFDEYLFKVVVKKQYLPE 210466 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 L + + E T + WD M Sbjct 210467 KLVKIAEGE---ATPVPCWDSM 210523 Features in this part of subject sequence: aminopeptidase C Score = 407 bits (1047), Expect = 4e-112 Identities = 202/442 (45%), Positives = 289/442 (65%), Gaps = 7/442 (1%) Frame = -3 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS E+T ++ QF+ D + + +A M +G+ + N + FS+E++T + Sbjct 212579 MSHELTLQEIDQFRSDFDNSRN-QVVSRAAMRSGVLEASFNPAVTNRLNDVFSVEVETDN 212403 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQ QSGRCW+FA LNT+RH ++K K+F LSQ Y FFWDK E++N FY+ ++ +AD Sbjct 212402 VTNQMQSGRCWLFATLNTLRHDFGKKYKAKNFTLSQAYNFFWDKIERANIFYDAIIDSAD 212223 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PLD R V M DGGQW M ++L++KYG+VP + MPE+++++ ++ L+ L K Sbjct 212222 KPLDDRTVKAYMNFAGADGGQWAMAASLVKKYGVVPTNAMPESFNTNHTAGLSDALARKE 212043 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKDA+ LRKLV + ++ ++E +++ L+E YR+ A +G PP FD EYRDD+K+ H+D Sbjct 212042 RKDALVLRKLVQEGKTE-EVEKKRKEFLSEIYRMTAIAVGEPPKTFDLEYRDDEKKLHLD 211866 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + LTP FF KY N +DY + NAP D Y LY++ NV GG + LN+ I+ Sbjct 211865 KNLTPVEFFNKYWDINFNDYVCLTNAP--DHEYGKLYSLPFEDNVNGGIPITFLNVPIEY 211692 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K A+KQLK GESVWFG+DV + DR+ G +DT +YK D+LF+ D MTKAERL GE Sbjct 211691 LKDAAIKQLKDGESVWFGNDVLKEMDRKTGYLDTELYKTDELFDVDTYMTKAERLATGEG 211512 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 ++HAM L GVD+ G+ KWKVENSW +K G KGYF SD WFDEFVY+VV+ K++L+ Sbjct 211511 EVSHAMTLVGVDLDKGEIRKWKVENSWSEKSGRKGYFTMSDKWFDEFVYEVVVRKEFLTE 211332 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 D + + ++ KPT L WD + Sbjct 211331 DQKKLAES---KPTPLPAWDSL 211275 Features in this part of subject sequence: aminopeptidase C Score = 401 bits (1030), Expect = 4e-110 Identities = 197/442 (44%), Positives = 279/442 (63%), Gaps = 3/442 (0%) Frame = -1 Query 4 EITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVAN 63 +I DL Q + + TP Q AVM NGI + N + FSI++D+ V N Sbjct 611206 QIDNEDLKQVRSEFLDTPKYRNTQNAVMKNGIKKSITNQSEINSHPFVFSIDVDSNKVLN 611027 Query 64 QKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPL 123 QKQSGRCW F+ LN +R+ I+ + IKD ELS +Y +F+DK EK NYFY+N++ TAD+PL Sbjct 611026 QKQSGRCWDFSGLNFIRYHIEKEHHIKDMELSPSYVYFYDKLEKGNYFYQNIINTADRPL 610847 Query 124 DSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKD 183 R V +L+TTPQQDGG W +L LIEKYGIVP MPE S+ S ELN + + KL+KD Sbjct 610846 SDRLVNWLLTTPQQDGGDWQLLVDLIEKYGIVPIEEMPEDAVSANSQELNRMYDRKLQKD 610667 Query 184 AVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDREL 243 A+ LR L ASD +++ ++M AE+YR+LA LG PP KF +EYRD++ +YH ++ Sbjct 610666 ALKLRDLANSDASDEKMKSVLRQMNAENYRVLAIALGTPPEKFTYEYRDENNEYHTTGQI 610487 Query 244 TPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKA 303 TP FFKK+V NL DY ++N P + PYN + VE+ GN+VGG+ R+ N+ + + Sbjct 610486 TPLEFFKKFVDINLGDYVELMNLPGEKYPYNTPFGVEISGNMVGGQPSRYFNVSMKDMEK 610307 Query 304 LAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMT 363 A++QLK E VWFG DV Q Q G++ ++ D F K +R +Y ESL T Sbjct 610306 TAIEQLKDDEPVWFGCDVLQEWAPQAGLLTEKVFDWDRSFGIKLGTDKTKRFEYRESLPT 610127 Query 364 HAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQ 423 HAM+++GVD+ D KP +WK++NSWG KVG KGYF+ + W +++ Y+ V++KKYL+ + Sbjct 610126 HAMLISGVDMRDDKPIRWKIQNSWGPKVGHKGYFIMGNDWMEQYTYETVVNKKYLTDEQL 609947 Query 424 DVIKNEYDKPTVLAPWDPMGAL 445 + E P +L W+ M + Sbjct 609946 AAYEKE---PVMLPYWNAMNPI 609890 Features in this part of subject sequence: aminopeptidase C Score = 397 bits (1019), Expect = 7e-109 Identities = 192/437 (43%), Positives = 271/437 (62%), Gaps = 4/437 (0%) Frame = -1 Query 3 AEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVA 62 +EI DL + D T Q AVM NGI N + + FSI++D+ V Sbjct 606667 SEINPTDLKTIRSDFLDTQRLRITQNAVMKNGIKKAITNERAIENSSFNFSIDVDSNKVM 606488 Query 63 NQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQP 122 NQK SGRCWMF+ LN +R I+ + +KD ELS +Y FF+DK E+ NYFY N++KTA +P Sbjct 606487 NQKHSGRCWMFSGLNFVRFLIEKKHNLKDMELSPDYLFFYDKLERGNYFYNNIVKTAAKP 606308 Query 123 LDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRK 182 L R+V FL+ TPQ+DGG W +L+ LIEKYG+VP +MPET + ++E+N + N KL K Sbjct 606307 LSDREVMFLLATPQEDGGDWPLLTNLIEKYGLVPNELMPETTPAWNTTEINQMYNRKLDK 606128 Query 183 DAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRE 242 DA+ LR LV ASD I++ +++ E+YR+L+ G PP KF +EYRD +K+YH E Sbjct 606127 DAMKLRDLVNSNASDTKIKSVIRQLNQENYRVLSICFGTPPEKFTYEYRDKNKKYHTTGE 605948 Query 243 LTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFK 302 +TP F+KK+ NLDDY ++N P YN Y +E+ NVVGGR +R+LN+ + + Sbjct 605947 VTPLEFYKKFADINLDDYVELMNLPGGGYKYNQTYGIELCNNVVGGRNIRYLNVPMHDMR 605768 Query 303 ALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLM 362 + + QLK + VWF DV Q + G++ +Y F KA R+ Y ES+ Sbjct 605767 RMVIDQLKDDQPVWFACDVLQEWNNPAGLLSLKVYDWKRSFGISLGKDKATRVQYRESMP 605588 Query 363 THAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADL 422 THAM++ GVD+ D +PTKWKV+NSWGDK G KGYF+ +SW D++ Y V++KKYL+ Sbjct 605587 THAMLICGVDLHDNEPTKWKVQNSWGDKPGHKGYFIMDNSWMDQYTYNTVVNKKYLT--- 605417 Query 423 QDVIKNEYDKPTVLAPW 439 D + Y+K + P+ Sbjct 605416 -DTERAAYEKAEINLPY 605369 Features in this part of subject sequence: aminopeptidase C Score = 380 bits (976), Expect = 7e-104 Identities = 195/437 (44%), Positives = 271/437 (62%), Gaps = 9/437 (2%) Frame = -2 Query 9 DLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSG 68 +LA F D +A +G+ + N + + TFS ELD G V +QK SG Sbjct 1442553 ELAAFSADFNKNDKNKIASRAARRSGLFEASFNDEVSKRLNHTFSTELDIGGVTDQKHSG 1442374 Query 69 RCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKV 128 RCW FA LN +RH ++ +KDF SQ Y FFWDK E++N FY+++++ AD+P+D R+V Sbjct 1442373 RCWEFATLNVLRHHFGQKYHVKDFTFSQAYNFFWDKIERANAFYDSMIRLADKPIDDREV 1442194 Query 129 AFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALR 188 QDGG W M L++KYG+VP MPE +S+ +S L L K RKDA+ LR Sbjct 1442193 ETWFDFAGQDGGLWQMAINLVKKYGVVPSYAMPENATSNNTSALIDSLARKERKDALVLR 1442014 Query 189 KLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTF 248 KLV + + + E AK++ L E YR+ A LG PP KFD EYRDDDK+YH++++LTP+ F Sbjct 1442013 KLVQEGKLE-EAEKAKREFLNEVYRMAAVALGEPPKKFDLEYRDDDKKYHLEKDLTPRQF 1441837 Query 249 FKKYVA-WNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVK 307 +KY+ +N DDY ++N+P D YN Y + NV GG + LN+ I+ A Sbjct 1441836 AEKYLKDFNWDDYVVLLNSPNYD--YNKRYHQGLYDNVAGGTPITGLNVPIEVLARAAAA 1441663 Query 308 QLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMV 367 QLK G++V FG+DV + +R+ G +DT +YK DDLF+ D M+KA+RL GE TH M Sbjct 1441662 QLKDGKAVIFGNDVLKQMERKTGFLDTELYKTDDLFSVDTQMSKADRLATGEGAATHDMT 1441483 Query 368 LTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIK 427 L GVD +G+ KWKVENSWGDK G KG++ S WF+E+VY VV+ KKYLS DL + Sbjct 1441482 LVGVDEDNGEIRKWKVENSWGDKYGHKGFYEMSQKWFEEYVYDVVVDKKYLSDDLVKL-- 1441309 Query 428 NEYDKPTV-LAPWDPMG 443 +++P + L PW+ +G Sbjct 1441308 --WEEPAIDLKPWEHIG 1441264 >gb|AE016830.1| Download subject sequence spanning the HSP Enterococcus faecalis V583, complete genome Length=3218031 Features in this part of subject sequence: aminopeptidase C Score = 577 bits (1488), Expect = 3e-163 Identities = 277/438 (63%), Positives = 342/438 (78%), Gaps = 5/438 (1%) Frame = +2 Query 12 QFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCW 71 +F QD +ALQ++V+ NGI+A+ E+ V P FS++L TG VANQKQSGRCW Sbjct 287975 KFHQDFLNNNKQNALQRSVVKNGISASGESVQGAVNNVPVFSVDLATGKVANQKQSGRCW 288154 Query 72 MFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFL 131 MFAALNT RH + F++KDFELSQNYTFFWDK+EKSNYFYEN++ TADQPL SRKVAFL Sbjct 288155 MFAALNTFRHRMLNAFQLKDFELSQNYTFFWDKYEKSNYFYENIIATADQPLTSRKVAFL 288334 Query 132 MTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLV 191 + TPQQDGGQWDM+ ++ +KYG+VPK+ MPE+ +SS S +LN LN KLRKDA LR L+ Sbjct 288335 LATPQQDGGQWDMIVSIFDKYGVVPKTAMPESSNSSNSRDLNNYLNKKLRKDATILRSLI 288514 Query 192 ADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKK 251 AS +++ K+ ML E Y LA +LG PP FDFEYRD++K YH+D+ LTPQTFF+K Sbjct 288515 EKGASAEEVQKNKEAMLQEIYNFLAISLGTPPETFDFEYRDEEKNYHLDQNLTPQTFFEK 288694 Query 252 YVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKA 311 YV NL DY SIINAPT+DKP+N YTVEMLGNVVGG+EV++LN+++ FK LA QL+ Sbjct 288695 YVGVNLHDYVSIINAPTEDKPFNKTYTVEMLGNVVGGKEVKYLNVEMAAFKKLAAAQLEQ 288874 Query 312 GESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGV 371 GESVWFG DVGQSS R GIM ++Y +DLF+ DFTMTKAERLD+GESLMTHAMVLTGV Sbjct 288875 GESVWFGCDVGQSSTRDTGIMALDVYDMNDLFDIDFTMTKAERLDFGESLMTHAMVLTGV 289054 Query 372 DIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYD 431 DIVDG+ TKWKVENSWG+KVG+ G+FV SD+W DE+ YQ+V+ K L+ D K ++ Sbjct 289055 DIVDGQTTKWKVENSWGEKVGENGFFVMSDAWMDEYTYQIVVHKDLLT----DEQKKAWE 289222 Query 432 K-PTVLAPWDPMGALASK 448 + PTVLAPWDPMGALA++ Sbjct 289223 QAPTVLAPWDPMGALATQ 289276 >gb|CP000033.2| Download subject sequence spanning the HSP Lactobacillus acidophilus NCFM, complete genome Length=1993561 Features in this part of subject sequence: aminopeptidase C Score = 573 bits (1476), Expect = 7e-162 Identities = 269/446 (60%), Positives = 346/446 (77%), Gaps = 0/446 (0%) Frame = -3 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS EI+ + +F+QDL P +A NGI +++ +K+ + PTFSIE++TG Sbjct 325562 MSKEISKDTINKFEQDLTNHPAYKVASRAAQENGIFKASQDLQTKIDLDPTFSIEIETGK 325383 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 A+QKQSGRCWMF+ALNTMRH +Q +F++KDFELSQNYT FWDKFEKSN+F+ENV+ TAD Sbjct 325382 PADQKQSGRCWMFSALNTMRHPLQKKFQLKDFELSQNYTNFWDKFEKSNWFFENVIATAD 325203 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PL RKV+FL TPQQDGGQWDML +IEKYGIVPKSV PET +++ SS LN LN L Sbjct 325202 KPLGDRKVSFLFATPQQDGGQWDMLCGIIEKYGIVPKSVYPETANATNSSALNDTLNTLL 325023 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKD + LRKLV D S+ +I+ K++ML + +R+LA +LG PP KF+FEYRDDDK YHID Sbjct 325022 RKDGLELRKLVNDGKSEEEIQTRKEEMLNDVFRVLAVSLGVPPKKFNFEYRDDDKNYHID 324843 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 +++TP+ FF KYV +L+D+ S INAPT DKP++ +++VE LGNV GGR+VRHLNL +D Sbjct 324842 KDITPKEFFDKYVGMDLEDHISTINAPTSDKPFHKVFSVEYLGNVEGGRQVRHLNLKVDE 324663 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K L +KQLK+GE VWFGS+V + S+R+ G++DT++Y++D+LF+ DF+M+KAE+LD GES Sbjct 324662 MKDLIIKQLKSGEVVWFGSNVVKDSERRAGLLDTDLYRRDELFDVDFSMSKAEKLDSGES 324483 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 +M HAMV+TGVDIVDGKPTKWK+ENSWG+K G KGYFV SD WFD FVYQ VI+KK+L Sbjct 324482 MMDHAMVITGVDIVDGKPTKWKIENSWGEKPGFKGYFVMSDKWFDSFVYQAVINKKFLPD 324303 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALA 446 DL+ P L PWDPMGALA Sbjct 324302 DLKKAYDEGVKDPIQLLPWDPMGALA 324225 Features in this part of subject sequence: aminopeptidase G Score = 419 bits (1076), Expect = 2e-115 Identities = 202/442 (45%), Positives = 286/442 (64%), Gaps = 6/442 (1%) Frame = +2 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M ++T ++A+F+Q+ + P + AV+NNG+ + N + + TFSIE+ T + Sbjct 189152 MKHKLTMAEIAKFQQEYEKQPRNRVAELAVVNNGVQKASFNNEGVRKLNRTFSIEIPTDN 189331 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V +QKQSGRCW+FAALNT+RHG + K+F SQNY FFWD+ E++N F++N+L TAD Sbjct 189332 VTDQKQSGRCWLFAALNTLRHGFAKKQNAKNFTFSQNYLFFWDRVERANIFFDNILNTAD 189511 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PLD R V M P DGGQW M +LI KYG+VP E+++++ ++ N LN+KL Sbjct 189512 KPLDDRTVHTYMQGPDTDGGQWAMAVSLIRKYGLVPTYAQDESFTANNTAAFNSALNMKL 189691 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 R+D + LRKL +K D +IE +Q+ L+E YR+ G P KFD E++DD+ YH D Sbjct 189692 REDGLVLRKLYQEKKMD-EIETKRQEFLSEVYRMAVIAFGEPVQKFDLEFKDDNGNYHFD 189868 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 LTP FF Y +LDDY + NAP D ++ LY + NV GG V+ LN +ID Sbjct 189869 GNLTPLDFFHNYFTDDLDDYIVLFNAP--DHEFDKLYALPFEDNVEGGTPVQFLNTEIDN 190042 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K A+KQL+AGE++WFG DVG+ SDRQ GI+ +Y+ D +F+ + + K ERL G S Sbjct 190043 LKEAAIKQLEAGETIWFGCDVGKESDRQKGILSKGLYQTDLIFDIETKLNKKERLQTGAS 190222 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 THAM L GVD+VDG+P +WKVENSWG KVG+KGYFV +D WF+E++++VV+ K+Y+ Sbjct 190223 GSTHAMTLVGVDVVDGQPQQWKVENSWGSKVGEKGYFVMNDEWFNEYLFKVVVKKQYVPE 190402 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 L + + E T + WD M Sbjct 190403 KLIKIWEGE---ATPVEAWDSM 190459 Features in this part of subject sequence: aminopeptidase E Score = 382 bits (982), Expect = 1e-104 Identities = 191/443 (43%), Positives = 276/443 (62%), Gaps = 7/443 (1%) Frame = -3 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M+ E+T +L +F D P + +A +G+ + N + +T FS ELDT + Sbjct 201449 MAHELTVQELEKFSADFNKNPKNKIIARAAQRSGVLEASYNDRVEGELTRVFSTELDTDN 201270 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQ SGRCW F+ LN +RH ++K K+F SQ Y FFWDK E++N FY +L +AD Sbjct 201269 VTNQLHSGRCWEFSTLNVLRHAFGKKYKAKNFTFSQAYNFFWDKIERANMFYNRILDSAD 201090 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 PLDSR+V + DGGQ+ M +AL+EKYG+VP MPET++++ ++ L KL Sbjct 201089 MPLDSRQVKADLDFAGADGGQFQMAAALVEKYGVVPSYAMPETFNTNNTTSFATALGDKL 200910 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 +KDA+ LR+L D +I ++K L+E Y++ A +G PP FD EYRDDDK+YH+D Sbjct 200909 KKDALVLREL-KQYGKDDEIAKTREKFLSEVYQMTAIAVGEPPKTFDLEYRDDDKKYHLD 200733 Query 241 RELTPQTFFKKYVA-WNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDID 299 + LTP F KY+ + DDY + NAP D YN LY + N+ G ++ LN+ ++ Sbjct 200732 KNLTPLEFLHKYMGEVDFDDYVVLTNAP--DHEYNKLYGLPAEDNIEGSLRIKLLNVPME 200559 Query 300 TFKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGE 359 + A+ QLK GE+VWFG+DV + DR+ G +DTN+YK DDLF D M+KA+RL G Sbjct 200558 YLSSAAIAQLKDGEAVWFGNDVLRQMDRKTGYLDTNLYKLDDLFGVDLKMSKADRLRTGV 200379 Query 360 SLMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLS 419 ++HAM L GVD +G+ +WKVENSWG+K G KG+FV S+ WF+++VY+VV+ KKYL+ Sbjct 200378 GEVSHAMTLVGVDEDNGEIRQWKVENSWGEKSGSKGFFVMSNDWFNDYVYEVVVHKKYLT 200199 Query 420 ADLQDVIKNEYDKPTVLAPWDPM 442 +++ + T L WD + Sbjct 200198 DKQKELAEGPI---TDLPAWDSL 200139 Features in this part of subject sequence: aminopeptidase Score = 366 bits (939), Expect = 1e-99 Identities = 186/442 (42%), Positives = 269/442 (60%), Gaps = 7/442 (1%) Frame = +2 Query 3 AEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVA 62 A I+ ++A F D + A NG+ + N + FS ELD G V Sbjct 888539 AIISDQEIADFSADFNSNSENLVASCAARRNGLLEASFNDRVSEKLNHVFSTELDIGGVT 888718 Query 63 NQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQP 122 NQKQSGRCW FA LN +RH + +KDF SQ Y FFWDK E++N FY+ +++ AD+P Sbjct 888719 NQKQSGRCWEFATLNVLRHYFGKKNNVKDFTFSQAYNFFWDKIERANAFYDAMIRLADKP 888898 Query 123 LDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRK 182 ++ R+V ++ +DGG W M L++KYG+VP MPE+++S+ ++ L L K RK Sbjct 888899 INDREVQSWLSFAGEDGGLWSMAINLVKKYGVVPSYAMPESFNSNHTAGLIDSLARKERK 889078 Query 183 DAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRE 242 DA+ LRKLV + + +I K+K L E YR+++ LG PP KFD EYRDDDK+YH++++ Sbjct 889079 DAILLRKLVNENRQN-EIAETKKKALNEVYRMVSVALGEPPKKFDLEYRDDDKKYHLEKD 889255 Query 243 LTPQTFFKKYVA-WNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTF 301 LTP+ F +KY + DDY + N P + +N LY + + NV GG +++ LN+ I+ Sbjct 889256 LTPRAFVQKYFKDFKFDDYVVLSNCPNHE--FNKLYHMPLYDNVDGGDQIKFLNVPIEYL 889429 Query 302 KALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESL 361 AV QLK+G++V FG+DV + +R+ G +DTN+Y+ D LF D M+KA+RL GE Sbjct 889430 SQAAVAQLKSGDAVIFGNDVSKQMERKTGYLDTNLYETDKLFGVDTKMSKADRLATGEGF 889609 Query 362 MTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSAD 421 TH M L GVD +G KWKVENSWGDK G G++ S WF+++VY VV+ K++L+ Sbjct 889610 ATHDMTLVGVDEDNGHIRKWKVENSWGDKFGHNGFYEMSQQWFEDYVYDVVVRKEFLT-- 889783 Query 422 LQDVIKNEYDKPTVLAPWDPMG 443 + +K L PWD +G Sbjct 889784 -DEQLKLAEGPAIDLKPWDNIG 889846 >emb|X80643.1|LDPEPC L.delbrueckii pepC gene Length=2026 Score = 565 bits (1455), Expect = 2e-159 Identities = 266/446 (59%), Positives = 331/446 (74%), Gaps = 0/446 (0%) Frame = +2 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS EI+ + F +L P A NGI +++T SKV + PTFS+E+DTGS Sbjct 353 MSKEISFDTIEDFTSNLSKHPAYGVAANAAQTNGIFKASQSTQSKVDLDPTFSVEIDTGS 532 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQKQSGRCWMF+ALNTMRH IQ +FK+K FELSQ+YTFFWDKFEKSN+F+ENV+ +AD Sbjct 533 VTNQKQSGRCWMFSALNTMRHSIQKEFKLKGFELSQSYTFFWDKFEKSNFFFENVIGSAD 712 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PL RKV+FL TPQ DGGQWDML LIEKYGIVPK V PET +S S LN LN L Sbjct 713 KPLGDRKVSFLFATPQSDGGQWDMLCGLIEKYGIVPKKVYPETANSENSRALNDTLNTML 892 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RK + LR LV + S ++EA K ++L +R+LA +LG PP F+FEY DDD YHID Sbjct 893 RKGGLELRALVNEGKSTEEVEAHKAELLDAIFRMLATSLGLPPKSFNFEYTDDDGNYHID 1072 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 +++TPQ FFKKYV W+L++Y S+IN PT DKPYN +++VE LGNVVGGR+VRHLNL++ Sbjct 1073 KDITPQDFFKKYVGWDLENYISVINGPTADKPYNKVFSVEYLGNVVGGRQVRHLNLELSK 1252 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 FK L + QLK GE VWFGSDV + DR+ G++DT IY++D LF+ DF+M+KA+RLD GES Sbjct 1253 FKELIINQLKQGEVVWFGSDVSKGGDREAGLLDTKIYQRDQLFDYDFSMSKADRLDSGES 1432 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 +M HAMV+T VD+VD KPTKWK+ENSWGDK G KGYFV SD WFD+FVYQ V++K +L Sbjct 1433 MMNHAMVITAVDLVDDKPTKWKIENSWGDKSGFKGYFVMSDEWFDQFVYQAVLNKAFLPE 1612 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALA 446 D++ + P L PWDPMGALA Sbjct 1613 DVKKAYDEGKENPIELLPWDPMGALA 1690 >gb|CP000422.1| Download subject sequence spanning the HSP Pediococcus pentosaceus ATCC 25745, complete genome Length=1832387 Features in this part of subject sequence: Aminopeptidase C Score = 564 bits (1453), Expect = 3e-159 Identities = 272/448 (60%), Positives = 342/448 (76%), Gaps = 5/448 (1%) Frame = +1 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 +S EI+ + +FKQ+ A +++ V NGI ++ N + V TP FSI+LDTG Sbjct 1473958 LSKEISQNLIDRFKQEYNGRKEAKVIERTVTKNGILNSSRNLAADVQSTPVFSIDLDTGD 1474137 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIK-DFELSQNYTFFWDKFEKSNYFYENVLKTA 119 VANQKQSGRCWMFAALNTMRH ++ QFK+ +FELSQNYTFFWDKFEKSN+FYEN++ TA Sbjct 1474138 VANQKQSGRCWMFAALNTMRHDMKNQFKVPGNFELSQNYTFFWDKFEKSNWFYENIINTA 1474317 Query 120 DQPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLK 179 + D RKVAFL+ PQ DGGQWDML ALIEKYG+VP+S PETY+SSKS E + LLN K Sbjct 1474318 ELDTDDRKVAFLLNEPQGDGGQWDMLCALIEKYGVVPQSAYPETYNSSKSREFDTLLNEK 1474497 Query 180 LRKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHI 239 LRKDAV LR LV AS DI+ KQ+ML+E YR+ +Y+ G PP +FD+EYRD D+ YH Sbjct 1474498 LRKDAVTLRNLVNSGASRTDIDERKQQMLSEVYRMASYSFGEPPVQFDWEYRDADQNYHR 1474677 Query 240 DRELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDID 299 + +TP+ F+ KYV WNL +Y SIINAPT DKPYN YT++MLGNVV GR+V+HLNL +D Sbjct 1474678 EAGITPKAFYDKYVGWNLSEYISIINAPTADKPYNQTYTIDMLGNVVNGRQVKHLNLAMD 1474857 Query 300 TFKALAVKQLKAGESVWFGSDVGQSSD-RQLGIMDTNIYKKDDLFNTDFTMTKAERLDYG 358 FK A+ QLKAG+SVWFG DVGQ S+ R+ G++D +++ +D+LF+ D +M+KAERLDY Sbjct 1474858 DFKQAAINQLKAGQSVWFGCDVGQHSEAREKGLLDLDVFAEDELFDIDLSMSKAERLDYK 1475037 Query 359 ESLMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYL 418 ESLMTHAMVLTGVD+V G+PTKWKVENSWG KVG+KGY V SD+W DE+ YQVV+ K++L Sbjct 1475038 ESLMTHAMVLTGVDLVAGQPTKWKVENSWGKKVGEKGYMVMSDAWMDEYCYQVVVQKQFL 1475217 Query 419 SADLQDVIKNEYDKPTVLAPWDPMGALA 446 + + + PTVL PWDPMG+LA Sbjct 1475218 TEAQRQA---QAQTPTVLKPWDPMGSLA 1475292 >gb|CP000412.1| Download subject sequence spanning the HSP Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365, complete genome Length=1856951 Features in this part of subject sequence: Aminopeptidase C Score = 563 bits (1450), Expect = 7e-159 Identities = 265/446 (59%), Positives = 331/446 (74%), Gaps = 0/446 (0%) Frame = +3 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS EI+ + F +L P A NGI +++T SKV + PTFS+E+DTGS Sbjct 1490784 MSKEISFDTIEDFTNNLSKHPAYGVAANAAQTNGIFKASQSTQSKVDLDPTFSVEIDTGS 1490963 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQ+QSGRCWMF+ALNTMRH IQ +FK+K FELSQ+YTFFWDKFEKSN+F+ENV+ +AD Sbjct 1490964 VTNQRQSGRCWMFSALNTMRHSIQKEFKLKGFELSQSYTFFWDKFEKSNFFFENVIGSAD 1491143 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PL RKV+FL TPQ DGGQWDML LIEKYGIVPK V PET +S S LN LN L Sbjct 1491144 KPLGDRKVSFLFATPQSDGGQWDMLCGLIEKYGIVPKKVYPETANSENSRALNDTLNTML 1491323 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RK + LR LV + S ++EA K ++L +R+LA +LG PP F+FEY DDD YHID Sbjct 1491324 RKGGLELRALVNEGKSAEEVEAHKAELLDAIFRMLATSLGLPPKSFNFEYTDDDGNYHID 1491503 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 +++TPQ FFKKYV W+L++Y S+IN PT DKPYN +++VE LGNVVGGR+VRHLNL++ Sbjct 1491504 KDITPQDFFKKYVGWDLENYISVINGPTADKPYNKVFSVEYLGNVVGGRQVRHLNLELSK 1491683 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 FK L + QLK GE VWFGSDV + DR+ G++DT IY++D LF+ DF+M+KA+RLD GES Sbjct 1491684 FKDLIINQLKQGEVVWFGSDVSKGGDREAGLLDTKIYQRDQLFDYDFSMSKADRLDSGES 1491863 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 +M HAMV+T VD+VD KPTKWK+ENSWGDK G KGYFV SD WFD+FVYQ V++K +L Sbjct 1491864 MMNHAMVITAVDLVDDKPTKWKIENSWGDKPGFKGYFVMSDEWFDQFVYQAVLNKAFLPE 1492043 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALA 446 D++ + P L PWDPMGALA Sbjct 1492044 DVKKAYDEGKENPIELLPWDPMGALA 1492121 Features in this part of subject sequence: cysteine aminopeptidase Score = 412 bits (1058), Expect = 2e-113 Identities = 206/442 (46%), Positives = 286/442 (64%), Gaps = 6/442 (1%) Frame = -2 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS E+T +LA+F + A P + +A +G+ + N +T FS EL T + Sbjct 234628 MSHELTLQELAKFSANFNADPKNQVIARAAARSGVLEASYNERVAGRLTRVFSTELPTDN 234449 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQKQSGRCW+F+ LN +RH A+ K K+F LSQ+Y FFWDK E++N FYE V++TAD Sbjct 234448 VTNQKQSGRCWLFSTLNVLRHDFGAKHKAKNFTLSQSYNFFWDKLERANLFYEKVIETAD 234269 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PLD R+V DGGQW M +L++KYG+VP VMPE++++S ++ L L K Sbjct 234268 KPLDDREVRSYFDFAGHDGGQWHMAVSLVKKYGVVPSYVMPESFNTSATNGLASALADKE 234089 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKDA+ALR+L A +E A++ L E YR++A +G PP FD EYRDDDK YH++ Sbjct 234088 RKDALALRRL-AQAGDQEGLEKARKTFLNEIYRMVAIAVGEPPKTFDLEYRDDDKNYHLE 233912 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + LTP +FF KY +LDDY + NAP D Y LY + NV GG + LN+ ++ Sbjct 233911 KNLTPVSFFNKYFDVDLDDYVVLTNAP--DHEYGKLYHLGAEDNVEGGTPILFLNVPMEY 233738 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 + AV QLK GE+VWFG+DVG+ D + G +DT++YK +DLF D +++KA+RL G Sbjct 233737 LEQAAVAQLKDGEAVWFGNDVGRQMDHKTGYLDTDLYKLEDLFAVDLSLSKADRLATGVG 233558 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 ++HAM L GVD G +WKVENSWGDK G+KG+FV S +WF E+VY+VV+ KKYL+ Sbjct 233557 EVSHAMTLVGVDEDKGDIRQWKVENSWGDKSGEKGFFVMSHNWFKEYVYEVVVHKKYLTK 233378 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 D Q+++ + P LAPWD + Sbjct 233377 DQQELLSS---TPVELAPWDSL 233321 Features in this part of subject sequence: cysteine aminopeptidase Score = 390 bits (1003), Expect = 5e-107 Identities = 196/442 (44%), Positives = 275/442 (62%), Gaps = 6/442 (1%) Frame = -2 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS E++ L F +D A P + +A +G+ A N + TFSIELDT + Sbjct 235993 MSHELSPQLLESFSRDFNADPKNQVISRAARRSGLLEAAYNPAVSQRLNRTFSIELDTDN 235814 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQ+QSGRCW+F+ LN +RH K K+F SQ+Y FFWDK E++NYFY+ ++ TAD Sbjct 235813 VTNQQQSGRCWLFSTLNVVRHNFGKANKAKNFTFSQSYNFFWDKIERANYFYDRIIATAD 235634 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PL R V Q DGGQW M ++LI KYG+VP MPE+++S+ S L+ +L K Sbjct 235633 RPLTDRTVRGYFDWCQTDGGQWHMAASLIAKYGVVPSYSMPESFNSNHSQALDMVLADKE 235454 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKDA+ LR+L A +EAA+ L++ YRI+A LG PP FD E+RDDDK YH+D Sbjct 235453 RKDALTLRRL-AQAGDHEKLEAARTDFLSQIYRIMATALGEPPKTFDLEFRDDDKNYHLD 235277 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + LTP F+KKY A +LDDY + NAP D N + + N+ GG +N+ ++ Sbjct 235276 KGLTPVQFYKKYCATDLDDYVVLANAP--DHEMNRVLHLGFEDNIKGGYPNLFINVPMEY 235103 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 + A+ QLK GE+VWFG+DVG+ D + G MD ++Y+ D L + D ++KA+RL G Sbjct 235102 LEDAAIAQLKDGEAVWFGNDVGRQMDHKTGFMDLDLYQLDQLLDIDSHLSKADRLATGIG 234923 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 +H M L GVD+ G+ +WKVENSWGDK G+KGYF S WF E+ Y+V + KK++ A Sbjct 234922 ESSHDMALVGVDVDGGQVRQWKVENSWGDKSGEKGYFTMSADWFREYTYEVAVQKKHVPA 234743 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 ++ D++KN+ P L PWD + Sbjct 234742 EILDLLKNQ---PIELDPWDSL 234686 >emb|CR954253.1| Download subject sequence spanning the HSP Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 complete genome Length=1864998 Features in this part of subject sequence: Aminopeptidase C Score = 562 bits (1448), Expect = 1e-158 Identities = 265/446 (59%), Positives = 331/446 (74%), Gaps = 0/446 (0%) Frame = +3 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS EI+ + F +L P A NGI +++T SKV + PTFS+E+DTGS Sbjct 1477560 MSKEISFDTIEDFTSNLSKHPAYGVAANAAQTNGIFKASQSTQSKVDLDPTFSVEIDTGS 1477739 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQKQSGRCWMF+ALNTMRH IQ +FK+K FELSQ+YTFFWDKFEKSN+F+ENV+ +AD Sbjct 1477740 VTNQKQSGRCWMFSALNTMRHSIQKEFKLKGFELSQSYTFFWDKFEKSNFFFENVIGSAD 1477919 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PL RKV+FL TPQ DGGQWDML LIEKYGIVPK V PET +S S L+ LN L Sbjct 1477920 KPLGDRKVSFLFATPQSDGGQWDMLCGLIEKYGIVPKKVYPETANSENSRALDDTLNTML 1478099 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RK + LR LV + S ++EA K ++L +R+LA +LG PP F+FEY DDD YHID Sbjct 1478100 RKGGLELRALVNEGKSAEEVEAHKAELLDAIFRMLATSLGLPPKSFNFEYTDDDGNYHID 1478279 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 +++TPQ FFKKYV W+L++Y S+IN PT DKPYN +++VE LGNVVGGR+VRHLNL++ Sbjct 1478280 KDITPQDFFKKYVGWDLENYISVINGPTADKPYNKVFSVEYLGNVVGGRQVRHLNLELSK 1478459 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 FK L + QLK GE VWFGSDV + DR+ G++DT IY++D LF+ DF+M+KA+RLD GES Sbjct 1478460 FKDLIINQLKQGEVVWFGSDVSKGGDREAGLLDTKIYQRDQLFDYDFSMSKADRLDSGES 1478639 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 +M HAMV+T VD+VD KPTKWK+ENSWGDK G KGYFV SD WFD+FVYQ V++K +L Sbjct 1478640 MMNHAMVITAVDLVDDKPTKWKIENSWGDKPGFKGYFVMSDEWFDQFVYQAVLNKAFLPE 1478819 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALA 446 D++ + P L PWDPMGALA Sbjct 1478820 DVKKAYDEGKENPIELLPWDPMGALA 1478897 Features in this part of subject sequence: Aminopeptidase G Score = 412 bits (1059), Expect = 2e-113 Identities = 206/442 (46%), Positives = 286/442 (64%), Gaps = 6/442 (1%) Frame = -3 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS E+T +LA+F + A P + +A +G+ + N +T FS EL T + Sbjct 242524 MSHELTLQELAEFSANFNADPKNQVIARAAARSGVLEASYNERVAGRLTRVFSTELPTDN 242345 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQKQSGRCW+F+ LN +RH A+ K K+F LSQ+Y FFWDK E++N FYE V++TAD Sbjct 242344 VTNQKQSGRCWLFSTLNVLRHDFGAKHKAKNFTLSQSYNFFWDKLERANLFYEKVIETAD 242165 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PLD R+V DGGQW M +L++KYG+VP VMPE++++S ++ L L K Sbjct 242164 KPLDDREVRSYFDFAGHDGGQWHMAVSLVKKYGVVPSYVMPESFNTSATNGLASALADKE 241985 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKDA+ALR+L A +E A++ L E YR++A +G PP FD EYRDDDK YH++ Sbjct 241984 RKDALALRRL-AQAGDQEGLEKARKTFLNEIYRMVAIAVGEPPKTFDLEYRDDDKNYHLE 241808 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + LTP +FF KY +LDDY + NAP D Y LY + NV GG + LN+ ++ Sbjct 241807 KNLTPVSFFNKYFDVDLDDYVVLTNAP--DHEYGKLYHLGAEDNVEGGSPILFLNVPMEY 241634 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 + AV QLK GE+VWFG+DVG+ D + G +DT++YK +DLF D +++KA+RL G Sbjct 241633 LEQAAVAQLKDGEAVWFGNDVGRQMDHKTGYLDTDLYKLEDLFAVDLSLSKADRLATGVG 241454 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 ++HAM L GVD G +WKVENSWGDK G+KG+FV S +WF E+VY+VV+ KKYL+ Sbjct 241453 EVSHAMTLVGVDEDKGDIRQWKVENSWGDKSGEKGFFVMSHNWFKEYVYEVVVHKKYLTK 241274 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 D Q+++ + P LAPWD + Sbjct 241273 DQQELLSS---TPVELAPWDSL 241217 Features in this part of subject sequence: Aminopeptidase W Score = 392 bits (1007), Expect = 2e-107 Identities = 197/442 (44%), Positives = 276/442 (62%), Gaps = 6/442 (1%) Frame = -3 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS E++ L F +D A P + +A +G+ A N + TFSIELDT + Sbjct 243889 MSHELSPQLLESFSRDFNADPKNQVISRAARRSGLLEAAYNPAVSHRLNRTFSIELDTDN 243710 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQ+QSGRCW+F+ LN +RH K K+F SQ+Y FFWDK E++NYFY+ ++ TAD Sbjct 243709 VTNQQQSGRCWLFSTLNVVRHNFGKANKAKNFTFSQSYNFFWDKIERANYFYDRIIATAD 243530 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PL R V Q DGGQW M ++LI KYG+VP MPE+++S+ S L+ +L K Sbjct 243529 RPLTDRTVRGYFDWCQTDGGQWHMAASLIAKYGVVPAYSMPESFNSNHSQALDMVLADKE 243350 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKDA+ LR+L A +EAA+ L++ YRI+A LG PP FD E+RDDDK YH+D Sbjct 243349 RKDALTLRRL-AQAGDQEKLEAARTDFLSQIYRIMATALGEPPKTFDLEFRDDDKNYHLD 243173 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + LTP F+KKY A +LDDY + NAP D N + + N+ GG +N+ ++ Sbjct 243172 KGLTPVQFYKKYCATDLDDYVVLANAP--DHEMNRVLHLGFEDNIKGGYPNLFINVPMEY 242999 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 + A+ QLK GE+VWFG+DVG+ DR+ G MD ++Y+ D L + D ++KA+RL G Sbjct 242998 LEDAAIAQLKDGEAVWFGNDVGRQMDRKTGFMDLDLYQLDQLLDIDSHLSKADRLATGIG 242819 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 +H M L GVD+ G+ +WKVENSWGDK G+KGYF S WF E+ Y+V + KK++ A Sbjct 242818 ESSHDMALVGVDVDGGQVRQWKVENSWGDKSGEKGYFTMSADWFREYTYEVAVQKKHVPA 242639 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 ++ D++KN+ P L PWD + Sbjct 242638 EILDLLKNQ---PIELDPWDSL 242582 >gb|CP000414.1| Download subject sequence spanning the HSP Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293, complete genome Length=2038396 Features in this part of subject sequence: Aminopeptidase C Score = 555 bits (1430), Expect = 2e-156 Identities = 263/425 (61%), Positives = 339/425 (79%), Gaps = 4/425 (0%) Frame = +3 Query 26 LQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQA 85 +++AV NGI++ + + + TP FSI+LDTG VANQKQSGRCWMFAALNTMRH I+ Sbjct 1732545 IRRAVTKNGIHSASFDQEIANINTPIFSIDLDTGKVANQKQSGRCWMFAALNTMRHDIKD 1732724 Query 86 QFKIKD-FELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDM 144 +F I D F+LSQ+YT FWDKFEK+NYFYENVLKTA +PLDSR+V+FL+TTPQQDGGQWDM Sbjct 1732725 RFHISDEFQLSQSYTLFWDKFEKANYFYENVLKTATEPLDSRRVSFLLTTPQQDGGQWDM 1732904 Query 145 LSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAK 204 + ++IEKYG+VP+S+ PE+ +SS ++ELN LN LR DA LR LVA +AS I A+ Sbjct 1732905 IVSIIEKYGLVPQSIYPESKASSATAELNNTLNTLLRHDATVLRGLVAQQASKDKISNAR 1733084 Query 205 QKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSII 264 +MLA YR+L+ TLG PP +FDFEYRD+ +H++R+LTPQ +++K+V+W+LD+Y S+I Sbjct 1733085 NEMLANVYRLLSLTLGEPPVQFDFEYRDELHNFHVERQLTPQDYYQKFVSWDLDEYISVI 1733264 Query 265 NAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQS 324 NAPT DKP++ Y V+MLGNVVGGR+V+HLN+DI+ KA A+ QLK G+SVWFG D+G Sbjct 1733265 NAPTADKPFDATYNVDMLGNVVGGRDVKHLNVDINKMKAFAISQLKDGQSVWFGVDMGPQ 1733444 Query 325 SDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVDG-KPTKWKV 383 DR+ G+M + I+ DDLFN D TMTKA+RLDYGESLMTHAMVLTGVD+ + +PTKWKV Sbjct 1733445 VDRESGLMASGIFASDDLFNVDSTMTKAQRLDYGESLMTHAMVLTGVDLDENDQPTKWKV 1733624 Query 384 ENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVLAPWDPMG 443 ENSWG+KVG KGYF SD W E+ YQ+V+ K+YLS++L ++ N KPT+L+PWDPMG Sbjct 1733625 ENSWGEKVGKKGYFTMSDDWMSEYAYQIVVKKEYLSSELVNIYDN--SKPTLLSPWDPMG 1733798 Query 444 ALASK 448 ALA K Sbjct 1733799 ALA*K 1733813 >emb|Z30340.1|LHPEPCG L.helveticus pepC gene for aminopeptidase C Length=1655 Score = 548 bits (1412), Expect = 2e-154 Identities = 261/448 (58%), Positives = 336/448 (75%), Gaps = 0/448 (0%) Frame = +1 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M+ EI +A+F+ DL P + A NGI ++N +K+ + P FSIE+DTG Sbjct 229 MAKEINNDTIAKFENDLNNHPVFNVASHAAQENGIYKASQNLQTKIDLDPIFSIEIDTGK 408 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 A+QKQSGRCWMF+ALNTMRH +Q +FK++DFELSQNYT FWDKFEKSN+F+ENV+ TAD Sbjct 409 PADQKQSGRCWMFSALNTMRHPLQKKFKLQDFELSQNYTNFWDKFEKSNWFFENVIATAD 588 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 + L RKV+FL TPQQDGGQWDML +IEKYGIVPKSV PET +++ SS LN LN L Sbjct 589 KDLGDRKVSFLFATPQQDGGQWDMLCGIIEKYGIVPKSVYPETANATNSSALNDTLNTLL 768 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKD + LR+LV S+ +++A K++ML + +R+LA + PP KF+FEYRDD+ YHID Sbjct 769 RKDGLELRRLVNAGKSEDEVQARKEEMLNDVFRVLAISTCVPPKKFNFEYRDDNHNYHID 948 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 +++TP+ FF KYV +L ++ S INAPT DKP++ +++VE LGNV GGR+VRHLNL +D Sbjct 949 KDITPKEFFDKYVGMDLANHISTINAPTSDKPFHKVFSVEYLGNVEGGRQVRHLNLKVDE 1128 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K L +KQL GE VWFGS+V + S+R+ G++ TN+Y++D LF+ DF+M+KA++LD GES Sbjct 1129 MKDLIIKQLNNGEVVWFGSNVVKDSERRAGLLATNLYRRDQLFDVDFSMSKADKLDSGES 1308 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 +M HAMV+TGVDIVDGKPTKWK+ENSWG+K G KGYFV SDSWFD FVYQ VI+K L Sbjct 1309 MMDHAMVITGVDIVDGKPTKWKIENSWGEKPGFKGYFVMSDSWFDSFVYQAVINKDILPE 1488 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALASK 448 DL+ D P L PWDPMGALA K Sbjct 1489 DLKKAYDEGKDNPIQLLPWDPMGALAFK 1572 >gb|CP000411.1| Download subject sequence spanning the HSP Oenococcus oeni PSU-1, complete genome Length=1780517 Features in this part of subject sequence: Aminopeptidase C Score = 537 bits (1383), Expect = 4e-151 Identities = 261/447 (58%), Positives = 336/447 (75%), Gaps = 7/447 (1%) Frame = +2 Query 4 EITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVAN 63 EI+ + F Q L++ P A +++AV +NGI+ ++ + V FS+E+ TG VAN Sbjct 450797 EISLEQIKDFNQGLKSFPAADTIRRAVTSNGIDKATLDSKAAVDSQAVFSVEVKTGKVAN 450976 Query 64 QKQSGRCWMFAALNTMRHGIQAQFKIKD-FELSQNYTFFWDKFEKSNYFYENVLKTADQP 122 Q SGRCWMFAALNTMRH F I FELSQ+YTFFWDKFEK+NYFY NV+KTAD P Sbjct 450977 QMSSGRCWMFAALNTMRHRTADLFNISGKFELSQSYTFFWDKFEKANYFYNNVVKTADLP 451156 Query 123 LDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRK 182 LD+RKVA+L+ TPQQDGGQWDM+ A+IEKYG+VP++V PE++ SS S+ LN +LN KLRK Sbjct 451157 LDNRKVAYLLETPQQDGGQWDMICAIIEKYGLVPQAVFPESFDSSHSAALNRMLNRKLRK 451336 Query 183 DAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPP--TKFDFEYRDDDKQYHID 240 DAV LR L A K++ A+I+ ++ A++YR+L+ GNP FDFEYRD+DK+YH++ Sbjct 451337 DAVELRALAAQKSNQAEIDEKIKEFNADNYRMLSLVFGNPADVAHFDFEYRDEDKKYHLE 451516 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + LTP++FFKK+V +L+DY SIINAPT DKPY+ YT+E LGNVVGGREV+HLN+++D Sbjct 451517 KNLTPKSFFKKFVDEDLEDYVSIINAPTSDKPYHKTYTIENLGNVVGGREVKHLNVELDE 451696 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 FK LA+ QLK G+SVWFG D+G DR+ GIMD N + ++D F D ++TKAE+LDY +S Sbjct 451697 FKQLAISQLKDGQSVWFGVDMGPQVDRESGIMDLNNFAQEDAFGIDLSLTKAEQLDYADS 451876 Query 361 LMTHAMVLTGVDI-VDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLS 419 LMTHAMVLTGVD+ DG P +WKVENSWG+K G GYFV SD W + YQVV++KKYLS Sbjct 451877 LMTHAMVLTGVDLDEDGNPLRWKVENSWGEKAGKNGYFVMSDDWMSLYAYQVVVNKKYLS 452056 Query 420 ADLQDVIKNEYDKPTVLAPWDPMGALA 446 A+LQ K + + VL PWDPMGALA Sbjct 452057 AELQ---KAQAETAKVLDPWDPMGALA 452128 Features in this part of subject sequence: cysteine aminopeptidase Score = 470 bits (1209), Expect = 7e-131 Identities = 220/442 (49%), Positives = 313/442 (70%), Gaps = 5/442 (1%) Frame = -2 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M++ +T ++ + + AS L + V NGI+A + + + + TFSIELDTG Sbjct 25999 MASALTKEKISSLRDQFKQNKEASILTRTVTKNGIHAASYDNTAATRLNRTFSIELDTGK 25820 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQK SGRCW F+ LNT+RH ++ +KDF+LSQNY FFWDK E++N FY+N+ +TA Sbjct 25819 VTNQKHSGRCWEFSMLNTLRHTFAKKYHVKDFQLSQNYLFFWDKIERANIFYQNIERTAQ 25640 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +P++ R+V F + TP QDGGQW M + LIEKYG++P S MPE+Y+++K+ E +++ KL Sbjct 25639 KPINDREVEFFLDTPGQDGGQWAMAAGLIEKYGLMPASTMPESYNTNKTDEFAEVMDKKL 25460 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKDA+A+RKLVA+ A+ IEA++ +MLAE YRI AY+ G PP KFD EYRDD+K+YH + Sbjct 25459 RKDALAIRKLVANGATKEKIEASENEMLAEVYRIAAYSFGEPPKKFDLEYRDDNKKYHRE 25280 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 +LT + F+KKY N D+Y + N+P DKP N LY++ N++ GR + LN+D+ Sbjct 25279 AKLTAKEFYKKYFNKNFDNYVVVTNSP--DKPLNKLYSLPCENNIIKGRTIEFLNVDMKL 25106 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 L+++QLK GE+VWFG+DV Q DRQ G +D+ +Y+ ++LF+ + MTKAERL GE Sbjct 25105 LADLSIQQLKDGETVWFGNDVLQQLDRQAGFLDSILYRTEELFSINTKMTKAERLLTGEG 24926 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 ++HAM LTGVD++D +PTKWKVENSWGDK+G GYFV S WF+ FVY+VV+ KKYLS Sbjct 24925 QVSHAMTLTGVDLIDKQPTKWKVENSWGDKIGKDGYFVMSQDWFENFVYEVVVHKKYLSK 24746 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 +LQ+++K ++ L WDP+ Sbjct 24745 ELQEILKQPAEE---LPVWDPL 24689 >gb|L26223.1|LBAPEPC Lactobacillus helveticus aminopeptidase C (pepC) gene, complete cds Length=1740 Score = 533 bits (1372), Expect = 8e-150 Identities = 253/433 (58%), Positives = 327/433 (75%), Gaps = 0/433 (0%) Frame = +1 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M+ EI T +A+F+ DL P + A NGI ++N +K+ + P FSIE+DTG Sbjct 190 MAKEINTDTIAKFENDLNNHPVFNVASHAAQENGIYKASQNLQTKIDLDPIFSIEIDTGK 369 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 ANQKQSGRCWMF+ALNTMRH +Q +FK++DFELSQNYT FWDKFEKSN+F+ENV+ TAD Sbjct 370 PANQKQSGRCWMFSALNTMRHPLQKKFKLQDFELSQNYTNFWDKFEKSNWFFENVIATAD 549 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 + L RKV+FL TPQQDGGQWDML +IEKYGIVPKSV PET +++ SS LN LN L Sbjct 550 KDLGDRKVSFLFATPQQDGGQWDMLCGIIEKYGIVPKSVYPETANATNSSALNDTLNTVL 729 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKD + LR+LV S+ +++A K++ML + +R+LA + PP KF+FEYRDDD YHID Sbjct 730 RKDGLELRRLVNAGKSEDEVQARKEEMLNDVFRVLAISTCVPPKKFNFEYRDDDHNYHID 909 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 +++TP+ FF KYV +L ++ S INAPT DKP++ +++VE LGNV GGR+VRHLNL +D Sbjct 910 KDITPKEFFDKYVGMDLANHISTINAPTSDKPFHKVFSVEYLGNVEGGRQVRHLNLKVDE 1089 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K L +KQLK+GE VWFGS+V + S+R+ G++DTN+Y++D LF+ DF+M+KA++LD GES Sbjct 1090 MKDLIIKQLKSGEVVWFGSNVVKDSERRAGLLDTNLYRRDQLFDVDFSMSKADKLDSGES 1269 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 +M HAMV+TGVD DGKPTKWK+ENSWG+K G KGYFV SDSWFD FVYQ VI+K L Sbjct 1270 MMDHAMVITGVDNGDGKPTKWKIENSWGEKPGFKGYFVMSDSWFDSFVYQAVINKDILPE 1449 Query 421 DLQDVIKNEYDKP 433 DL+ D P Sbjct 1450 DLKKAYDEGKDNP 1488 >gb|AE014074.1| Download subject sequence spanning the HSP Streptococcus pyogenes MGAS315, complete genome Length=1900521 Features in this part of subject sequence: putative aminopeptidase C Score = 513 bits (1322), Expect = 5e-144 Identities = 257/430 (59%), Positives = 315/430 (73%), Gaps = 4/430 (0%) Frame = -3 Query 18 QATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALN 77 +A+ SA++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAALN Sbjct 1394605 EASAKFSAIENAVTHNGLLKSLETRQSEVDNDFVFSIDLTKDKVSNQKASGRCWMFAALN 1394426 Query 78 TMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQ 137 T RH + +FK+++FELSQ +TFFWDK+EK+N+F E V+ TADQ L SRKV FL+ PQQ Sbjct 1394425 TFRHKLITEFKLENFELSQAHTFFWDKYEKANWFMEQVIATADQELTSRKVKFLLDVPQQ 1394246 Query 138 DGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASD 197 DGGQWDM+ +L EKYG+VPKSV PE+ SSS S ELN LN LR+DA LR L+A A Sbjct 1394245 DGGQWDMVVSLFEKYGVVPKSVYPESISSSNSRELNQYLNKLLRQDAQILRDLIASGAKA 1394066 Query 198 ADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNL 257 +E K ++L E + LA TLG PP FDF YRD D YH+++ LTPQ F+ K+V L Sbjct 1394065 DQVEDRKAELLQEIFNFLAMTLGLPPRHFDFAYRDKDDHYHVEKGLTPQAFYDKFVGLKL 1393886 Query 258 DDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWF 317 DY S+INAPT DKPY YTVEMLGNVVG REVR+LNLD+ FK LA+KQ++AGESVWF Sbjct 1393885 SDYVSVINAPTADKPYGKSYTVEMLGNVVGSREVRYLNLDMKRFKELAIKQMQAGESVWF 1393706 Query 318 GSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVD-G 376 GSDVGQ SDRQ GI+ TN Y + + + + KA RLDY ESLMTHAMVLTGVD+ + G Sbjct 1393705 GSDVGQVSDRQKGILATNTYDFEASMDINLSQDKAGRLDYSESLMTHAMVLTGVDLDETG 1393526 Query 377 KPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVL 436 KP KWKVENSWG+KVGDKGYFVASD+W DE+ YQ+V+ K++L+AD + E P VL Sbjct 1393525 KPLKWKVENSWGEKVGDKGYFVASDAWMDEYTYQIVVRKEFLTADELAAYEKE---PQVL 1393355 Query 437 APWDPMGALA 446 APWDPMGALA Sbjct 1393354 APWDPMGALA 1393325 >dbj|BA000034.2| Download subject sequence spanning the HSP Streptococcus pyogenes SSI-1 DNA, complete genome Length=1894275 Features in this part of subject sequence: putative cysteine aminopeptidase C Score = 513 bits (1322), Expect = 5e-144 Identities = 257/430 (59%), Positives = 315/430 (73%), Gaps = 4/430 (0%) Frame = +3 Query 18 QATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALN 77 +A+ SA++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAALN Sbjct 502281 EASAKFSAIENAVTHNGLLKSLETRQSEVDNDFVFSIDLTKDKVSNQKASGRCWMFAALN 502460 Query 78 TMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQ 137 T RH + +FK+++FELSQ +TFFWDK+EK+N+F E V+ TADQ L SRKV FL+ PQQ Sbjct 502461 TFRHKLITEFKLENFELSQAHTFFWDKYEKANWFMEQVIATADQELTSRKVKFLLDVPQQ 502640 Query 138 DGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASD 197 DGGQWDM+ +L EKYG+VPKSV PE+ SSS S ELN LN LR+DA LR L+A A Sbjct 502641 DGGQWDMVVSLFEKYGVVPKSVYPESISSSNSRELNQYLNKLLRQDAQILRDLIASGAKA 502820 Query 198 ADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNL 257 +E K ++L E + LA TLG PP FDF YRD D YH+++ LTPQ F+ K+V L Sbjct 502821 DQVEDRKAELLQEIFNFLAMTLGLPPRHFDFAYRDKDDHYHVEKGLTPQAFYDKFVGLKL 503000 Query 258 DDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWF 317 DY S+INAPT DKPY YTVEMLGNVVG REVR+LNLD+ FK LA+KQ++AGESVWF Sbjct 503001 SDYVSVINAPTADKPYGKSYTVEMLGNVVGSREVRYLNLDMKRFKELAIKQMQAGESVWF 503180 Query 318 GSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVD-G 376 GSDVGQ SDRQ GI+ TN Y + + + + KA RLDY ESLMTHAMVLTGVD+ + G Sbjct 503181 GSDVGQVSDRQKGILATNTYDFEASMDINLSQDKAGRLDYSESLMTHAMVLTGVDLDETG 503360 Query 377 KPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVL 436 KP KWKVENSWG+KVGDKGYFVASD+W DE+ YQ+V+ K++L+AD + E P VL Sbjct 503361 KPLKWKVENSWGEKVGDKGYFVASDAWMDEYTYQIVVRKEFLTADELAAYEKE---PQVL 503531 Query 437 APWDPMGALA 446 APWDPMGALA Sbjct 503532 APWDPMGALA 503561 >gb|AE004092.1| Download subject sequence spanning the HSP Streptococcus pyogenes M1 GAS, complete genome Length=1852441 Features in this part of subject sequence: putative cysteine aminopeptidase C Score = 513 bits (1321), Expect = 7e-144 Identities = 257/430 (59%), Positives = 314/430 (73%), Gaps = 4/430 (0%) Frame = -3 Query 18 QATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALN 77 +A SA++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAALN Sbjct 1371113 EANAKFSAIENAVTHNGLLKSLETRQSEVDNDFVFSIDLTKDKVSNQKASGRCWMFAALN 1370934 Query 78 TMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQ 137 T RH + +FK+++FELSQ +TFFWDK+EK+N+F E V+ TADQ L SRKV FL+ PQQ Sbjct 1370933 TFRHKLITEFKLENFELSQAHTFFWDKYEKANWFMEQVIATADQELTSRKVKFLLDVPQQ 1370754 Query 138 DGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASD 197 DGGQWDM+ +L EKYG+VPKSV PE+ SSS S ELN LN LR+DA LR L+A A Sbjct 1370753 DGGQWDMVVSLFEKYGVVPKSVYPESISSSNSRELNQYLNKLLRQDAQILRDLIASGAKA 1370574 Query 198 ADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNL 257 +E K ++L E + LA TLG PP FDF YRD D YH+++ LTPQ F+ K+V L Sbjct 1370573 DQVEDRKAELLQEIFNFLAMTLGLPPRHFDFAYRDKDDHYHVEKGLTPQAFYDKFVGLKL 1370394 Query 258 DDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWF 317 DY S+INAPT DKPY YTVEMLGNVVG REVR+LNLD+ FK LA+KQ++AGESVWF Sbjct 1370393 SDYVSVINAPTADKPYGKSYTVEMLGNVVGSREVRYLNLDMKRFKELAIKQMQAGESVWF 1370214 Query 318 GSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVD-G 376 GSDVGQ SDRQ GI+ TN Y + + + + KA RLDY ESLMTHAMVLTGVD+ + G Sbjct 1370213 GSDVGQVSDRQKGILATNTYDFEASMDINLSQDKAGRLDYSESLMTHAMVLTGVDLDETG 1370034 Query 377 KPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVL 436 KP KWKVENSWG+KVGDKGYFVASD+W DE+ YQ+V+ K++L+AD + E P VL Sbjct 1370033 KPLKWKVENSWGEKVGDKGYFVASDAWMDEYTYQIVVRKEFLTADELAAYEKE---PQVL 1369863 Query 437 APWDPMGALA 446 APWDPMGALA Sbjct 1369862 APWDPMGALA 1369833 >gb|CP000261.1| Download subject sequence spanning the HSP Streptococcus pyogenes MGAS2096, complete genome Length=1860355 Features in this part of subject sequence: Aminopeptidase C Score = 513 bits (1321), Expect = 7e-144 Identities = 257/430 (59%), Positives = 314/430 (73%), Gaps = 4/430 (0%) Frame = -3 Query 18 QATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALN 77 +A SA++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAALN Sbjct 1344521 EANAKFSAIENAVTHNGLLKSLETRQSEVDNDFVFSIDLTKDKVSNQKASGRCWMFAALN 1344342 Query 78 TMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQ 137 T RH + +FK+++FELSQ +TFFWDK+EK+N+F E V+ TADQ L SRKV FL+ PQQ Sbjct 1344341 TFRHKLITEFKLENFELSQAHTFFWDKYEKANWFMEQVIATADQELTSRKVKFLLDVPQQ 1344162 Query 138 DGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASD 197 DGGQWDM+ +L EKYG+VPKSV PE+ SSS S ELN LN LR+DA LR L+A A Sbjct 1344161 DGGQWDMVVSLFEKYGVVPKSVYPESISSSNSRELNQYLNKLLRQDAQILRDLIASGAKA 1343982 Query 198 ADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNL 257 +E K ++L E + LA TLG PP FDF YRD D YH+++ LTPQ F+ K+V L Sbjct 1343981 DQVEDRKAELLQEIFNFLAMTLGLPPRHFDFAYRDKDDHYHVEKGLTPQAFYDKFVGLKL 1343802 Query 258 DDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWF 317 DY S+INAPT DKPY YTVEMLGNVVG REVR+LNLD+ FK LA+KQ++AGESVWF Sbjct 1343801 SDYVSVINAPTADKPYGKSYTVEMLGNVVGSREVRYLNLDMKRFKELAIKQMQAGESVWF 1343622 Query 318 GSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVD-G 376 GSDVGQ SDRQ GI+ TN Y + + + + KA RLDY ESLMTHAMVLTGVD+ + G Sbjct 1343621 GSDVGQVSDRQKGILATNTYDFEASMDINLSQDKAGRLDYSESLMTHAMVLTGVDLDETG 1343442 Query 377 KPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVL 436 KP KWKVENSWG+KVGDKGYFVASD+W DE+ YQ+V+ K++L+AD + E P VL Sbjct 1343441 KPLKWKVENSWGEKVGDKGYFVASDAWMDEYTYQIVVRKEFLTADELAAYEKE---PQVL 1343271 Query 437 APWDPMGALA 446 APWDPMGALA Sbjct 1343270 APWDPMGALA 1343241 >gb|CP000259.1| Download subject sequence spanning the HSP Streptococcus pyogenes MGAS9429, complete genome Length=1836467 Features in this part of subject sequence: aminopeptidase C Score = 513 bits (1321), Expect = 7e-144 Identities = 257/430 (59%), Positives = 314/430 (73%), Gaps = 4/430 (0%) Frame = -2 Query 18 QATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALN 77 +A SA++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAALN Sbjct 1320679 EANAKFSAIENAVTHNGLLKSLETRQSEVDNDFVFSIDLTKDKVSNQKASGRCWMFAALN 1320500 Query 78 TMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQ 137 T RH + +FK+++FELSQ +TFFWDK+EK+N+F E V+ TADQ L SRKV FL+ PQQ Sbjct 1320499 TFRHKLITEFKLENFELSQAHTFFWDKYEKANWFMEQVIATADQELTSRKVKFLLDVPQQ 1320320 Query 138 DGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASD 197 DGGQWDM+ +L EKYG+VPKSV PE+ SSS S ELN LN LR+DA LR L+A A Sbjct 1320319 DGGQWDMVVSLFEKYGVVPKSVYPESISSSNSRELNQYLNKLLRQDAQILRDLIASGAKA 1320140 Query 198 ADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNL 257 +E K ++L E + LA TLG PP FDF YRD D YH+++ LTPQ F+ K+V L Sbjct 1320139 DQVEDRKAELLQEIFNFLAMTLGLPPRHFDFAYRDKDDHYHVEKGLTPQAFYDKFVGLKL 1319960 Query 258 DDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWF 317 DY S+INAPT DKPY YTVEMLGNVVG REVR+LNLD+ FK LA+KQ++AGESVWF Sbjct 1319959 SDYVSVINAPTADKPYGKSYTVEMLGNVVGSREVRYLNLDMKRFKELAIKQMQAGESVWF 1319780 Query 318 GSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVD-G 376 GSDVGQ SDRQ GI+ TN Y + + + + KA RLDY ESLMTHAMVLTGVD+ + G Sbjct 1319779 GSDVGQVSDRQKGILATNTYDFEASMDINLSQDKAGRLDYSESLMTHAMVLTGVDLDETG 1319600 Query 377 KPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVL 436 KP KWKVENSWG+KVGDKGYFVASD+W DE+ YQ+V+ K++L+AD + E P VL Sbjct 1319599 KPLKWKVENSWGEKVGDKGYFVASDAWMDEYTYQIVVRKEFLTADELAAYEKE---PQVL 1319429 Query 437 APWDPMGALA 446 APWDPMGALA Sbjct 1319428 APWDPMGALA 1319399 >gb|CP000017.1| Download subject sequence spanning the HSP Streptococcus pyogenes MGAS5005, complete genome Length=1838554 Features in this part of subject sequence: aminopeptidase C Score = 513 bits (1321), Expect = 7e-144 Identities = 257/430 (59%), Positives = 314/430 (73%), Gaps = 4/430 (0%) Frame = -1 Query 18 QATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALN 77 +A SA++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAALN Sbjct 1326073 EANAKFSAIENAVTHNGLLKSLETRQSEVDNDFVFSIDLTKDKVSNQKASGRCWMFAALN 1325894 Query 78 TMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQ 137 T RH + +FK+++FELSQ +TFFWDK+EK+N+F E V+ TADQ L SRKV FL+ PQQ Sbjct 1325893 TFRHKLITEFKLENFELSQAHTFFWDKYEKANWFMEQVIATADQELTSRKVKFLLDVPQQ 1325714 Query 138 DGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASD 197 DGGQWDM+ +L EKYG+VPKSV PE+ SSS S ELN LN LR+DA LR L+A A Sbjct 1325713 DGGQWDMVVSLFEKYGVVPKSVYPESISSSNSRELNQYLNKLLRQDAQILRDLIASGAKA 1325534 Query 198 ADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNL 257 +E K ++L E + LA TLG PP FDF YRD D YH+++ LTPQ F+ K+V L Sbjct 1325533 DQVEDRKAELLQEIFNFLAMTLGLPPRHFDFAYRDKDDHYHVEKGLTPQAFYDKFVGLKL 1325354 Query 258 DDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWF 317 DY S+INAPT DKPY YTVEMLGNVVG REVR+LNLD+ FK LA+KQ++AGESVWF Sbjct 1325353 SDYVSVINAPTADKPYGKSYTVEMLGNVVGSREVRYLNLDMKRFKELAIKQMQAGESVWF 1325174 Query 318 GSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVD-G 376 GSDVGQ SDRQ GI+ TN Y + + + + KA RLDY ESLMTHAMVLTGVD+ + G Sbjct 1325173 GSDVGQVSDRQKGILATNTYDFEASMDINLSQDKAGRLDYSESLMTHAMVLTGVDLDETG 1324994 Query 377 KPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVL 436 KP KWKVENSWG+KVGDKGYFVASD+W DE+ YQ+V+ K++L+AD + E P VL Sbjct 1324993 KPLKWKVENSWGEKVGDKGYFVASDAWMDEYTYQIVVRKEFLTADELAAYEKE---PQVL 1324823 Query 437 APWDPMGALA 446 APWDPMGALA Sbjct 1324822 APWDPMGALA 1324793 >gb|CP000056.1| Download subject sequence spanning the HSP Streptococcus pyogenes MGAS6180, complete genome Length=1897573 Features in this part of subject sequence: aminopeptidase C Score = 513 bits (1321), Expect = 7e-144 Identities = 257/430 (59%), Positives = 314/430 (73%), Gaps = 4/430 (0%) Frame = -1 Query 18 QATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALN 77 +A SA++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAALN Sbjct 1395733 EANAKFSAIENAVTHNGLLKSLETRQSEVDNDFVFSIDLTKDKVSNQKASGRCWMFAALN 1395554 Query 78 TMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQ 137 T RH + +FK+++FELSQ +TFFWDK+EK+N+F E V+ TADQ L SRKV FL+ PQQ Sbjct 1395553 TFRHKLITEFKLENFELSQAHTFFWDKYEKANWFMEQVIATADQELTSRKVKFLLDVPQQ 1395374 Query 138 DGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASD 197 DGGQWDM+ +L EKYG+VPKSV PE+ SSS S ELN LN LR+DA LR L+A A Sbjct 1395373 DGGQWDMVVSLFEKYGVVPKSVYPESISSSNSRELNQYLNKLLRQDAQILRDLIASGAKA 1395194 Query 198 ADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNL 257 +E K ++L E + LA TLG PP FDF YRD D YH+++ LTPQ F+ K+V L Sbjct 1395193 DQVEDRKAELLQEIFNFLAMTLGLPPRHFDFAYRDKDDHYHVEKGLTPQAFYDKFVGLKL 1395014 Query 258 DDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWF 317 DY S+INAPT DKPY YTVEMLGNVVG REVR+LNLD+ FK LA+KQ++AGESVWF Sbjct 1395013 SDYVSVINAPTADKPYGKSYTVEMLGNVVGSREVRYLNLDMKRFKELAIKQMQAGESVWF 1394834 Query 318 GSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVD-G 376 GSDVGQ SDRQ GI+ TN Y + + + + KA RLDY ESLMTHAMVLTGVD+ + G Sbjct 1394833 GSDVGQVSDRQKGILATNTYDFEASMDINLSQDKAGRLDYSESLMTHAMVLTGVDLDETG 1394654 Query 377 KPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVL 436 KP KWKVENSWG+KVGDKGYFVASD+W DE+ YQ+V+ K++L+AD + E P VL Sbjct 1394653 KPLKWKVENSWGEKVGDKGYFVASDAWMDEYTYQIVVRKEFLTADELAAYEKE---PQVL 1394483 Query 437 APWDPMGALA 446 APWDPMGALA Sbjct 1394482 APWDPMGALA 1394453 >gb|CP000262.1| Download subject sequence spanning the HSP Streptococcus pyogenes MGAS10750, complete genome Length=1937111 Features in this part of subject sequence: Aminopeptidase C Score = 513 bits (1320), Expect = 9e-144 Identities = 256/430 (59%), Positives = 314/430 (73%), Gaps = 4/430 (0%) Frame = -1 Query 18 QATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALN 77 +A SA++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAALN Sbjct 1403180 EANAKFSAIENAVTHNGLLKSLETRQSEVDNDFVFSIDLTKDKVSNQKASGRCWMFAALN 1403001 Query 78 TMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQ 137 T RH + +FK+++FELSQ +TFFWDK+EK+N+F E V+ TADQ L SRKV FL+ PQQ Sbjct 1403000 TFRHKLITEFKLENFELSQAHTFFWDKYEKANWFMEQVIATADQELTSRKVKFLLDVPQQ 1402821 Query 138 DGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASD 197 DGGQWDM+ +L EKYG+VPKSV PE+ SSS S ELN LN LR+DA LR L+A A Sbjct 1402820 DGGQWDMVVSLFEKYGVVPKSVYPESISSSNSRELNQYLNKLLRQDAQILRDLIASGAKA 1402641 Query 198 ADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNL 257 +E K ++L E + LA TLG PP FDF YRD D YH+++ LTPQ F+ K+V L Sbjct 1402640 DQVEDRKAELLQEIFNFLAMTLGLPPRHFDFAYRDKDDHYHVEKGLTPQAFYDKFVGLKL 1402461 Query 258 DDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWF 317 DY S+INAPT DKPY YTVEMLGNVVG REVR+LNLD+ FK LA+KQ++AGESVWF Sbjct 1402460 SDYVSVINAPTADKPYGKSYTVEMLGNVVGSREVRYLNLDMKRFKELAIKQMQAGESVWF 1402281 Query 318 GSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVD-G 376 GSDVGQ SDRQ GI+ TN Y + + + + KA RLDY ESLMTHAMVLTGVD+ + G Sbjct 1402280 GSDVGQVSDRQKGILATNTYDFEASMDINLSQDKAGRLDYSESLMTHAMVLTGVDLDETG 1402101 Query 377 KPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVL 436 KP KWK+ENSWG+KVGDKGYFVASD+W DE+ YQ+V+ K++L+AD + E P VL Sbjct 1402100 KPLKWKIENSWGEKVGDKGYFVASDAWMDEYTYQIVVRKEFLTADELAAYEKE---PQVL 1401930 Query 437 APWDPMGALA 446 APWDPMGALA Sbjct 1401929 APWDPMGALA 1401900 >gb|AE017262.2| Download subject sequence spanning the HSP Listeria monocytogenes str. 4b F2365, complete genome Length=2905187 Features in this part of subject sequence: aminopeptidase C Score = 512 bits (1319), Expect = 1e-143 Identities = 246/446 (55%), Positives = 324/446 (72%), Gaps = 6/446 (1%) Frame = +2 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M E+T L F + + P Q +++ NGI A EN SKV++ P FS E+ T Sbjct 2360456 MHTELTFEQLESFSRKWRENPDKLVFQASIIKNGIKAATENPASKVSIQPVFSHEVATDK 2360635 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V+NQ+QSGRCWMFAALNT RH + +KDFELSQNYT FWDK EK+NYF EN+++TA Sbjct 2360636 VSNQQQSGRCWMFAALNTFRHKLNGTLGLKDFELSQNYTNFWDKLEKANYFLENIIETAS 2360815 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 + DSR V++L+ TPQQDGGQWDML ++IEKYG+VPKS MPET+ SSKS++LN LLN +L Sbjct 2360816 EDEDSRLVSWLLDTPQQDGGQWDMLVSIIEKYGVVPKSAMPETFQSSKSADLNHLLNERL 2360995 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 R DAV LR +A+K AD+ K++MLAE Y++L TLG PP FDFEYR+ D ++ + Sbjct 2360996 RTDAVILRNAIAEKKDTADL---KEEMLAEVYQLLVMTLGEPPKVFDFEYRNKDNEFKQE 2361166 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 ++TP+ F+++YV +L DY +INAPT DKP+N +TVE LGN+V G +++LN+++D Sbjct 2361167 LQITPKDFYERYVDMDLKDYIPLINAPTKDKPFNQAFTVEYLGNIVNGTPIKYLNVEMDV 2361346 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K A Q+K GE+VWFG DVGQ S+R GIMDT+I+ + F MTKAERLDY S Sbjct 2361347 LKKAAADQIKDGETVWFGCDVGQLSERNTGIMDTDIFLLNQTFGFKTAMTKAERLDYKHS 2361526 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 ++THAMVLTGV+I +G+ +WKVENSWG+K+G+ GYFVASD+W DEF +QVV+ KKYLS Sbjct 2361527 MLTHAMVLTGVNIANGEVNRWKVENSWGEKIGNNGYFVASDAWMDEFTFQVVVHKKYLSK 2361706 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALA 446 +L I++ KP VL PWDPMG+LA Sbjct 2361707 EL---IESFNQKPIVLKPWDPMGSLA 2361775 >gb|CP000419.1| Download subject sequence spanning the HSP Streptococcus thermophilus LMD-9, complete genome Length=1856368 Features in this part of subject sequence: Aminopeptidase C Score = 512 bits (1318), Expect = 2e-143 Identities = 255/434 (58%), Positives = 316/434 (72%), Gaps = 4/434 (0%) Frame = +2 Query 16 DLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAA 75 D +A A++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAA Sbjct 235229 DYEANAKYGAIENAVTHNGLLKSIETRQSEVENDFVFSIDLTKDEVSNQKASGRCWMFAA 235408 Query 76 LNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTP 135 LNT RH + + FK++ FELSQ +TFFWDK+EKSN+F E ++ TADQ + SRKV FL+ TP Sbjct 235409 LNTFRHKLISDFKLESFELSQAHTFFWDKYEKSNWFLEQIIATADQEIGSRKVKFLLDTP 235588 Query 136 QQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKA 195 QQDGGQWDM+ +L EKYG+VPKSV PE+ +SS S ELN LN LR+DA LR L+A A Sbjct 235589 QQDGGQWDMVVSLFEKYGVVPKSVYPESVASSNSRELNQYLNKLLRQDAQILRDLIASGA 235768 Query 196 SDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAW 255 A ++A K++ L E + LA TLG PP +FDF YRD D Y ++ +TP+ FF+KYV Sbjct 235769 DQAAVQAKKEEFLQEIFNYLAMTLGLPPRQFDFAYRDKDDNYQSEKGITPRAFFEKYVGL 235948 Query 256 NLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESV 315 L DY S+INAPT DKPY YTVEMLGNVVG VR++NL +D FK LA+ Q+KAGESV Sbjct 235949 KLSDYVSVINAPTTDKPYGKSYTVEMLGNVVGAPSVRYINLPMDRFKELAIAQMKAGESV 236128 Query 316 WFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-V 374 WFGSDVGQ SDRQ GI+ TN+Y + ++T KA RLDY ESLMTHAMVLTGVD+ Sbjct 236129 WFGSDVGQVSDRQKGILATNVYDFTASMDINWTQDKAGRLDYSESLMTHAMVLTGVDLDA 236308 Query 375 DGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPT 434 DGKP KWK+ENSWGDKVG KGYFVASD+W DE+ YQ+V+ K +L+A +++ E D P Sbjct 236309 DGKPIKWKIENSWGDKVGQKGYFVASDAWMDEYTYQIVVRKDFLTA--EELAAYEAD-PQ 236479 Query 435 VLAPWDPMGALASK 448 VLAPWDPMG+LASK Sbjct 236480 VLAPWDPMGSLASK 236521 >emb|Z30315.1|STPEPCGE S.thermophilus (CNRZ 302) pepC gene for aminopeptidase C Length=1976 Score = 511 bits (1317), Expect = 2e-143 Identities = 255/434 (58%), Positives = 316/434 (72%), Gaps = 4/434 (0%) Frame = +2 Query 16 DLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAA 75 D +A A++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAA Sbjct 650 DYEANAKYGAIENAVTHNGLLKSIETRQSEVENDFVFSIDLTKDEVSNQKASGRCWMFAA 829 Query 76 LNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTP 135 LNT RH + + FK++ FELSQ +TFFWDK+EKSN+F E ++ TADQ + SRKV FL+ TP Sbjct 830 LNTFRHKLISDFKLESFELSQAHTFFWDKYEKSNWFLEQIIATADQEIGSRKVKFLLDTP 1009 Query 136 QQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKA 195 QQDGGQWDM+ +L EKYG+VPKSV PE+ +SS S ELN LN LR+DA LR L+A A Sbjct 1010 QQDGGQWDMVVSLFEKYGVVPKSVYPESVASSNSRELNQYLNKLLRQDAQILRDLIASGA 1189 Query 196 SDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAW 255 A ++A K++ L E + LA TLG PP +FDF YRD D Y ++ +TP+ FF+KYV Sbjct 1190 DQAAVQAKKEEFLQEIFNYLAMTLGLPPRQFDFAYRDKDDNYRSEKGITPRAFFEKYVGL 1369 Query 256 NLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESV 315 L DY S+INAPT DKPY YTVEMLGNVVG VR++NL +D FK LA+ Q+KAGESV Sbjct 1370 KLSDYVSVINAPTADKPYGKSYTVEMLGNVVGAPSVRYINLPMDRFKELAIAQMKAGESV 1549 Query 316 WFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-V 374 WFGSDVGQ SDRQ GI+ TN+Y + ++T KA RLDY ESLMTHAMVLTGVD+ Sbjct 1550 WFGSDVGQVSDRQKGILATNVYDFTASMDINWTQDKAGRLDYSESLMTHAMVLTGVDLDA 1729 Query 375 DGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPT 434 DGKP KWK+ENSWGDKVG KGYFVASD+W DE+ YQ+V+ K +L+A +++ E D P Sbjct 1730 DGKPIKWKIENSWGDKVGQKGYFVASDAWMDEYTYQIVVRKDFLTA--EELAAYEAD-PQ 1900 Query 435 VLAPWDPMGALASK 448 VLAPWDPMG+LASK Sbjct 1901 VLAPWDPMGSLASK 1942 >gb|CP000024.1| Download subject sequence spanning the HSP Streptococcus thermophilus CNRZ1066, complete genome Length=1796226 Features in this part of subject sequence: cysteine aminopeptidase C Score = 511 bits (1316), Expect = 3e-143 Identities = 255/434 (58%), Positives = 316/434 (72%), Gaps = 4/434 (0%) Frame = +1 Query 16 DLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAA 75 D +A A++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAA Sbjct 232048 DYKANAKYGAIENAVTHNGLLKSIETRQSEVENDFVFSIDLTKDEVSNQKASGRCWMFAA 232227 Query 76 LNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTP 135 LNT RH + + FK++ FELSQ +TFFWDK+EKSN+F E ++ TADQ + SRKV FL+ TP Sbjct 232228 LNTFRHKLISDFKLESFELSQAHTFFWDKYEKSNWFLEQIIATADQEIGSRKVKFLLDTP 232407 Query 136 QQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKA 195 QQDGGQWDM+ +L EKYG+VPKSV PE+ +SS S ELN LN LR+DA LR L+A A Sbjct 232408 QQDGGQWDMVVSLFEKYGVVPKSVYPESVASSNSRELNQYLNKLLRQDAQILRDLIASGA 232587 Query 196 SDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAW 255 A ++A K++ L E + LA TLG PP +FDF YRD D Y ++ +TP+ FF+KYV Sbjct 232588 DQAAVQAKKEEFLQEIFNYLAMTLGLPPRQFDFAYRDKDDNYQSEKGITPRAFFEKYVGL 232767 Query 256 NLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESV 315 L DY S+INAPT DKPY YTVEMLGNVVG VR++NL +D FK LA+ Q+KAGESV Sbjct 232768 KLSDYVSVINAPTADKPYGKSYTVEMLGNVVGAPSVRYINLPMDRFKELAIAQMKAGESV 232947 Query 316 WFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-V 374 WFGSDVGQ SDRQ GI+ TN+Y + ++T KA RLDY ESLMTHAMVLTGVD+ Sbjct 232948 WFGSDVGQVSDRQKGILATNVYDFTASMDINWTQDKAGRLDYSESLMTHAMVLTGVDLDA 233127 Query 375 DGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPT 434 DGKP KWK+ENSWGDKVG KGYFVASD+W DE+ YQ+V+ K +L+A +++ E D P Sbjct 233128 DGKPIKWKIENSWGDKVGQKGYFVASDAWMDEYTYQIVVRKDFLTA--EELAAYEAD-PQ 233298 Query 435 VLAPWDPMGALASK 448 VLAPWDPMG+LASK Sbjct 233299 VLAPWDPMGSLASK 233340 >gb|CP000023.1| Download subject sequence spanning the HSP Streptococcus thermophilus LMG 18311, complete genome Length=1796846 Features in this part of subject sequence: cysteine aminopeptidase C Score = 511 bits (1316), Expect = 3e-143 Identities = 255/434 (58%), Positives = 316/434 (72%), Gaps = 4/434 (0%) Frame = +1 Query 16 DLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAA 75 D +A A++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAA Sbjct 232042 DYKANAKYGAIENAVTHNGLLKSIETRQSEVENDFVFSIDLTKDEVSNQKASGRCWMFAA 232221 Query 76 LNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTP 135 LNT RH + + FK++ FELSQ +TFFWDK+EKSN+F E ++ TADQ + SRKV FL+ TP Sbjct 232222 LNTFRHKLISDFKLESFELSQAHTFFWDKYEKSNWFLEQIIATADQEIGSRKVKFLLDTP 232401 Query 136 QQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKA 195 QQDGGQWDM+ +L EKYG+VPKSV PE+ +SS S ELN LN LR+DA LR L+A A Sbjct 232402 QQDGGQWDMVVSLFEKYGVVPKSVYPESVASSNSRELNQYLNKLLRQDAQILRDLIASGA 232581 Query 196 SDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAW 255 A ++A K++ L E + LA TLG PP +FDF YRD D Y ++ +TP+ FF+KYV Sbjct 232582 DQAAVQAKKEEFLQEIFNYLAMTLGLPPRQFDFAYRDKDDNYQSEKGITPRAFFEKYVGL 232761 Query 256 NLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESV 315 L DY S+INAPT DKPY YTVEMLGNVVG VR++NL +D FK LA+ Q+KAGESV Sbjct 232762 KLSDYVSVINAPTADKPYGKSYTVEMLGNVVGAPSVRYINLPMDRFKELAIAQMKAGESV 232941 Query 316 WFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-V 374 WFGSDVGQ SDRQ GI+ TN+Y + ++T KA RLDY ESLMTHAMVLTGVD+ Sbjct 232942 WFGSDVGQVSDRQKGILATNVYDFTASMDINWTQDKAGRLDYSESLMTHAMVLTGVDLDA 233121 Query 375 DGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPT 434 DGKP KWK+ENSWGDKVG KGYFVASD+W DE+ YQ+V+ K +L+A +++ E D P Sbjct 233122 DGKPIKWKIENSWGDKVGQKGYFVASDAWMDEYTYQIVVRKDFLTA--EELAAYEAD-PQ 233292 Query 435 VLAPWDPMGALASK 448 VLAPWDPMG+LASK Sbjct 233293 VLAPWDPMGSLASK 233334 >gb|CP000260.1| Download subject sequence spanning the HSP Streptococcus pyogenes MGAS10270, complete genome Length=1928252 Features in this part of subject sequence: Aminopeptidase C Score = 511 bits (1315), Expect = 3e-143 Identities = 256/430 (59%), Positives = 315/430 (73%), Gaps = 4/430 (0%) Frame = -3 Query 18 QATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALN 77 +A+ SA++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAALN Sbjct 1419978 EASAKFSAIENAVTHNGLLKSLETRQSEVDNDFVFSIDLTKDKVSNQKASGRCWMFAALN 1419799 Query 78 TMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQ 137 T RH + +FK+++FELSQ +TFFWDK+EK+N+F E V+ TADQ L SRKV FL+ PQQ Sbjct 1419798 TFRHKLITEFKLENFELSQAHTFFWDKYEKANWFMEQVIATADQELTSRKVKFLLDVPQQ 1419619 Query 138 DGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASD 197 DGGQWDM+ +L EKYG+VPKSV PE+ SSS S ELN L+ LR+DA LR L+A A Sbjct 1419618 DGGQWDMVVSLFEKYGVVPKSVYPESVSSSNSRELNQYLDKLLRQDAQILRDLIASGAKA 1419439 Query 198 ADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNL 257 +E K ++L E + LA TLG PP FDF YRD D YH+++ LTPQ F+ K+V L Sbjct 1419438 DQVEDRKAELLQEIFNFLAMTLGLPPRHFDFAYRDKDDHYHVEKGLTPQAFYDKFVDLKL 1419259 Query 258 DDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWF 317 DY S+INAPT DKPY YTVEMLGNVVG REVR+LNLD+ FK LA+KQ++AGESVWF Sbjct 1419258 SDYVSVINAPTADKPYGKSYTVEMLGNVVGSREVRYLNLDMKRFKELAIKQMQAGESVWF 1419079 Query 318 GSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVD-G 376 GSDVGQ SDRQ GI+ TN Y + + + + KA RLDY ESLMTHAMVLTGVD+ + G Sbjct 1419078 GSDVGQVSDRQKGILATNTYDFEASMDINLSQDKAGRLDYSESLMTHAMVLTGVDLDETG 1418899 Query 377 KPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVL 436 KP KWKVENSWG+KVGDKGYFVASD+W DE+ YQ+V+ K++L+AD + E P VL Sbjct 1418898 KPLKWKVENSWGEKVGDKGYFVASDAWMDEYTYQIVVRKEFLTADELAAYEKE---PQVL 1418728 Query 437 APWDPMGALA 446 APWDPMGALA Sbjct 1418727 APWDPMGALA 1418698 >gb|CP000408.1| Download subject sequence spanning the HSP Streptococcus suis 98HAH33, complete genome Length=2095698 Features in this part of subject sequence: cysteine aminopeptidase C Score = 509 bits (1312), Expect = 8e-143 Identities = 256/429 (59%), Positives = 309/429 (72%), Gaps = 4/429 (0%) Frame = +2 Query 19 ATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNT 78 A P A + AV +NG+ + E S + FSI+L +V+NQK SGRCWMFAALNT Sbjct 1617170 ANPSLQATENAVSHNGLLKSLETRQSAIDNDYVFSIDLTKDAVSNQKASGRCWMFAALNT 1617349 Query 79 MRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQD 138 RH + + FK+++FELSQ +TFFWDK+EKSN+F E ++ TADQ + SRKV FL+ TPQQD Sbjct 1617350 FRHKLISDFKLENFELSQAHTFFWDKYEKSNWFLEQIIATADQEIGSRKVKFLLDTPQQD 1617529 Query 139 GGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDA 198 GGQWDM+ AL EKYG+VPKSV PE+ SSS S ELN LN LR+DA LR L+A AS Sbjct 1617530 GGQWDMVVALFEKYGVVPKSVYPESISSSASRELNQYLNKLLRQDAQILRDLLAKGASPE 1617709 Query 199 DIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLD 258 +++ K+ +L E + LA LG PP FDF YRD D YH D +TPQ F++KYV L Sbjct 1617710 EVQTQKENLLQEIFNFLAVNLGLPPRSFDFAYRDKDNVYHRDTNVTPQAFYEKYVGLKLS 1617889 Query 259 DYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFG 318 DY SIINAPT DKPYN YTVE+LGNVVG VR+LN++++ FK LA+ QLKAGESVWFG Sbjct 1617890 DYVSIINAPTTDKPYNKSYTVELLGNVVGAPAVRYLNVEMNRFKELAIAQLKAGESVWFG 1618069 Query 319 SDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVDG-K 377 SDVGQSS+RQ GIM TN Y F KA RLDY ESLMTHAMVLTGVD+ D + Sbjct 1618070 SDVGQSSNRQTGIMATNTYDFSSGLGIHFHQDKAGRLDYSESLMTHAMVLTGVDLDDNEQ 1618249 Query 378 PTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVLA 437 P KWKVENSWGDKVGDKGYFVASDSW DE+ YQ+V+ K++L+ Q+ + +P VLA Sbjct 1618250 PLKWKVENSWGDKVGDKGYFVASDSWMDEYTYQIVVRKEFLT---QEELAAYQAQPQVLA 1618420 Query 438 PWDPMGALA 446 PWDPMGALA Sbjct 1618421 PWDPMGALA 1618447 >gb|CP000407.1| Download subject sequence spanning the HSP Streptococcus suis 05ZYH33, complete genome Length=2096309 Features in this part of subject sequence: cysteine aminopeptidase C Score = 509 bits (1312), Expect = 8e-143 Identities = 256/429 (59%), Positives = 309/429 (72%), Gaps = 4/429 (0%) Frame = +3 Query 19 ATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNT 78 A P A + AV +NG+ + E S + FSI+L +V+NQK SGRCWMFAALNT Sbjct 1617765 ANPSLQATENAVSHNGLLKSLETRQSAIDNDYVFSIDLTKDAVSNQKASGRCWMFAALNT 1617944 Query 79 MRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQD 138 RH + + FK+++FELSQ +TFFWDK+EKSN+F E ++ TADQ + SRKV FL+ TPQQD Sbjct 1617945 FRHKLISDFKLENFELSQAHTFFWDKYEKSNWFLEQIIATADQEIGSRKVKFLLDTPQQD 1618124 Query 139 GGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDA 198 GGQWDM+ AL EKYG+VPKSV PE+ SSS S ELN LN LR+DA LR L+A AS Sbjct 1618125 GGQWDMVVALFEKYGVVPKSVYPESISSSASRELNQYLNKLLRQDAQILRDLLAKGASPE 1618304 Query 199 DIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLD 258 +++ K+ +L E + LA LG PP FDF YRD D YH D +TPQ F++KYV L Sbjct 1618305 EVQTQKENLLQEIFNFLAVNLGLPPRSFDFAYRDKDNVYHRDTNVTPQAFYEKYVGLKLS 1618484 Query 259 DYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFG 318 DY SIINAPT DKPYN YTVE+LGNVVG VR+LN++++ FK LA+ QLKAGESVWFG Sbjct 1618485 DYVSIINAPTTDKPYNKSYTVELLGNVVGAPAVRYLNVEMNRFKELAIAQLKAGESVWFG 1618664 Query 319 SDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVDG-K 377 SDVGQSS+RQ GIM TN Y F KA RLDY ESLMTHAMVLTGVD+ D + Sbjct 1618665 SDVGQSSNRQTGIMATNTYDFSSGLGIHFHQDKAGRLDYSESLMTHAMVLTGVDLDDNEQ 1618844 Query 378 PTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVLA 437 P KWKVENSWGDKVGDKGYFVASDSW DE+ YQ+V+ K++L+ Q+ + +P VLA Sbjct 1618845 PLKWKVENSWGDKVGDKGYFVASDSWMDEYTYQIVVRKEFLT---QEELAAYQAQPQVLA 1619015 Query 438 PWDPMGALA 446 PWDPMGALA Sbjct 1619016 PWDPMGALA 1619042 >emb|AM295007.1| Download subject sequence spanning the HSP Streptococcus pyogenes Manfredo complete genome Length=1841271 Features in this part of subject sequence: aminopeptidase C Score = 508 bits (1309), Expect = 2e-142 Identities = 255/430 (59%), Positives = 313/430 (72%), Gaps = 4/430 (0%) Frame = +1 Query 18 QATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALN 77 +A SA++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAALN Sbjct 469801 EANAKFSAIENAVTHNGLLKSLETRQSEVDNDFVFSIDLTKDKVSNQKASGRCWMFAALN 469980 Query 78 TMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQ 137 T RH + +FK+++FELSQ +TFFWDK+EK+N+F E V+ TADQ L SRKV FL+ PQQ Sbjct 469981 TFRHKLITEFKLENFELSQAHTFFWDKYEKANWFMEQVIATADQELTSRKVKFLLDVPQQ 470160 Query 138 DGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASD 197 DGGQWDM+ +L EKYG+VPKSV PE+ SSS S ELN LN LR+DA LR L+A A Sbjct 470161 DGGQWDMVVSLFEKYGVVPKSVYPESISSSNSRELNQYLNKLLRQDAQILRDLIASGAKA 470340 Query 198 ADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNL 257 + K ++L E + LA TLG PP FDF YRD D YH+++ LTPQ F+ K+V L Sbjct 470341 DQVVDRKAELLQEIFNFLAMTLGLPPRHFDFAYRDKDDHYHVEKGLTPQAFYDKFVGLKL 470520 Query 258 DDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWF 317 +Y S+INAPT DKPY YTVEMLGNVVG REVR+LNLD+ FK LA+KQ++AGESVWF Sbjct 470521 SNYVSVINAPTADKPYGKSYTVEMLGNVVGSREVRYLNLDMKRFKELAIKQMQAGESVWF 470700 Query 318 GSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVD-G 376 GSDVGQ SDRQ GI+ TN Y + + + + KA RLDY ESLMTHAMVLTGVD+ + G Sbjct 470701 GSDVGQVSDRQKGILATNTYDFEASMDINLSQDKAGRLDYSESLMTHAMVLTGVDLDETG 470880 Query 377 KPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVL 436 KP KWKVENSWG+KVGDKGYFVASD+W DE+ YQ+V+ K++L+AD + E P VL Sbjct 470881 KPLKWKVENSWGEKVGDKGYFVASDAWMDEYTYQIVVRKEFLTADELAAYEKE---PQVL 471051 Query 437 APWDPMGALA 446 APWDPMGALA Sbjct 471052 APWDPMGALA 471081 >gb|CP000003.1| Download subject sequence spanning the HSP Streptococcus pyogenes MGAS10394, complete genome Length=1899877 Features in this part of subject sequence: Aminopeptidase C Score = 508 bits (1309), Expect = 2e-142 Identities = 255/430 (59%), Positives = 313/430 (72%), Gaps = 4/430 (0%) Frame = -1 Query 18 QATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALN 77 +A SA++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAALN Sbjct 1398205 EANAKFSAIENAVTHNGLLKSLETRQSEVDNDFVFSIDLTKDKVSNQKASGRCWMFAALN 1398026 Query 78 TMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQ 137 T RH + +FK+++FELSQ +TFFWDK+EK+N+F E V+ TADQ L SRKV FL+ PQQ Sbjct 1398025 TFRHKLITEFKLENFELSQAHTFFWDKYEKANWFMEQVIATADQELTSRKVKFLLDVPQQ 1397846 Query 138 DGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASD 197 DGGQWDM+ +L EKYG+VPKSV PE+ SSS S ELN LN LR+DA LR L+A A Sbjct 1397845 DGGQWDMVVSLFEKYGVVPKSVYPESISSSNSRELNQYLNKLLRQDAQILRDLIASGAKA 1397666 Query 198 ADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNL 257 + K ++L E + LA TLG PP FDF YRD D YH+++ LTPQ F+ K+V L Sbjct 1397665 DQVVDRKAELLQEIFNFLAMTLGLPPRHFDFAYRDKDDHYHVEKGLTPQAFYDKFVGLKL 1397486 Query 258 DDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWF 317 +Y S+INAPT DKPY YTVEMLGNVVG REVR+LNLD+ FK LA+KQ++AGESVWF Sbjct 1397485 SNYVSVINAPTADKPYGKSYTVEMLGNVVGSREVRYLNLDMKRFKELAIKQMQAGESVWF 1397306 Query 318 GSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVD-G 376 GSDVGQ SDRQ GI+ TN Y + + + + KA RLDY ESLMTHAMVLTGVD+ + G Sbjct 1397305 GSDVGQVSDRQKGILATNTYDFEASMDINLSQDKAGRLDYSESLMTHAMVLTGVDLDETG 1397126 Query 377 KPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVL 436 KP KWKVENSWG+KVGDKGYFVASD+W DE+ YQ+V+ K++L+AD + E P VL Sbjct 1397125 KPLKWKVENSWGEKVGDKGYFVASDAWMDEYTYQIVVRKEFLTADELAAYEKE---PQVL 1396955 Query 437 APWDPMGALA 446 APWDPMGALA Sbjct 1396954 APWDPMGALA 1396925 >emb|AL596172.1| Download subject sequence spanning the HSP Listeria innocua Clip11262 complete genome, segment 10/12 Length=248050 Features in this part of subject sequence: aminopeptidase C Score = 508 bits (1307), Expect = 3e-142 Identities = 245/446 (54%), Positives = 319/446 (71%), Gaps = 6/446 (1%) Frame = +1 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS EIT L F + + P Q ++M NGI A EN SK + P FS E+ T Sbjct 88639 MSTEITFDQLESFSKKWRENPDKLVFQASIMKNGIKAATENPVSKATVQPVFSHEVHTDK 88818 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V+NQ+QSGRCWMFAALNT RH + +KDFELSQNYT FWDK EK+NYF EN+++TA+ Sbjct 88819 VSNQQQSGRCWMFAALNTFRHKLNGTLGLKDFELSQNYTNFWDKLEKANYFLENIIETAN 88998 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 + DSR V++L+ TPQQDGGQWDML ++IEKYG+V KS MPET+ SSKS++LN LLN +L Sbjct 88999 EDEDSRLVSWLLDTPQQDGGQWDMLVSIIEKYGVVSKSAMPETFQSSKSADLNHLLNERL 89178 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 R DAV LRK V ++ A + K++MLAE Y++L TLG PP FDFEYR+ D ++ D Sbjct 89179 RTDAVILRKAVKEQKDTAGL---KEEMLAEVYQLLVMTLGEPPKVFDFEYRNKDNEFKQD 89349 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 ++TP+ F+K+YV +L DY +INAPT DKP+N +TV+ LGN+V G +++LN+++D Sbjct 89350 LQITPKEFYKRYVDMDLKDYIPLINAPTKDKPFNQAFTVDYLGNIVNGTPIKYLNVEMDV 89529 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K Q+K GE+VWFG DVGQ S+R GIMDT+I+ + F MTKAERLDY S Sbjct 89530 LKKATADQIKDGETVWFGCDVGQLSERTTGIMDTDIFLLNQAFGFKTAMTKAERLDYKHS 89709 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 ++THAMVLTGV+IV+ + +WKVENSWG+K+G+ GYFVASD+W DEF +QVV+ KKYLS Sbjct 89710 MLTHAMVLTGVNIVNNEVNRWKVENSWGEKIGNNGYFVASDAWMDEFTFQVVVHKKYLSK 89889 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALA 446 +L + NE P L PWDPMG+LA Sbjct 89890 ELIEAFSNE---PIALKPWDPMGSLA 89958 >gb|AE010078.1| Gene infoDownload subject sequence spanning the HSP Streptococcus pyogenes strain MGAS8232, section 126 of 173 of the complete genome Length=10723 Score = 507 bits (1306), Expect = 4e-142 Identities = 255/430 (59%), Positives = 312/430 (72%), Gaps = 4/430 (0%) Frame = -3 Query 18 QATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALN 77 +A SA++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAALN Sbjct 5204 EANAKFSAIENAVTHNGLLKSLETRQSEVDNDFVFSIDLTKDKVSNQKASGRCWMFAALN 5025 Query 78 TMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQ 137 T RH + +FK+++FELSQ +TFFWDK+EK+N+F E V+ TADQ L SRKV FL+ PQQ Sbjct 5024 TFRHKLITEFKLENFELSQAHTFFWDKYEKANWFMEQVIATADQELTSRKVKFLLDVPQQ 4845 Query 138 DGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASD 197 DGGQWDM+ +L EKYG+VPKSV PE+ SSS S ELN LN LR+DA LR L+A A Sbjct 4844 DGGQWDMVVSLFEKYGVVPKSVYPESISSSNSRELNQYLNKLLRQDAQILRDLIASGAKA 4665 Query 198 ADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNL 257 + K ++L E + LA TLG PP FDF YRD D YH+++ LTPQ F+ K+V L Sbjct 4664 DQVVDRKAELLQEIFNFLAMTLGLPPRHFDFAYRDKDDHYHVEKGLTPQAFYDKFVGLKL 4485 Query 258 DDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWF 317 +Y S+INAPT DKPY YTVEMLGNVVG REVR+LNLD+ FK LA+KQ+ AGESVWF Sbjct 4484 SNYVSVINAPTADKPYGKSYTVEMLGNVVGSREVRYLNLDMKRFKELAIKQMLAGESVWF 4305 Query 318 GSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVD-G 376 GSDVGQ SDRQ GI+ TN Y + + + + KA RLDY ESLMTHAMVLTGVD+ + G Sbjct 4304 GSDVGQVSDRQKGILATNTYDFEASMDINLSQDKAGRLDYSESLMTHAMVLTGVDLDETG 4125 Query 377 KPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVL 436 KP KWKVENSWG+KVGDKGYFVASD+W DE+ YQ+V+ K++L+AD + E P VL Sbjct 4124 KPLKWKVENSWGEKVGDKGYFVASDAWMDEYTYQIVVRKEFLTADELAAYEKE---PQVL 3954 Query 437 APWDPMGALA 446 APWDPMGALA Sbjct 3953 APWDPMGALA 3924 >gb|AE014133.1| Download subject sequence spanning the HSP Streptococcus mutans UA159, complete genome Length=2030921 Features in this part of subject sequence: cysteine aminopeptidase C Score = 503 bits (1294), Expect = 9e-141 Identities = 252/432 (58%), Positives = 312/432 (72%), Gaps = 4/432 (0%) Frame = +3 Query 16 DLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAA 75 D +A A++ AV +NG+ + E S+V FSI+L V+NQK SGRCWMFAA Sbjct 434514 DYEANTKFHAVENAVTHNGLLKSLETRQSQVENDHVFSIDLTKDEVSNQKASGRCWMFAA 434693 Query 76 LNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTP 135 LNT RH + + FK+++FELSQ +TFFWDK+EKSN+F E V+ TAD+ L SRKV FL+ TP Sbjct 434694 LNTFRHKLISDFKLENFELSQAHTFFWDKYEKSNWFLEQVIATADEELASRKVKFLLDTP 434873 Query 136 QQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKA 195 QQDGGQWDM+ AL EKYG+VPKSV PE+ SSS S ELN LN LR+DA LR+++A A Sbjct 434874 QQDGGQWDMVVALFEKYGVVPKSVYPESISSSASRELNQYLNKLLRQDAQILRQILAAGA 435053 Query 196 SDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAW 255 ++A K+++L E + LA LG PP FDF YRD D Y ++++TP+ F+KKYV Sbjct 435054 DSKAVQAKKEELLQEIFNFLAMNLGLPPRHFDFAYRDKDNHYQSEKKITPRAFYKKYVGL 435233 Query 256 NLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESV 315 NL DY SIINAPT DKPY YTV+MLGNVVG VR+LNL+++ FK LA+ Q++AGE+V Sbjct 435234 NLSDYVSIINAPTADKPYGKSYTVDMLGNVVGSPAVRYLNLEMERFKELAIAQMRAGETV 435413 Query 316 WFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-V 374 WFGSDVGQ SDRQ GI+ TN Y N D T KA RLDY ESLMTHAMVLTGVD+ Sbjct 435414 WFGSDVGQVSDRQKGILATNTYDFKAAMNIDLTQDKAGRLDYSESLMTHAMVLTGVDLDE 435593 Query 375 DGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPT 434 +GK KWKVENSWGDKVG KGYFVASD W DE+ YQ+V+ K++L+A + + + P Sbjct 435594 NGKAIKWKVENSWGDKVGQKGYFVASDVWMDEYTYQIVVRKEFLTA---EELAAYEEAPQ 435764 Query 435 VLAPWDPMGALA 446 VLAPWDPMGALA Sbjct 435765 VLAPWDPMGALA 435800 >emb|AM263198.1| Download subject sequence spanning the HSP Listeria welshimeri serovar 6b str. SLCC5334 complete genome Length=2814130 Features in this part of subject sequence: unnamed protein product Score = 502 bits (1293), Expect = 1e-140 Identities = 242/446 (54%), Positives = 320/446 (71%), Gaps = 6/446 (1%) Frame = +2 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MSAE+T + F + + P Q ++M NGI A EN SKV P FS E+ T Sbjct 2330876 MSAELTLDQVEIFSKKWRENPDKLVFQASIMKNGIKAATENPISKVNNQPIFSHEVKTEK 2331055 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V+NQ+QSGRCWMFAALNT RH + +KDFELSQNYT FWDK EK+NYF EN+++TA+ Sbjct 2331056 VSNQQQSGRCWMFAALNTFRHKLNGTLGLKDFELSQNYTNFWDKLEKANYFLENIIETAN 2331235 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 + DSR V++L+ TPQQDGGQWDML ++IEKYG+VPKS MPETY SSKS++LN LLN +L Sbjct 2331236 EDEDSRLVSWLLDTPQQDGGQWDMLVSIIEKYGVVPKSAMPETYQSSKSADLNHLLNERL 2331415 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 R DAV LRK V +K A + K++MLAE Y++L TLG PP FDFEYR+ D ++ D Sbjct 2331416 RTDAVILRKAVQEKKDTAML---KEEMLAEVYQLLVLTLGEPPKVFDFEYRNKDNEFKQD 2331586 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 ++TP+ F+++Y+ +L +Y +INAPT DKP+N +TV+ LGN+V G +++LN++++ Sbjct 2331587 LQITPKDFYERYIDMDLKNYIPLINAPTKDKPFNQAFTVDYLGNIVDGTPIKYLNVEMNV 2331766 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K A Q+K GE+VWFG DVGQ S+R GIMDT+I+ + F MTKAERLDY S Sbjct 2331767 LKKAAADQIKEGETVWFGCDVGQLSERTSGIMDTDIFLLNQAFGFKSAMTKAERLDYKHS 2331946 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 ++THAMVLTGV++ +G +WKVENSWG+K+G+ GYFVASD+W DE+ +QVV+ KK+LS Sbjct 2331947 MLTHAMVLTGVNVANGSVNRWKVENSWGEKIGNNGYFVASDTWMDEYTFQVVVHKKHLSK 2332126 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALA 446 DL + KP L PWDPMG+LA Sbjct 2332127 DLIEAFN---QKPIALKPWDPMGSLA 2332195 >gb|AF067409.1|AF067409 Listeria monocytogenes aminopeptidase C (pepC) gene, complete cds; and aminopeptidase regulatory protein (pepR) gene, partial cds Length=2029 Score = 502 bits (1292), Expect = 2e-140 Identities = 239/446 (53%), Positives = 318/446 (71%), Gaps = 6/446 (1%) Frame = -1 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M E+T L F + + P Q ++M NGI A EN SKV++ P FS E+ T Sbjct 1336 MQTELTFEQLENFSRKWRENPDKLVFQASIMKNGIKAATENPTSKVSIQPVFSHEVATDK 1157 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V+NQ+QSGRCWMFAALNT RH + +KDFELSQNYT FWDK EK+NYF EN+++TA Sbjct 1156 VSNQQQSGRCWMFAALNTFRHKLNGTLGLKDFELSQNYTNFWDKLEKANYFLENIIETAS 977 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 + DSR V++L+ TPQQDGGQWDML ++IEKYG+VPKS MPET+ S KS++LN LLN +L Sbjct 976 EDEDSRLVSWLLDTPQQDGGQWDMLVSIIEKYGVVPKSAMPETFQSGKSADLNHLLNERL 797 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 R DAV LRK +K A + K++MLAE Y++L TLG PP FDFEYR+ D ++ + Sbjct 796 RTDAVILRKAFTEKKDTAGL---KEEMLAEIYQLLVMTLGEPPKVFDFEYRNKDNEFKQE 626 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 ++TP+ F+++YV +L +Y +INAPT DKP+N +TV+ LGN+V G +++LN+++D Sbjct 625 LQITPKDFYERYVDMDLKNYIPLINAPTKDKPFNQAFTVDYLGNIVNGTPIKYLNVEMDV 446 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K A Q+K GE+VWFG DVGQ S++ GIMDT+I+ + F MTKAERLDY S Sbjct 445 LKKAATDQIKDGETVWFGCDVGQLSEKTTGIMDTDIFLLNQTFGFKTAMTKAERLDYKHS 266 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 ++THAMVLTGV++ +G+ +WKVENSWG+K+G+ GYFVASD+W DEF +QVV+ KKYLS Sbjct 265 MLTHAMVLTGVNVANGEVNRWKVENSWGEKIGNNGYFVASDAWMDEFTFQVVVHKKYLSK 86 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALA 446 +L + E P L PWDPMG+LA Sbjct 85 ELIEAFNQE---PIALKPWDPMGSLA 17 >emb|AL591983.1| Download subject sequence spanning the HSP Listeria monocytogenes strain EGD, complete genome segment 11/12 Length=324050 Features in this part of subject sequence: aminopeptidase C Score = 502 bits (1292), Expect = 2e-140 Identities = 239/446 (53%), Positives = 318/446 (71%), Gaps = 6/446 (1%) Frame = +2 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M E+T L F + + P Q ++M NGI A EN SKV++ P FS E+ T Sbjct 12128 MQTELTFEQLENFSRKWRENPDKLVFQASIMKNGIKAATENPTSKVSIQPVFSHEVATDK 12307 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V+NQ+QSGRCWMFAALNT RH + +KDFELSQNYT FWDK EK+NYF EN+++TA Sbjct 12308 VSNQQQSGRCWMFAALNTFRHKLNGTLGLKDFELSQNYTNFWDKLEKANYFLENIIETAS 12487 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 + DSR V++L+ TPQQDGGQWDML ++IEKYG+VPKS MPET+ S KS++LN LLN +L Sbjct 12488 EDEDSRLVSWLLDTPQQDGGQWDMLVSIIEKYGVVPKSAMPETFQSGKSADLNHLLNERL 12667 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 R DAV LRK +K A + K++MLAE Y++L TLG PP FDFEYR+ D ++ + Sbjct 12668 RTDAVILRKAFTEKKDTAGL---KEEMLAEIYQLLVMTLGEPPKVFDFEYRNKDNEFKQE 12838 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 ++TP+ F+++YV +L +Y +INAPT DKP+N +TV+ LGN+V G +++LN+++D Sbjct 12839 LQITPKDFYERYVDMDLKNYIPLINAPTKDKPFNQAFTVDYLGNIVNGTPIKYLNVEMDV 13018 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K A Q+K GE+VWFG DVGQ S++ GIMDT+I+ + F MTKAERLDY S Sbjct 13019 LKKAATDQIKDGETVWFGCDVGQLSEKTTGIMDTDIFLLNQTFGFKTAMTKAERLDYKHS 13198 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 ++THAMVLTGV++ +G+ +WKVENSWG+K+G+ GYFVASD+W DEF +QVV+ KKYLS Sbjct 13199 MLTHAMVLTGVNVANGEVNRWKVENSWGEKIGNNGYFVASDAWMDEFTFQVVVHKKYLSK 13378 Query 421 DLQDVIKNEYDKPTVLAPWDPMGALA 446 +L + E P L PWDPMG+LA Sbjct 13379 ELIEAFNQE---PIALKPWDPMGSLA 13447 >gb|CP000410.1| Download subject sequence spanning the HSP Streptococcus pneumoniae D39, complete genome Length=2046115 Features in this part of subject sequence: aminopeptidase C Score = 501 bits (1290), Expect = 3e-140 Identities = 248/423 (58%), Positives = 310/423 (73%), Gaps = 4/423 (0%) Frame = +1 Query 25 ALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQ 84 A++ A +NGI A E S V TP FS++L V NQK SGRCWMFAALNT RH + Sbjct 259099 AIENAASHNGIFAALERRQSHVDNTPVFSLDLTKDKVTNQKASGRCWMFAALNTFRHKLI 259278 Query 85 AQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDM 144 +Q+K+++FELSQ +TFFWDK+EKSN+F E V+ T+DQ L SRKV+FL+ TPQQDGGQWDM Sbjct 259279 SQYKLENFELSQAHTFFWDKYEKSNWFLEQVIATSDQELTSRKVSFLLQTPQQDGGQWDM 259458 Query 145 LSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAK 204 + +L EKYG+VPKSV PE+ SSS S ELN +LN LR+DA LR L+ A A ++A K Sbjct 259459 VVSLFEKYGVVPKSVYPESVSSSSSRELNAILNKLLRQDAQILRDLLVSGADQATVQAKK 259638 Query 205 QKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSII 264 + +L E + LA +LG PP KFDF YRD D Y ++ +TPQ F+KKYV L+DY S+I Sbjct 259639 EDLLQEIFNFLAMSLGLPPRKFDFAYRDKDNNYKSEKGITPQEFYKKYVNLPLEDYVSVI 259818 Query 265 NAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQS 324 NAPT DKPY YTVEMLGNVVG R VR++N+ ++ K LA+ Q++AGE+VWFGSDVGQ Sbjct 259819 NAPTADKPYGKSYTVEMLGNVVGSRAVRYINVPMERLKELAIAQMQAGETVWFGSDVGQL 259998 Query 325 SDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-VDGKPTKWKV 383 S+R+ GI+ T++Y + + T KA RLDY ESLMTHAMVLTGVD+ +GK TKWKV Sbjct 259999 SNRKAGILATDVYDFESSMDIKLTQDKAGRLDYSESLMTHAMVLTGVDLDENGKSTKWKV 260178 Query 384 ENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVLAPWDPMG 443 ENSWGDKVG GYFVASD+W DE+ YQ+V+ K+ L+A+ Q E P VLAPWDPMG Sbjct 260179 ENSWGDKVGTDGYFVASDAWMDEYTYQIVVRKELLTAEEQAAYGAE---PIVLAPWDPMG 260349 Query 444 ALA 446 ALA Sbjct 260350 ALA 260358 >gb|AE008407.1| Gene infoDownload subject sequence spanning the HSP Streptococcus pneumoniae R6 section 23 of 184 of the complete genome Length=10140 Score = 501 bits (1290), Expect = 3e-140 Identities = 248/423 (58%), Positives = 310/423 (73%), Gaps = 4/423 (0%) Frame = +1 Query 25 ALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQ 84 A++ A +NGI A E S V TP FS++L V NQK SGRCWMFAALNT RH + Sbjct 3613 AIENAASHNGIFAALERRQSHVDNTPVFSLDLTKDKVTNQKASGRCWMFAALNTFRHKLI 3792 Query 85 AQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDM 144 +Q+K+++FELSQ +TFFWDK+EKSN+F E V+ T+DQ L SRKV+FL+ TPQQDGGQWDM Sbjct 3793 SQYKLENFELSQAHTFFWDKYEKSNWFLEQVIATSDQELTSRKVSFLLQTPQQDGGQWDM 3972 Query 145 LSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAK 204 + +L EKYG+VPKSV PE+ SSS S ELN +LN LR+DA LR L+ A A ++A K Sbjct 3973 VVSLFEKYGVVPKSVYPESVSSSSSRELNAILNKLLRQDAQILRDLLVSGADQATVQAKK 4152 Query 205 QKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSII 264 + +L E + LA +LG PP KFDF YRD D Y ++ +TPQ F+KKYV L+DY S+I Sbjct 4153 EDLLQEIFNFLAMSLGLPPRKFDFAYRDKDNNYKSEKGITPQEFYKKYVNLPLEDYVSVI 4332 Query 265 NAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQS 324 NAPT DKPY YTVEMLGNVVG R VR++N+ ++ K LA+ Q++AGE+VWFGSDVGQ Sbjct 4333 NAPTADKPYGKSYTVEMLGNVVGSRAVRYINVPMERLKELAIAQMQAGETVWFGSDVGQL 4512 Query 325 SDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-VDGKPTKWKV 383 S+R+ GI+ T++Y + + T KA RLDY ESLMTHAMVLTGVD+ +GK TKWKV Sbjct 4513 SNRKAGILATDVYDFESSMDIKLTQDKAGRLDYSESLMTHAMVLTGVDLDENGKSTKWKV 4692 Query 384 ENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVLAPWDPMG 443 ENSWGDKVG GYFVASD+W DE+ YQ+V+ K+ L+A+ Q E P VLAPWDPMG Sbjct 4693 ENSWGDKVGTDGYFVASDAWMDEYTYQIVVRKELLTAEEQAAYGAE---PIVLAPWDPMG 4863 Query 444 ALA 446 ALA Sbjct 4864 ALA 4872 >gb|AE005672.2| Download subject sequence spanning the HSP Streptococcus pneumoniae TIGR4, complete genome Length=2160842 Features in this part of subject sequence: aminopeptidase C Score = 501 bits (1290), Expect = 3e-140 Identities = 248/423 (58%), Positives = 310/423 (73%), Gaps = 4/423 (0%) Frame = +1 Query 25 ALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQ 84 A++ A +NGI A E S V TP FS++L V NQK SGRCWMFAALNT RH + Sbjct 258598 AIENAASHNGIFAALERRQSHVDNTPVFSLDLTKDKVTNQKASGRCWMFAALNTFRHKLI 258777 Query 85 AQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDM 144 +Q+K+++FELSQ +TFFWDK+EKSN+F E V+ T+DQ L SRKV+FL+ TPQQDGGQWDM Sbjct 258778 SQYKLENFELSQAHTFFWDKYEKSNWFLEQVIATSDQELTSRKVSFLLQTPQQDGGQWDM 258957 Query 145 LSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAK 204 + +L EKYG+VPKSV PE+ SSS S ELN +LN LR+DA LR L+ A A ++A K Sbjct 258958 VVSLFEKYGVVPKSVYPESVSSSSSRELNAILNKLLRQDAQILRDLLVSGADQATVQAKK 259137 Query 205 QKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSII 264 + +L E + LA +LG PP KFDF YRD D Y ++ +TPQ F+KKYV L+DY S+I Sbjct 259138 EDLLQEIFNFLAMSLGLPPRKFDFAYRDKDNNYKSEKGITPQEFYKKYVNLPLEDYVSVI 259317 Query 265 NAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQS 324 NAPT DKPY YTVEMLGNVVG R VR++N+ ++ K LA+ Q++AGE+VWFGSDVGQ Sbjct 259318 NAPTADKPYGKSYTVEMLGNVVGSRAVRYINVPMERLKELAIAQMQAGETVWFGSDVGQL 259497 Query 325 SDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-VDGKPTKWKV 383 S+R+ GI+ T++Y + + T KA RLDY ESLMTHAMVLTGVD+ +GK TKWKV Sbjct 259498 SNRKAGILATDVYDFESSMDIKLTQDKAGRLDYSESLMTHAMVLTGVDLDENGKSTKWKV 259677 Query 384 ENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVLAPWDPMG 443 ENSWGDKVG GYFVASD+W DE+ YQ+V+ K+ L+A+ Q E P VLAPWDPMG Sbjct 259678 ENSWGDKVGTDGYFVASDAWMDEYTYQIVVRKELLTAEEQAAYGAE---PIVLAPWDPMG 259848 Query 444 ALA 446 ALA Sbjct 259849 ALA 259857 >gb|CP000387.1| Download subject sequence spanning the HSP Streptococcus sanguinis SK36, complete genome Length=2388435 Features in this part of subject sequence: Aminopeptidase C, putative Score = 494 bits (1273), Expect = 3e-138 Identities = 245/430 (56%), Positives = 316/430 (73%), Gaps = 4/430 (0%) Frame = -2 Query 18 QATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALN 77 +A P +A++ A+ +NG+ A+ E + V TP FS++L V++QK SGRCWMFAALN Sbjct 1857944 EANPKFAAMENAISHNGLLASLEKRSAAVENTPIFSLDLTKDKVSDQKASGRCWMFAALN 1857765 Query 78 TMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQ 137 T RH + A F+++DFELSQ +TFFWDK+EKSN+F E V+ TADQ L SRKV FL+ TPQQ Sbjct 1857764 TFRHKMIAGFQLEDFELSQAHTFFWDKYEKSNWFLEQVIATADQELTSRKVKFLLDTPQQ 1857585 Query 138 DGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASD 197 DGGQWDM+ +L EKYG+VPKSV PE+ SSS S ELN +LN LR+DA LR+L A Sbjct 1857584 DGGQWDMVVSLFEKYGVVPKSVYPESISSSNSRELNQILNKLLRQDAQILRELREKGAES 1857405 Query 198 ADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNL 257 ++++A K+++L E + LA LG PP +FDF YRD D +H + LTP TF++KYV L Sbjct 1857404 SELQAKKEELLQEVFNFLAMNLGLPPRQFDFSYRDKDNHFHSESGLTPLTFYQKYVDLKL 1857225 Query 258 DDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWF 317 DY SIINAPT DKPY YTVEMLGNVVG + VR+LN++++ K LA+ Q++AGE+VWF Sbjct 1857224 ADYVSIINAPTADKPYGRSYTVEMLGNVVGSKPVRYLNVEMNRLKELAIAQMQAGETVWF 1857045 Query 318 GSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-VDG 376 GSDVGQSS+R+ G+M ++ + T KA RLDY ESLMTHAMVLTGVD+ +G Sbjct 1857044 GSDVGQSSNRKAGVMAEGMHDFTASMDIQITQDKAGRLDYSESLMTHAMVLTGVDLDENG 1856865 Query 377 KPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVL 436 K KWKVENSWG+KVG+KGYFVASD+W DE+ YQ+V+ K++L+A + E PTVL Sbjct 1856864 KAKKWKVENSWGEKVGNKGYFVASDAWMDEYTYQIVVRKEFLTAAELAAYEAE---PTVL 1856694 Query 437 APWDPMGALA 446 +PWDPMGALA Sbjct 1856693 SPWDPMGALA 1856664 >gb|CP000114.1| Download subject sequence spanning the HSP Streptococcus agalactiae A909, complete genome Length=2127839 Features in this part of subject sequence: aminopeptidase C Score = 493 bits (1268), Expect = 1e-137 Identities = 245/433 (56%), Positives = 310/433 (71%), Gaps = 4/433 (0%) Frame = +2 Query 16 DLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAA 75 D QA SA++ AV +NG+ + E S++ FSI+L V+NQKQSGRCWMFAA Sbjct 316514 DYQANTKFSAIENAVTHNGLLKSLETRQSEIENDYVFSIDLTKDEVSNQKQSGRCWMFAA 316693 Query 76 LNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTP 135 LNT RH + + FK+++FELSQ +TFFWDK+EKSN+F E ++ TA+Q L SRKV FL+ P Sbjct 316694 LNTFRHKLISDFKLENFELSQAHTFFWDKYEKSNWFMEQIIATANQELSSRKVKFLLDVP 316873 Query 136 QQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKA 195 QQDGGQWDM+ AL EKYG+VPK+V PE+ SSS S ELN LN LR+DA LR+L+A A Sbjct 316874 QQDGGQWDMVVALFEKYGVVPKTVYPESVSSSASRELNQYLNKLLRQDAQILRELIAQGA 317053 Query 196 SDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAW 255 A ++ K+++L E + LA LG PP FDF YRD D Y D+ +TP+ F++KYV Sbjct 317054 DGATVQNKKEELLQEIFNFLAMNLGLPPQSFDFAYRDKDNHYQSDKNITPKAFYQKYVNL 317233 Query 256 NLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESV 315 +L DY SIINAPT DKPY YTVEMLGNVVGG V++LNLD+ FK LA+ Q+K+GE+V Sbjct 317234 DLSDYVSIINAPTVDKPYGQSYTVEMLGNVVGGPAVKYLNLDMKRFKELAIAQMKSGETV 317413 Query 316 WFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVD 375 WFGSDVGQ S+RQ GI+ T Y + + + KA RLDY ESLMTHAMVLTGVD+ + Sbjct 317414 WFGSDVGQVSNRQKGILATTTYDFNSSMDIKLSQDKAGRLDYSESLMTHAMVLTGVDLDE 317593 Query 376 -GKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPT 434 G+P KWKVENSWG+KVG GYFVASD+W DE+ YQ+V+ K+ L+ + + E P Sbjct 317594 SGQPLKWKVENSWGEKVGKDGYFVASDAWMDEYTYQIVVRKELLTKEELEAYNAE---PI 317764 Query 435 VLAPWDPMGALAS 447 LAPWDPMGALA+ Sbjct 317765 TLAPWDPMGALAN 317803 >gb|AE014205.1| Download subject sequence spanning the HSP Streptococcus agalactiae 2603V/R section 15 of 100 of the complete genome Length=20094 Score = 493 bits (1268), Expect = 1e-137 Identities = 245/433 (56%), Positives = 310/433 (71%), Gaps = 4/433 (0%) Frame = +2 Query 16 DLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAA 75 D QA SA++ AV +NG+ + E S++ FSI+L V+NQKQSGRCWMFAA Sbjct 3890 DYQANTKFSAIENAVTHNGLLKSLETRQSEIENDYVFSIDLTKDEVSNQKQSGRCWMFAA 4069 Query 76 LNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTP 135 LNT RH + + FK+++FELSQ +TFFWDK+EKSN+F E ++ TA+Q L SRKV FL+ P Sbjct 4070 LNTFRHKLISDFKLENFELSQAHTFFWDKYEKSNWFMEQIIATANQELSSRKVKFLLDVP 4249 Query 136 QQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKA 195 QQDGGQWDM+ AL EKYG+VPK+V PE+ SSS S ELN LN LR+DA LR+L+A A Sbjct 4250 QQDGGQWDMVVALFEKYGVVPKTVYPESVSSSASRELNQYLNKLLRQDAQILRELIAQGA 4429 Query 196 SDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAW 255 A ++ K+++L E + LA LG PP FDF YRD D Y D+ +TP+ F++KYV Sbjct 4430 DGATVQNKKEELLQEIFNFLAMNLGLPPQSFDFAYRDKDNHYQSDKNITPKAFYQKYVNL 4609 Query 256 NLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESV 315 +L DY SIINAPT DKPY YTVEMLGNVVGG V++LNLD+ FK LA+ Q+K+GE+V Sbjct 4610 DLSDYVSIINAPTVDKPYGQSYTVEMLGNVVGGPAVKYLNLDMKRFKELAIAQMKSGETV 4789 Query 316 WFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVD 375 WFGSDVGQ S+RQ GI+ T Y + + + KA RLDY ESLMTHAMVLTGVD+ + Sbjct 4790 WFGSDVGQVSNRQKGILATTTYDFNSSMDIKLSQDKAGRLDYSESLMTHAMVLTGVDLDE 4969 Query 376 -GKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPT 434 G+P KWKVENSWG+KVG GYFVASD+W DE+ YQ+V+ K+ L+ + + E P Sbjct 4970 SGQPLKWKVENSWGEKVGKDGYFVASDAWMDEYTYQIVVRKELLTKEELEAYNAE---PI 5140 Query 435 VLAPWDPMGALAS 447 LAPWDPMGALA+ Sbjct 5141 TLAPWDPMGALAN 5179 >emb|AL766844.1|SAG766844 Download subject sequence spanning the HSP Streptococcus agalactiae NEM316 complete genome, segment 2 Length=240050 Features in this part of subject sequence: unknown Score = 493 bits (1268), Expect = 1e-137 Identities = 245/433 (56%), Positives = 310/433 (71%), Gaps = 4/433 (0%) Frame = +1 Query 16 DLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAA 75 D QA SA++ AV +NG+ + E S++ FSI+L V+NQKQSGRCWMFAA Sbjct 165373 DYQANTKFSAIENAVTHNGLLKSLETRQSEIENDYVFSIDLTKDEVSNQKQSGRCWMFAA 165552 Query 76 LNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTP 135 LNT RH + + FK+++FELSQ +TFFWDK+EKSN+F E ++ TA+Q L SRKV FL+ P Sbjct 165553 LNTFRHKLISDFKLENFELSQAHTFFWDKYEKSNWFMEQIIATANQELSSRKVKFLLDVP 165732 Query 136 QQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKA 195 QQDGGQWDM+ AL EKYG+VPK+V PE+ SSS S ELN LN LR+DA LR+L+A A Sbjct 165733 QQDGGQWDMVVALFEKYGVVPKTVYPESVSSSASRELNQYLNKLLRQDAQILRELIAQGA 165912 Query 196 SDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAW 255 A ++ K+++L E + LA LG PP FDF YRD D Y D+ +TP+ F++KYV Sbjct 165913 DGATVQNKKEELLQEIFNFLAMNLGLPPQSFDFAYRDKDNHYQSDKNITPKAFYQKYVNL 166092 Query 256 NLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESV 315 +L DY SIINAPT DKPY YTVEMLGNVVGG V++LNLD+ FK LA+ Q+K+GE+V Sbjct 166093 DLSDYVSIINAPTVDKPYGQSYTVEMLGNVVGGPAVKYLNLDMKRFKELAIAQMKSGETV 166272 Query 316 WFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVD 375 WFGSDVGQ S+RQ GI+ T Y + + + KA RLDY ESLMTHAMVLTGVD+ + Sbjct 166273 WFGSDVGQVSNRQKGILATTTYDFNSSMDIKLSQDKAGRLDYSESLMTHAMVLTGVDLDE 166452 Query 376 -GKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPT 434 G+P KWKVENSWG+KVG GYFVASD+W DE+ YQ+V+ K+ L+ + + E P Sbjct 166453 SGQPLKWKVENSWGEKVGKDGYFVASDAWMDEYTYQIVVRKELLTKEELEAYNAE---PI 166623 Query 435 VLAPWDPMGALAS 447 LAPWDPMGALA+ Sbjct 166624 TLAPWDPMGALAN 166662 >emb|AM406671.1| Download subject sequence spanning the HSP Lactococcus lactis subsp. cremoris MG1363, complete genome Length=2529478 Features in this part of subject sequence: PepC protein Score = 459 bits (1180), Expect = 2e-127 Identities = 230/423 (54%), Positives = 295/423 (69%), Gaps = 10/423 (2%) Frame = -1 Query 25 ALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQ 84 A++ AV NG+ ++ E S A P FS++L V NQKQSGRCWMFAALNT RH Sbjct 2053057 AVENAVTKNGLLSSLEVRGSHAANLPEFSLDLTKDPVTNQKQSGRCWMFAALNTFRHKFI 2052878 Query 85 AQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDM 144 +FK +DFE SQ YTFFWDK+EKSN+F E ++ D +D R++ FL+ TPQQDGGQWDM Sbjct 2052877 NEFKTEDFEFSQAYTFFWDKYEKSNWFMEQII--GDVAMDDRRLKFLLQTPQQDGGQWDM 2052704 Query 145 LSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAK 204 + A+ +KYGIVPK+V PE+ +SS S ELN LN LR+DA LR + D D++A K Sbjct 2052703 MVAIFDKYGIVPKAVYPESQASSSSRELNQYLNKLLRQDAEILRYTIEQ---DGDVQAVK 2052533 Query 205 QKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSII 264 +++L E + LA TLG PP F+F +R+ D +Y TP+ F+ +YV +L++Y S+I Sbjct 2052532 EELLQEVFNFLAVTLGLPPQNFEFAFRNKDNEYK-KFVGTPKEFYNEYVGIDLNNYVSVI 2052356 Query 265 NAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQS 324 NAPT DKPYN YTVE LGNVVGG+EV+HLN+++D FK LA+ Q++AGE+VWFG DVGQ Sbjct 2052355 NAPTADKPYNKSYTVEFLGNVVGGKEVKHLNVEMDRFKKLAIAQMQAGETVWFGCDVGQE 2052176 Query 325 SDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-VDGKPTKWKV 383 S+R G++ + Y + +FT +KA RLDYGESLMTHAMVL GVD+ DG TKWKV Sbjct 2052175 SNRSAGLLTMDSYDFKSSLDIEFTQSKAGRLDYGESLMTHAMVLAGVDLDADGNSTKWKV 2051996 Query 384 ENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVLAPWDPMG 443 ENSWG G KGYFVASD W DE+ YQ+V+ K LS ++ + KP VL PWDPMG Sbjct 2051995 ENSWGKDAGQKGYFVASDEWMDEYTYQIVVRKDLLS---EEELAAYEAKPQVLLPWDPMG 2051825 Query 444 ALA 446 ALA Sbjct 2051824 ALA 2051816 >gb|CP000425.1| Download subject sequence spanning the HSP Lactococcus lactis subsp. cremoris SK11, complete genome Length=2438589 Features in this part of subject sequence: Aminopeptidase C Score = 459 bits (1180), Expect = 2e-127 Identities = 230/423 (54%), Positives = 295/423 (69%), Gaps = 10/423 (2%) Frame = -3 Query 25 ALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQ 84 A++ AV NG+ ++ E S A P FS++L V NQKQSGRCWMFAALNT RH Sbjct 1966033 AVENAVTKNGLLSSLEVRGSHAANLPEFSLDLTKDPVTNQKQSGRCWMFAALNTFRHKFI 1965854 Query 85 AQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDM 144 +FK +DFE SQ YTFFWDK+EKSN+F E ++ D +D R++ FL+ TPQQDGGQWDM Sbjct 1965853 NEFKTEDFEFSQAYTFFWDKYEKSNWFMEQII--GDVAMDDRRLKFLLQTPQQDGGQWDM 1965680 Query 145 LSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAK 204 + A+ +KYGIVPK+V PE+ +SS S ELN LN LR+DA LR + D D++A K Sbjct 1965679 MVAIFDKYGIVPKAVYPESQASSSSRELNQYLNKLLRQDAEILRYTIEQ---DGDVQAVK 1965509 Query 205 QKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSII 264 +++L E + LA TLG PP F+F +R+ D +Y TP+ F+ +YV +L++Y S+I Sbjct 1965508 EELLQEVFNFLAVTLGLPPQNFEFAFRNKDNEYK-KFVGTPKEFYNEYVGIDLNNYVSVI 1965332 Query 265 NAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQS 324 NAPT DKPYN YTVE LGNVVGG+EV+HLN+++D FK LA+ Q++AGE+VWFG DVGQ Sbjct 1965331 NAPTADKPYNKSYTVEFLGNVVGGKEVKHLNVEMDRFKKLAIAQMQAGETVWFGCDVGQE 1965152 Query 325 SDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-VDGKPTKWKV 383 S+R G++ + Y + +FT +KA RLDYGESLMTHAMVL GVD+ DG TKWKV Sbjct 1965151 SNRSAGLLTMDSYDFKSSLDIEFTQSKAGRLDYGESLMTHAMVLAGVDLDADGNSTKWKV 1964972 Query 384 ENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVLAPWDPMG 443 ENSWG G KGYFVASD W DE+ YQ+V+ K LS ++ + KP VL PWDPMG Sbjct 1964971 ENSWGKDAGQKGYFVASDEWMDEYTYQIVVRKDLLS---EEELAAYEAKPQVLLPWDPMG 1964801 Query 444 ALA 446 ALA Sbjct 1964800 ALA 1964792 >gb|M86245.1|LACAPEPC Lactococcus lactis cysteine aminopeptidase (pepC) gene, complete cds Length=2748 Score = 459 bits (1180), Expect = 2e-127 Identities = 230/423 (54%), Positives = 295/423 (69%), Gaps = 10/423 (2%) Frame = +1 Query 25 ALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQ 84 A++ AV NG+ ++ E S A P FS++L V NQKQSGRCWMFAALNT RH Sbjct 784 AVENAVTKNGLLSSLEVRGSHAANLPEFSLDLTKDPVTNQKQSGRCWMFAALNTFRHKFI 963 Query 85 AQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDM 144 +FK +DFE SQ YTFFWDK+EKSN+F E ++ D +D R++ FL+ TPQQDGGQWDM Sbjct 964 NEFKTEDFEFSQAYTFFWDKYEKSNWFMEQII--GDVAMDDRRLKFLLQTPQQDGGQWDM 1137 Query 145 LSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAK 204 + A+ +KYGIVPK+V PE+ +SS S ELN LN LR+DA LR + D D++A K Sbjct 1138 MVAIFDKYGIVPKAVYPESQASSSSRELNQYLNKLLRQDAEILRYTIEQ---DGDVQAVK 1308 Query 205 QKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSII 264 +++L E + LA TLG PP F+F +R+ D +Y TP+ F+ +YV +L++Y S+I Sbjct 1309 EELLQEVFNFLAVTLGLPPQNFEFAFRNKDNEYK-KFVGTPKEFYNEYVGIDLNNYVSVI 1485 Query 265 NAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQS 324 NAPT DKPYN YTVE LGNVVGG+EV+HLN+++D FK LA+ Q++AGE+VWFG DVGQ Sbjct 1486 NAPTADKPYNKSYTVEFLGNVVGGKEVKHLNVEMDRFKKLAIAQMQAGETVWFGCDVGQE 1665 Query 325 SDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-VDGKPTKWKV 383 S+R G++ + Y + +FT +KA RLDYGESLMTHAMVL GVD+ DG TKWKV Sbjct 1666 SNRSAGLLTMDSYDFKSSLDIEFTQSKAGRLDYGESLMTHAMVLAGVDLDADGNSTKWKV 1845 Query 384 ENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVLAPWDPMG 443 ENSWG G KGYFVASD W DE+ YQ+V+ K LS ++ + KP VL PWDPMG Sbjct 1846 ENSWGKDAGQKGYFVASDEWMDEYTYQIVVRKDLLS---EEELAAYEAKPQVLLPWDPMG 2016 Query 444 ALA 446 ALA Sbjct 2017 ALA 2025 >gb|AE006417.1| Gene infoDownload subject sequence spanning the HSP Lactococcus lactis subsp. lactis IL1403 section 179 of 218 of the complete genome Length=10687 Score = 457 bits (1177), Expect = 3e-127 Identities = 230/423 (54%), Positives = 295/423 (69%), Gaps = 10/423 (2%) Frame = -1 Query 25 ALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQ 84 A++ AV NG+ ++ E S A P FSI+L V NQKQSGRCWMFAALNT RH Sbjct 8191 AVENAVTKNGLLSSLEVRGSHAANLPEFSIDLTKDPVTNQKQSGRCWMFAALNTFRHKFI 8012 Query 85 AQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDM 144 +FK +DFE SQ YTFFWDK+EKSN+F E ++ D +D R++ FL+ TPQQDGGQWDM Sbjct 8011 NEFKTEDFEFSQAYTFFWDKYEKSNWFMEQII--GDIEMDDRRLKFLLQTPQQDGGQWDM 7838 Query 145 LSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAK 204 + A+ EKYGIVPK+V PE+ +SS S ELN LN LR+DA LR + D+EA K Sbjct 7837 MVAIFEKYGIVPKAVYPESQASSSSRELNQYLNKLLRQDAEILRYTIEQ---GGDVEAVK 7667 Query 205 QKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSII 264 +++L E + LA TLG PP F+F +R+ D +Y +P+ F+ +YV +L++Y S+I Sbjct 7666 EELLQEVFNFLAVTLGLPPQNFEFAFRNKDNEYK-KFVGSPKEFYNEYVGIDLNNYVSVI 7490 Query 265 NAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQS 324 NAPT DKPYN YTVE LGNVVGG+EV+HLN+++D FK LA+ Q++AGE+VWFG DVGQ Sbjct 7489 NAPTADKPYNKSYTVEFLGNVVGGKEVKHLNVEMDRFKKLAIAQMQAGETVWFGCDVGQE 7310 Query 325 SDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-VDGKPTKWKV 383 S+R G++ + Y + +FT +KA RLDYGESLMTHAMVL GVD+ DG TKWKV Sbjct 7309 SNRSAGLLTMDSYDFKSSLDIEFTQSKAGRLDYGESLMTHAMVLAGVDLDADGNSTKWKV 7130 Query 384 ENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVLAPWDPMG 443 ENSWG G KGYFVASD W DE+ YQ+V+ K L+ ++ + +KP VL PWDPMG Sbjct 7129 ENSWGKDAGQKGYFVASDEWMDEYTYQIVVRKDLLT---EEELAAYEEKPQVLLPWDPMG 6959 Query 444 ALA 446 ALA Sbjct 6958 ALA 6950 >emb|AL935262.1| Download subject sequence spanning the HSP Lactobacillus plantarum strain WCFS1 complete genome; segment 11/11 Length=304274 Features in this part of subject sequence: cysteine aminopeptidase Score = 439 bits (1130), Expect = 1e-121 Identities = 208/442 (47%), Positives = 299/442 (67%), Gaps = 5/442 (1%) Frame = -2 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M+ E+T LA + A L +A+ NGI A + + + + TFS+EL TG Sbjct 288442 MATELTPDALAALRTTHAQDRMAPVLTRAITKNGIEAASFDNQAASRLARTFSVELPTGK 288263 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V+NQK SGRCW F+ LNT+RH ++ +KDFELSQNY FFWDK E++N FY NV +TA Sbjct 288262 VSNQKHSGRCWEFSLLNTLRHKFATRYHVKDFELSQNYLFFWDKIERANIFYRNVEQTAR 288083 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 QP+D R V FL P +DGGQW M ++L++KYG+VP SVMPE++++ ++ L+ +L Sbjct 288082 QPIDDRLVQFLFANPGEDGGQWAMAASLVQKYGVVPASVMPESFNTDNTTAFQASLSRQL 287903 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKD + LR+LV D AS+A++++ ++ ML YR+ AY+ G PPT FD EYRDD++ YH Sbjct 287902 RKDGLKLRQLVMDGASEAELQSLEKSMLQTVYRMTAYSFGEPPTSFDLEYRDDEQHYHRT 287723 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 LTPQ F++ Y +LDDY + N+P DKP+N LY++ NV+GG+ + LNLD+ Sbjct 287722 ANLTPQQFYQDYFETDLDDYVVVTNSP--DKPFNRLYSLPDEDNVIGGKPIEFLNLDMGV 287549 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 +AV+QL+AGE+VWFG+DV + DR+ G +D ++++ LF T+ +TKA+RL GE Sbjct 287548 LTDVAVQQLQAGETVWFGNDVLRQMDRKTGYLDAHLFETGKLFGTNDHLTKAQRLLTGEG 287369 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 ++HAM LTGVD+V PTKWKVENSWG++VGD+GYFV S WF+E+VY+VV+ K +L+ Sbjct 287368 EVSHAMTLTGVDLVADTPTKWKVENSWGEQVGDQGYFVMSQDWFNEYVYEVVVHKHFLAP 287189 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 + Q ++ + L WDP+ Sbjct 287188 EFQALLNERAQR---LPAWDPL 287132 >gb|AY365130.1| Lactobacillus helveticus CNRZ32 endopeptidase E2 (pepE2) gene, complete cds Length=2320 Score = 426 bits (1094), Expect = 1e-117 Identities = 204/442 (46%), Positives = 289/442 (65%), Gaps = 6/442 (1%) Frame = +3 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M E+T ++A+F+Q+ + P + AV+NNG+ + NT+ + TFSIE+ T + Sbjct 504 MKHELTMAEIAKFQQEYKKEPQNRVAELAVVNNGVQKASFNTEGIRKLNRTFSIEIPTDN 683 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V +QKQSGRCW+FAALNT+RHG ++ K+F SQNY FFWD+ E++N F++N+L TAD Sbjct 684 VTDQKQSGRCWLFAALNTLRHGFAKKYNTKNFTFSQNYLFFWDRVERANIFFDNILNTAD 863 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PL R V M P DGGQW M +LI KYG+VP E+++++ ++ N LN+KL Sbjct 864 KPLGDRTVHTYMQGPDADGGQWAMAVSLIRKYGLVPTYAQEESFTANNTAAFNRALNMKL 1043 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 R+D + LRKL + +D +IE +Q+ L+E YR+ G P KFD E++DDD +YH D Sbjct 1044 REDGLILRKLAKENKTD-EIETKRQEFLSEVYRMAVIAFGEPVQKFDLEFKDDDGKYHFD 1220 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 +LTP FF Y +LDDY + NAP D ++ LY + NV GG V+ LN +ID Sbjct 1221 GDLTPLDFFHNYFTDDLDDYIVLFNAP--DHEFDKLYALPFEDNVEGGTPVQFLNTEIDN 1394 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 K A+KQL+AGE++WFG DVG+ SDRQ GI+ +Y+ D +FN + ++K ERL G S Sbjct 1395 LKEAAIKQLEAGETIWFGCDVGKDSDRQKGILSKGLYQTDTIFNIETKLSKKERLQTGAS 1574 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 THAM L GVD+VDGKP +WK+ENSWG KVG+KGYFV D WF+E++++VV+ K+Y+ Sbjct 1575 GSTHAMTLVGVDVVDGKPRQWKIENSWGAKVGEKGYFVMDDDWFNEYLFKVVVKKQYVPD 1754 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 L + + E T + WD M Sbjct 1755 KLVKIWEGE---ATPVEAWDSM 1811 >emb|Z71782.1|LDPEPGW L.delbrueckii pepG and pepW genes and unknown orf Length=3375 Score = 412 bits (1058), Expect = 2e-113 Identities = 206/442 (46%), Positives = 287/442 (64%), Gaps = 6/442 (1%) Frame = +1 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 MS E+T +LA+F + A P + +A +G+ + N +T FS EL T + Sbjct 1837 MSHELTLQELAEFSANFNADPKNQVIARAAARSGVLEASYNERVAGRLTRVFSTELPTDN 2016 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQKQSGRCW+F+ LN +RH A+ K K+F LSQ+Y FFWDK E++N FYE V++TAD Sbjct 2017 VTNQKQSGRCWLFSTLNVLRHDFGAKHKAKNFTLSQSYNFFWDKLERANLFYEKVIETAD 2196 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PLD R+V DGGQW M +L++KYG+VP VMPE++++S ++ L L K Sbjct 2197 KPLDDREVRSYFDFAGHDGGQWHMAISLVKKYGVVPSYVMPESFNTSATNGLASALADKE 2376 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKDA+ALR+L A +E A++ L E YR++A +G PP FD EYRDDDK YH++ Sbjct 2377 RKDALALRRL-AQAGDQEGLEKARKTFLNEIYRMVAIAVGEPPKTFDLEYRDDDKNYHLE 2553 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + LTP +FF KY +LDDY + NAP D Y LY + NV GG + LN+ ++ Sbjct 2554 KNLTPVSFFNKYFDVDLDDYVVLTNAP--DHEYGKLYHLGAEDNVEGGSPILFLNVPMEY 2727 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 + AV QLK GE+VWFG+DV + DR+ G +DT++YK +DLF+ D +++KA+RL G Sbjct 2728 LEQTAVAQLKDGEAVWFGNDVLRQMDRKTGYLDTDLYKLEDLFDVDLSLSKADRLATGAG 2907 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 ++HAM L GVD G +WKVENSWGDK G+KG+FV S +WF E+VY+VV+ KKYL+ Sbjct 2908 EVSHAMTLVGVDEDKGDIRQWKVENSWGDKSGEKGFFVMSHNWFKEYVYEVVVHKKYLTK 3087 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 D Q+++ + P LAPWD + Sbjct 3088 DQQELLSS---TPVELAPWDSL 3144 Score = 389 bits (1000), Expect = 1e-106 Identities = 195/442 (44%), Positives = 276/442 (62%), Gaps = 6/442 (1%) Frame = +3 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M+ E++ L F +D A P + +A +G+ A N + TFSIELDT + Sbjct 471 MTHELSPQLLESFSRDFNADPKNQVISRAARRSGLLEAAYNPAVSQRLNRTFSIELDTDN 650 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQ+QSGRCW+F+ LN +RH K K+F SQ+Y FFWDK E++NYFY+ ++ TAD Sbjct 651 VTNQQQSGRCWLFSTLNVVRHNFGKANKAKNFTFSQSYNFFWDKIERANYFYDRIIATAD 830 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 +PL R V Q DGGQW M ++LI KYG+VP+ MPE+++S+ S L+ +L K Sbjct 831 RPLTDRTVRGYFDWCQTDGGQWHMAASLIAKYGVVPRYAMPESFNSNHSQALDMVLADKE 1010 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 RKDA+ LR+L A +EAA+ L++ YRI+A LG PP FD E+RDDDK YH+D Sbjct 1011 RKDALTLRRL-AQADDQEKLEAARTDFLSQIYRIMATALGEPPKTFDLEFRDDDKNYHLD 1187 Query 241 RELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDT 300 + LTP F+KKY A +LDDY + NAP D N + + N+ GG +N+ ++ Sbjct 1188 KGLTPVQFYKKYCATDLDDYVVLANAP--DHEMNRVLHLGFEDNIKGGYPNLFINVPMEY 1361 Query 301 FKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGES 360 + A+ QLK GE+VWFG+ VG+ DR+ G MD ++Y+ D L + D ++KA+RL G Sbjct 1362 LEDAAIAQLKDGEAVWFGNAVGRQMDRKTGFMDLDLYQLDQLLDIDSHLSKADRLATGIG 1541 Query 361 LMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 +H M L GVD+ G+ +WKVENSWGDK G+KGYF S WF E+ Y+V + KK++ A Sbjct 1542 ESSHDMALVGVDVDGGQVRQWKVENSWGDKSGEKGYFTMSADWFREYTYEVAVQKKHVPA 1721 Query 421 DLQDVIKNEYDKPTVLAPWDPM 442 ++ D++KN+ P L PWD + Sbjct 1722 EILDLLKNQ---PIELDPWDSL 1778 >gb|AE000520.1| Download subject sequence spanning the HSP Treponema pallidum subsp. pallidum str. Nichols complete genome Length=1138011 Features in this part of subject sequence: aminopeptidase C (pepC) Score = 405 bits (1040), Expect = 3e-111 Identities = 209/439 (47%), Positives = 269/439 (61%), Gaps = 6/439 (1%) Frame = -1 Query 10 LAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGR 69 L F ++ A P A+ AV G+ A NT+ T FS E G + NQK SGR Sbjct 129729 LDTFAHEVAADPIHKAVAGAVARVGLEEAALNTEVARQHTHIFSTETKRGEMTNQKMSGR 129550 Query 70 CWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVA 129 CW+FAALN R + I+ E SQNY FFWDK EK+N+F EN+L+T D+PL SR +A Sbjct 129549 CWIFAALNAARVNTMKKLDIETVEFSQNYLFFWDKLEKANFFLENILETLDEPLTSRLMA 129370 Query 130 FLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRK 189 L+ P QDGGQWDM S L+EKYG+VPK MPET+ SS S L +L +LRK A LR Sbjct 129369 HLLANPVQDGGQWDMFSGLLEKYGLVPKECMPETFHSSNSRVLLAVLTRRLRKHAQLLRS 129190 Query 190 LVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFF 249 + + + K+ L+ Y IL LG PP KFDF Y+D +K++H R+LTPQ FF Sbjct 129189 AHEEGVALHTLREKKEAFLSSIYSILVKALGRPPEKFDFVYKDKEKKFHKVRDLTPQKFF 129010 Query 250 KKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQL 309 +V W+L + S+I+APT DKP+ YTV+ LG V + ++N I+ K + Sbjct 129009 CDFVGWDLKNKVSLIHAPTADKPFGRAYTVKFLGTVKEAPCICYVNTPIEVLKEATASAI 128830 Query 310 KAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLT 369 +AGE VWFG DVGQ R+ GIMDT I+ + + T KAERLDYGESL+THAMV+T Sbjct 128829 RAGEPVWFGCDVGQMMTRKDGIMDTEIFGYESMLGTTPEFNKAERLDYGESLLTHAMVIT 128650 Query 370 GVD-IVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKN 428 G D G P +W+VENSWGD G KG F SD WFDE++YQ+ I KK++ D + Sbjct 128649 GFDEDAQGNPVRWQVENSWGDDTGKKGMFSMSDRWFDEYLYQITIDKKFVPQVWLDAL-- 128476 Query 429 EYDKPTV-LAPWDPMGALA 446 +KP + L PWDPMGALA Sbjct 128475 --EKPIIALEPWDPMGALA 128425 >gb|U77050.1|LHU77050 Lactobacillus helveticus endopeptidase gene, complete cds Length=1680 Score = 392 bits (1007), Expect = 2e-107 Identities = 195/443 (44%), Positives = 282/443 (63%), Gaps = 7/443 (1%) Frame = +2 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M+ E+T +L +F D P + +A +G+ + N + +T FS ELDT + Sbjct 152 MAHELTVQELEKFSADFNKNPKNKVVARAAQRSGVLEASYNDRVQSELTRVFSTELDTDN 331 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQK SGRCW+FA LN +RH ++K KDF SQ Y FFWDK E++N FY +L +AD Sbjct 332 VTNQKHSGRCWLFATLNVLRHEFGKKYKAKDFTFSQAYNFFWDKIERANMFYNRILDSAD 511 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 PLDSR+V + DGGQ+ M +AL+EKYG+VP MPET++++ ++ L KL Sbjct 512 MPLDSRQVKTDLDFAGTDGGQFQMAAALVEKYGVVPSYAMPETFNTNDTTGFATALGDKL 691 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 +KDA+ LRKL + D +I+ ++K L+E Y++ A +G PP KFD EYRDDDK+YH++ Sbjct 692 KKDALVLRKL-KQEGKDDEIKKTREKFLSEVYQMTAIAVGEPPKKFDLEYRDDDKKYHLE 868 Query 241 RELTPQTFFKKYVAW-NLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDID 299 ++LTP F KY+ + DDY + NAP D Y+ LY + NV G ++ LN+ ++ Sbjct 869 KDLTPLEFLHKYLGGVDFDDYVVLTNAP--DHEYDKLYGLPAEDNVSGSIRIKLLNVPME 1042 Query 300 TFKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGE 359 A ++ QLK GE+VWFG+DV + DR+ G +DTN+YK DDLF D M+KA+RL G Sbjct 1043 YLTAASIAQLKDGEAVWFGNDVLRQMDRKTGYLDTNLYKLDDLFGVDLKMSKADRLKTGV 1222 Query 360 SLMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLS 419 ++HAM L GVD +G+ +WKVENSWGDK G KGY+V ++ WF+++VY+VV+ KKYL+ Sbjct 1223 GEVSHAMTLVGVDEDNGEVRQWKVENSWGDKSGAKGYYVMNNEWFNDYVYEVVVHKKYLT 1402 Query 420 ADLQDVIKNEYDKPTVLAPWDPM 442 +++ + T L WD + Sbjct 1403 DKQKELAEGPI---TDLPAWDSL 1462 >gb|DQ221762.1| Lactobacillus helveticus strain WSU19 endopeptidase E (pepE) gene, complete cds Length=2702 Score = 392 bits (1006), Expect = 2e-107 Identities = 198/444 (44%), Positives = 282/444 (63%), Gaps = 9/444 (2%) Frame = +3 Query 1 MSAEITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGS 60 M+ E+T +L +F D P + +A +G+ + N + +T FS ELDT + Sbjct 921 MAHELTVQELEKFSADFNKNPKNKVVARAAQRSGVLEASYNDRVQSELTRVFSTELDTDN 1100 Query 61 VANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTAD 120 V NQK SGRCW+FA LN +RH ++K KDF SQ Y FFWDK E++N FY +L +AD Sbjct 1101 VTNQKHSGRCWLFATLNVLRHEFGKKYKAKDFTFSQAYNFFWDKIERANMFYNRILDSAD 1280 Query 121 QPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKL 180 PLDSR+V + DGGQ+ M +AL+EKYG+VP MPET++++ ++ L KL Sbjct 1281 MPLDSRQVKTDLDFAGTDGGQFQMAAALVEKYGVVPSYAMPETFNTNNTTGFATALGDKL 1460 Query 181 RKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHID 240 +KDA+ LRKL + D +I+ ++K L+E Y++ A +G PP KFD EYRDDDK+YH++ Sbjct 1461 KKDALVLRKL-KQEGKDDEIKKTREKFLSEVYQMTAIAVGEPPKKFDLEYRDDDKKYHLE 1637 Query 241 RELTPQTFFKKYVAW-NLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDID 299 ++LTP F KY+ + DDY + NAP D Y+ LY + NV G ++ LN+ ++ Sbjct 1638 KDLTPLEFLHKYLGGVDFDDYVVLTNAP--DHEYDKLYGLPAEDNVSGSIRIKLLNVPME 1811 Query 300 TFKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGE 359 A ++ QLK GE+VWFG+DV + DR+ G +DTN+YK DDLF D M+KA+RL G Sbjct 1812 YLTAASIAQLKDGEAVWFGNDVLRQMDRKTGYLDTNLYKLDDLFGVDLKMSKADRLKTGV 1991 Query 360 SLMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLS 419 ++HAM L GVD +G+ +WKVENSWGDK G KGY+V ++ WF+++VY+VV+ KKYL+ Sbjct 1992 GEVSHAMTLVGVDEDNGEVRQWKVENSWGDKSGAKGYYVMNNEWFNDYVYEVVVHKKYLT 2171 Query 420 ADLQDVIKNEYDKP-TVLAPWDPM 442 D K + P T L WD + Sbjct 2172 ----DKQKKLAEGPITDLPAWDSL 2231 >gb|EF015485.1| Streptococcus infantarius subsp. infantarius putative aminopeptidase C (pepC) gene, partial cds Length=921 Score = 385 bits (990), Expect = 2e-105 Identities = 188/307 (61%), Positives = 227/307 (73%), Gaps = 0/307 (0%) Frame = +1 Query 65 KQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLD 124 K SGRCWMFAALNT RH + + +++FELSQ +TFFWDK+EKSN+F E V+ TADQ L Sbjct 1 KASGRCWMFAALNTFRHKMISDLNLENFELSQAHTFFWDKYEKSNWFLEQVIATADQELG 180 Query 125 SRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDA 184 SRKV FL+ PQQDGGQWDM+ AL EKYG+VPK+ PE+ SSS S ELN LN LR+DA Sbjct 181 SRKVKFLLDVPQQDGGQWDMVVALFEKYGVVPKAAYPESISSSNSRELNQYLNKLLRQDA 360 Query 185 VALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELT 244 LR+ +A A D ++ K+ L E + LA LG PP FDF YRD D YH D+ +T Sbjct 361 QILREAIAAGADDKAVQTKKEAFLQEVFNFLAINLGLPPRTFDFAYRDKDNNYHSDKNIT 540 Query 245 PQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKAL 304 PQ FFKKYV +L +Y S+INAPT DKPY YTVEMLGNVVG R+VR++NLD++ FK L Sbjct 541 PQEFFKKYVGLDLSEYVSVINAPTADKPYGKSYTVEMLGNVVGSRDVRYINLDMERFKEL 720 Query 305 AVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTH 364 A+ Q++AGE+VWFGSDVGQ SDRQ GIM TN+Y + + +FT KA RLDY ESLMTH Sbjct 721 AIAQMQAGETVWFGSDVGQISDRQKGIMATNVYDFETAMDINFTQDKAGRLDYSESLMTH 900 Query 365 AMVLTGV 371 AMVLTGV Sbjct 901 AMVLTGV 921 >gb|AY665598.1| Lactobacillus helveticus peptidase (pepCE) gene, complete cds Length=1314 Score = 376 bits (966), Expect = 1e-102 Identities = 193/441 (43%), Positives = 275/441 (62%), Gaps = 9/441 (2%) Frame = +1 Query 5 ITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQ 64 I+ ++A F D + +AV +G+ + N + FS ELD G V +Q Sbjct 10 ISEQEIAGFSADFNSNEKNKVASRAVRRSGLYEASFNDRVSERLNHVFSTELDVGGVTDQ 189 Query 65 KQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLD 124 K SGRCW FA LN +RH + K+K+F SQ Y FFWDK E++N FY ++K AD+P++ Sbjct 190 KHSGRCWEFATLNVLRHYFCKKNKVKNFTFSQAYNFFWDKIERANAFYNAMIKLADKPIN 369 Query 125 SRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDA 184 R+V + QDGG W M L++KYG+VP MPE+++S+ ++ L L K RKDA Sbjct 370 DREVQSWLEFAGQDGGLWSMAINLVKKYGVVPSYAMPESFNSNNTTALIDSLARKERKDA 549 Query 185 VALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELT 244 + LRKLV + D ++EAAK+K L E YR++A LG PP KFD EYRDDDK+YH++++LT Sbjct 550 LLLRKLVNEGKQD-ELEAAKKKCLGEVYRMVAVALGEPPKKFDLEYRDDDKKYHLEKDLT 726 Query 245 PQTFFKKYVA-WNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKA 303 PQ F +KY + DDY + N P + +N LY + + NV GG +++ LN+ I+ Sbjct 727 PQAFVQKYFKDFKFDDYVVLSNCP--NHAFNKLYHMPLYDNVEGGYQIKFLNVPIEYLAN 900 Query 304 LAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMT 363 AV QLKAG++V FG+DV + +R+ G +DT +YK D+LF D M+KA+RL+ GE T Sbjct 901 AAVAQLKAGDAVIFGNDVLKQMERKTGYLDTELYKTDELFGVDTKMSKADRLNTGEGFAT 1080 Query 364 HAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQ 423 H M L GVD G KWKVENSWGDK G KG++ S WF+++VY VV+ K++L+ + Sbjct 1081 HDMTLVGVDEDHGHIRKWKVENSWGDKFGHKGFYEMSQPWFEDYVYDVVVRKEFLTKEQV 1260 Query 424 DVIKNEYDKPTV-LAPWDPMG 443 ++ + P V L PWD +G Sbjct 1261 ELAEG----PAVDLKPWDNIG 1311 >dbj|AP009256.1| Download subject sequence spanning the HSP Bifidobacterium adolescentis ATCC 15703 DNA, complete genome Length=2089645 Features in this part of subject sequence: aminopeptidase C Score = 347 bits (890), Expect = 6e-94 Identities = 184/457 (40%), Positives = 260/457 (56%), Gaps = 27/457 (5%) Frame = -2 Query 10 LAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGR 69 LAQ+ +D A A +++G+ A + + A+ FSIEL GS+ NQ++SGR Sbjct 1202403 LAQYAKDFNADRANLVAANAAVSSGVLEAATDYKGQRALPRDFSIELKQGSITNQRRSGR 1202224 Query 70 CWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVA 129 CWMFA+LNT+R+ + Q+ + DFE S+ Y FFWD EKSN + ENV T D+P DSR Sbjct 1202223 CWMFASLNTLRYELMHQWGLDDFEFSETYLFFWDAMEKSNTYLENVFATLDEPTDSRLFQ 1202044 Query 130 FLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRK 189 + P DGG W M +AL++KYG+VPKS PE+ +S S LN +LR+ A LR+ Sbjct 1202043 EINYGPADDGGWWQMFAALVDKYGLVPKSAYPESANSKDSDAFKQYLNSRLRQFAADLRE 1201864 Query 190 LVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYR--DDDK-------QYHID 240 A A+ ++ A K ++ YR+ A +LG PP KFDF R DDDK + D Sbjct 1201863 RYAAGATVDELRAVKDDDMSTVYRMCAISLGEPPEKFDFLARVSDDDKKDDKKSGEDEAD 1201684 Query 241 RE--------------LTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVV 286 + +TP F+KKYV ++DD ++ N P +P+N Y + NV Sbjct 1201683 KPKTGKDERRQIRETGITPMEFYKKYVPVDVDDLVTLCNVPMASRPFNKRYRIRYTANVA 1201504 Query 287 GGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTD 346 ++ +N+ +D FK AV Q+ AG +WF D Q S R G D + + D LF TD Sbjct 1201503 EAGDMEFVNVPLDVFKKAAVDQISAGHPIWFACDCTQFSLRAAGYFDCDSVRVDQLFGTD 1201324 Query 347 FTMTKAERLDYGESLMTHAMVLTGVDIVD-GKPTKWKVENSWGDKVGDKGYFVASDSWFD 405 F KA L+YG+S HAM LTGV++ + GKP +WKVENSWG G+ GY+VASD WFD Sbjct 1201323 FDFDKAHGLEYGDSPSNHAMTLTGVNLDEQGKPNRWKVENSWGKDNGEDGYYVASDKWFD 1201144 Query 406 EFVYQVVISKKYLSADLQDVIKNEYDKPTVLAPWDPM 442 +V +++I K+YL + +++ E P L PW P+ Sbjct 1201143 RYVTEIIIRKEYLDDATRALLETE---PVELDPWQPL 1201042 Features in this part of subject sequence: aminopeptidase C Score = 307 bits (786), Expect = 7e-82 Identities = 173/445 (38%), Positives = 253/445 (56%), Gaps = 17/445 (3%) Frame = +2 Query 9 DLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSG 68 +L + D +A+ AV GI+ A N D M FS +D G+V +Q +SG Sbjct 362087 ELNKLVDDFEASEHNRMAMNAVTTAGIDKVARNYDRARLMQRRFSTVVDNGTVTHQDRSG 362266 Query 69 RCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLK--TADQPLDSR 126 RCW+F++LN R + +K+FE SQNY ++DK E+ NYF ++V K A +P DSR Sbjct 362267 RCWLFSSLNVARFVAKQNMGLKEFEFSQNYAMYYDKLERVNYFLKDVAKLVRAGEPADSR 362446 Query 127 KVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVA 186 + L++ DGGQW M + +KYG VPK + PET SS + E+N L L A Sbjct 362447 LMQHLLSDVMGDGGQWTMAMNVYKKYGAVPKDLFPETESSRNTGEMNVQLRRMLH---TA 362617 Query 187 LRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQ 246 + + AD ++ I+A +A +RIL LG PP FD+E+ D D ++H D E+TP Sbjct 362618 VAHMYADPSA---IDAIIADAVAAGHRILTIHLGEPPKSFDWEWTDKDGEFHRDGEITPV 362788 Query 247 TFFKKYV-AWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALA 305 F+KKYV + +L+ Y +++ P + +E LGNV GG +LN+ + F Sbjct 362789 EFWKKYVGSADLESYVCLVDDPRQEHVKGKKIGIEHLGNVAGGDPTEYLNVP-NQFMKDC 362965 Query 306 VKQL--KAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMT 363 V+Q+ + G VWFG+D DR+ G T++++ ++ DF + K +R+ +G+S M Sbjct 362966 VRQILQEQGIPVWFGADCHPMMDRENGAWATDLFEYGRVYGVDFDLDKEQRVRFGDSAMN 363145 Query 364 HAMVLTGVDI-VDGKPT-KWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSAD 421 HAM GVD+ DG T +W+VENSWGDK+ DKGYF SD WF E+VY+V + K L A Sbjct 363146 HAMAFVGVDVDEDGHTTRRWRVENSWGDKIADKGYFTMSDDWFTEYVYEVAVPKVLLPA- 363322 Query 422 LQDVIKNEYDKPTVLAPWDPMGALA 446 + +K + T+L WDPMGALA Sbjct 363323 --EYLKALEEPATMLPAWDPMGALA 363391 >gb|AE014295.3| Download subject sequence spanning the HSP Bifidobacterium longum NCC2705, complete genome Length=2256640 Features in this part of subject sequence: aminopeptidase C Score = 330 bits (847), Expect = 6e-89 Identities = 176/473 (37%), Positives = 256/473 (54%), Gaps = 62/473 (13%) Frame = -2 Query 29 AVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQAQFK 88 A ++ G+ A + A+ FSIEL GS+ NQ++SGRCWMFA+LNT+R+ + ++ Sbjct 1778307 AAVSAGVLKAATDYRGVRALPRDFSIELKQGSITNQERSGRCWMFASLNTLRYELMHRWN 1778128 Query 89 IKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDMLSAL 148 ++DFE S+ Y FFWD EKSN + ENVL+T D+ DSR + +P DGG W M +AL Sbjct 1778127 LEDFEFSETYLFFWDAMEKSNTYLENVLRTLDEATDSRLFEAINESPADDGGWWQMFAAL 1777948 Query 149 IEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAKQKML 208 + KYG+VPKS PE+ +S S + LN KLR+ A LR+ AS+ ++ A K + + Sbjct 1777947 VNKYGLVPKSAYPESENSRNSDDFKQYLNSKLREFAAELRRRSVAGASEDELRALKDEYM 1777768 Query 209 AEDYRILAYTLGNPPTKFDF---------------------------------------E 229 YRI A LG PP KFDF E Sbjct 1777767 GTVYRICAVALGEPPEKFDFFARPKDDDEDKKGEACKCKAEADADGKAESCKCGESCKCE 1777588 Query 230 YRDDDKQYHIDRE-------------------LTPQTFFKKYVAWNLDDYQSIINAPTDD 270 + D K D++ +TP F+KKYV +++D+ ++ NAP + Sbjct 1777587 GKSDAKACKCDKDKSDKPKTGKDERPQIREIGITPLEFYKKYVPVDVNDFVTLANAPLKN 1777408 Query 271 KPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQSSDRQLG 330 +P+N Y + NV ++ +N+ +D FK A+ QL AG +WF D Q + R+ G Sbjct 1777407 RPFNQRYRIRFSANVAEAGDMEFVNVPLDVFKKAALDQLTAGHPIWFACDCTQFALRKDG 1777228 Query 331 IMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDI-VDGKPTKWKVENSWGD 389 D ++ + D LF T+FT KA L+YG+S HAM TGV++ DGKP +WKVENSWG Sbjct 1777227 FFDQSVVRVDQLFGTEFTGDKAHGLEYGDSPSNHAMTFTGVNLGEDGKPNRWKVENSWGK 1777048 Query 390 KVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVLAPWDPM 442 G+ GY+V SD+WFD +V +++I K+YL + ++ E P L PW P+ Sbjct 1777047 DAGEDGYYVMSDAWFDRYVTELIIRKEYLDDATRALLTTE---PVELDPWQPL 1776898 Features in this part of subject sequence: aminopeptidase C Score = 304 bits (779), Expect = 5e-81 Identities = 167/424 (39%), Positives = 238/424 (56%), Gaps = 13/424 (3%) Frame = -1 Query 29 AVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQAQFK 88 AV GI+ A N D M FS +D G +Q +SGRCW+F++LN R + Sbjct 1249324 AVTAAGIDKVARNYDRARLMQRRFSTIVDNGEATHQDRSGRCWLFSSLNVARFVAKKNMN 1249145 Query 89 IKDFELSQNYTFFWDKFEKSNYFYENV--LKTADQPLDSRKVAFLMTTPQQDGGQWDMLS 146 +K+FE SQNY ++DK E+ NYF ++V L A +P DSR + L+ DGGQW M Sbjct 1249144 LKEFEFSQNYAMYYDKLERVNYFLKDVAALVAAGEPSDSRLMQHLLADVMGDGGQWTMAM 1248965 Query 147 ALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAKQK 206 + +KYG VPK + PET SS + E+N L L A+ + A + +EA Sbjct 1248964 NVYKKYGAVPKDLFPETESSKNTGEMNIQLRHMLH---TAVAHMYAADGDASKVEAIIAD 1248794 Query 207 MLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVA-WNLDDYQSIIN 265 A +RIL LG PP FD+E+ D D ++H D E+TP F+KKYV +L+DY +++ Sbjct 1248793 ATAAGHRILTIHLGEPPVSFDWEWTDKDGEFHRDGEITPVEFWKKYVGPADLEDYVCLVD 1248614 Query 266 APTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQL--KAGESVWFGSDVGQ 323 P + +E LGNV GG +LN+ + F VKQ+ + G VWFG+D Sbjct 1248613 DPRTEHAKGKKIGIEHLGNVAGGDATEYLNVP-NQFMKDCVKQILVEQGIPVWFGADCHP 1248437 Query 324 SSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIV-DGKPTKWK 382 DR+ G T++++ +++ DF + K R+ +G+S M HAM GVD+ DG +W+ Sbjct 1248436 FMDRENGAWATDLFEYGRVYDVDFDLDKEARVRFGDSAMNHAMAFAGVDVADDGTTRRWR 1248257 Query 383 VENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKNEYDKPTVLAPWDPM 442 VENSWG K+ DKGYF SD WF E+VY+V + K L + Q ++ + T+L WDPM Sbjct 1248256 VENSWGAKIADKGYFTMSDDWFTEYVYEVAVPKALLPEEYQKALE---EPATMLPAWDPM 1248086 Query 443 GALA 446 GALA Sbjct 1248085 GALA 1248074 >emb|CR626927.1| Download subject sequence spanning the HSP Bacteroides fragilis NCTC 9343, complete genome Length=5205140 Features in this part of subject sequence: putative aminopeptidase Score = 314 bits (804), Expect = 6e-84 Identities = 166/436 (38%), Positives = 248/436 (56%), Gaps = 6/436 (1%) Frame = +1 Query 10 LAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGR 69 L Q KQ Q T A++ A+ NN I A N D+ M FSI++D+ + +QK SGR Sbjct 2415241 LNQIKQSYQGTTTDKAIRNAIGNNDIRKLALNQDNLKGMDTHFSIKVDSKGITDQKSSGR 2415420 Query 70 CWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVA 129 CW+F LN MR A++ + FE SQNY FFWD+ EK+N F + V+ T ++P+D + V Sbjct 2415421 CWLFTGLNVMRAKAIARYGLGSFEFSQNYNFFWDQLEKANLFLQGVIDTREKPMDDKMVE 2415600 Query 130 FLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRK 189 +L P DGG + ++ ++ KYG+VPK VMPET SS +S + GL+ KLR+ + LR Sbjct 2415601 WLFRNPLSDGGTFTGVADIVSKYGLVPKEVMPETNSSENTSRMAGLIAEKLREYGLQLRD 2415780 Query 190 LVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFF 249 A A +E K +ML YR+L LG PPT+F + +D+ + TP +F Sbjct 2415781 RAAKGAKQPALEKDKTEMLGTVYRMLVLNLGIPPTEFTWTRKDEKGNPVETAQYTPMSFL 2415960 Query 250 KKYVAWN-LDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQ 308 +KY N LD+Y ++N P+ + Y Y ++ + GR ++NL D K +A+ Sbjct 2415961 EKYGDKNLLDNYVMLMNDPS--REYYKCYEIDFDRHRYDGRNWTYVNLPADEIKEMAIAS 2416134 Query 309 LKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVL 368 LK ++F DVG+ + + G++D N Y L T F M K +R+ S +HAM L Sbjct 2416135 LKDSTMMYFSCDVGKFLNSERGLLDVNNYDYASLMGTTFGMDKKQRVQTFASGSSHAMTL 2416314 Query 369 TGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKN 428 VD+ D KP KW VENSWG G +G+ + +D WFDE+++++V+ KK+ + + +++K Sbjct 2416315 MAVDVKDNKPVKWMVENSWGATNGYQGHLIMTDEWFDEYMFRLVVEKKFATPKVLEILK- 2416491 Query 429 EYDKPTVLAPWDPMGA 444 KP L WDPM A Sbjct 2416492 --QKPIRLPAWDPMFA 2416533 Features in this part of subject sequence: putative exported protein Score = 58.2 bits (139), Expect = 8e-07 Identities = 90/416 (21%), Positives = 159/416 (38%), Gaps = 71/416 (17%) Frame = +1 Query 35 INATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQAQFKIKDFEL 94 ++A A++ + T E S+ NQ +S CW F++L + + K +++L Sbjct 3749977 LSALAQDKPQEEGFVFTTVKENPITSIKNQNRSSTCWSFSSLGFLESELLRTGK-GEYDL 3750153 Query 95 SQNYTFFWDKFEKS-NYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYG 153 S+ + +++ NY V + + GG + + ++ YG Sbjct 3750154 SEMFVVHHTMVDRAVNY-----------------VRYHGDSSFSPGGSFYDIMFCMKNYG 3750282 Query 154 IVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAKQKMLAEDYR 213 +VP+ MP N +L A A +A K + + +K L Y Sbjct 3750283 LVPQDAMPGIMYGDSLPVHN-----ELDATAGAYVNAIA-KGNLKKLTPVWKKGLCAIYD 3750444 Query 214 ILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSIINAPTDDKPY 273 LG P KF ++ +E TP TF + + N DDY S+ + P+ Sbjct 3750445 TY---LGQCPEKFTYK----------GKEYTPMTFAQS-LGLNPDDYVSLTSYT--HHPF 3750576 Query 274 NHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQSSDRQLGI-M 332 + +E+ N G NL +D F A+ +K G + +GSDV + + GI + Sbjct 3750577 YSQFAIEIQDNWRNGLSY---NLPLDEFMAVMDNAVKNGYTFAWGSDVSEEGFTRDGIAV 3750747 Query 333 DTNIYKKDDLFNTDFT----MTKAER----------------------LDYGESLMTHAM 366 + K +L +D MT A++ D E+ H M Sbjct 3750748 VPDAAKGAELTGSDMARWTGMTAADKRKELTSKPLPEMKITQEMRQTAFDNWETTDDHGM 3750927 Query 367 VLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADL 422 ++ G+ + V+NSWG KG + AS ++ +++ K L D+ Sbjct 3750928 IIYGIAKDQNGKEYFMVKNSWGTNNKYKGTWYASKAFVAYKTMNILVHKDALPKDI 3751095 >dbj|AP006841.1| Download subject sequence spanning the HSP Bacteroides fragilis YCH46 DNA, complete genome Length=5277274 Features in this part of subject sequence: putative aminopeptidase C Score = 314 bits (804), Expect = 6e-84 Identities = 166/436 (38%), Positives = 248/436 (56%), Gaps = 6/436 (1%) Frame = +3 Query 10 LAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGR 69 L Q KQ Q T A++ A+ NN I A N D+ M FSI++D+ + +QK SGR Sbjct 2359272 LNQIKQSYQGTTTDKAIRNAIGNNDIRKLALNQDNLKGMDTHFSIKVDSKGITDQKSSGR 2359451 Query 70 CWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVA 129 CW+F LN MR A++ + FE SQNY FFWD+ EK+N F + V+ T ++P+D + V Sbjct 2359452 CWLFTGLNVMRAKAIARYGLGSFEFSQNYNFFWDQLEKANLFLQGVIDTREKPMDDKMVE 2359631 Query 130 FLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRK 189 +L P DGG + ++ ++ KYG+VPK VMPET SS +S + GL+ KLR+ + LR Sbjct 2359632 WLFRNPLSDGGTFTGVADIVSKYGLVPKEVMPETNSSENTSRMAGLIAEKLREYGLQLRD 2359811 Query 190 LVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFF 249 A A +E K +ML YR+L LG PPT+F + +D+ + TP +F Sbjct 2359812 RAAKGAKQPALEKDKTEMLGTVYRMLVLNLGIPPTEFTWTRKDEKGNPVETAQYTPMSFL 2359991 Query 250 KKYVAWN-LDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQ 308 +KY N LD+Y ++N P+ + Y Y ++ + GR ++NL D K +A+ Sbjct 2359992 EKYGDKNLLDNYVMLMNDPS--REYYKCYEIDFDRHRYDGRNWTYVNLPADEIKEMAIAS 2360165 Query 309 LKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVL 368 LK ++F DVG+ + + G++D N Y L T F M K +R+ S +HAM L Sbjct 2360166 LKDSTMMYFSCDVGKFLNSERGLLDVNNYDYASLMGTTFGMDKKQRVQTFASGSSHAMTL 2360345 Query 369 TGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQDVIKN 428 VD+ D KP KW VENSWG G +G+ + +D WFDE+++++V+ KK+ + + +++K Sbjct 2360346 MAVDVKDNKPVKWMVENSWGATNGYQGHLIMTDEWFDEYMFRLVVEKKFATPKVLEILK- 2360522 Query 429 EYDKPTVLAPWDPMGA 444 KP L WDPM A Sbjct 2360523 --QKPIRLPAWDPMFA 2360564 Features in this part of subject sequence: aminopeptidase C Score = 58.2 bits (139), Expect = 8e-07 Identities = 90/416 (21%), Positives = 159/416 (38%), Gaps = 71/416 (17%) Frame = +3 Query 35 INATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQAQFKIKDFEL 94 ++A A++ + T E S+ NQ +S CW F++L + + K +++L Sbjct 3843270 LSALAQDKPQEEGFVFTTVKENPITSIKNQNRSSTCWSFSSLGFLESELLRTGK-GEYDL 3843446 Query 95 SQNYTFFWDKFEKS-NYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYG 153 S+ + +++ NY V + + GG + + ++ YG Sbjct 3843447 SEMFVVHHTMVDRAVNY-----------------VRYHGDSSFSPGGSFYDIMFCMKNYG 3843575 Query 154 IVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAKQKMLAEDYR 213 +VP+ MP N +L A A +A K + + +K L Y Sbjct 3843576 LVPQDAMPGIMYGDSLPVHN-----ELDATAGAYVNAIA-KGNLKKLTPVWKKGLCAIYD 3843737 Query 214 ILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSIINAPTDDKPY 273 LG P KF ++ +E TP TF + + N DDY S+ + P+ Sbjct 3843738 TY---LGQCPEKFTYK----------GKEYTPMTFAQS-LGLNPDDYVSLTSYT--HHPF 3843869 Query 274 NHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQSSDRQLGI-M 332 + +E+ N G NL +D F A+ +K G + +GSDV + + GI + Sbjct 3843870 YSQFAIEIQDNWRNGLSY---NLPLDEFMAVMDNAVKNGYTFAWGSDVSEEGFTRDGIAV 3844040 Query 333 DTNIYKKDDLFNTDFT----MTKAER----------------------LDYGESLMTHAM 366 + K +L +D MT A++ D E+ H M Sbjct 3844041 VPDAAKGAELTGSDMARWTGMTAADKRKELTSKPLPEMKITQEMRQTAFDNWETTDDHGM 3844220 Query 367 VLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADL 422 ++ G+ + V+NSWG KG + AS ++ +++ K L D+ Sbjct 3844221 IIYGIAKDQNGKEYFMVKNSWGTNNKYKGTWYASKAFVAYKTMNILVHKDALPKDI 3844388 >gb|AE015928.1| Download subject sequence spanning the HSP Bacteroides thetaiotaomicron VPI-5482, complete genome Length=6260361 Features in this part of subject sequence: putative aminopeptidase C Score = 303 bits (777), Expect = 8e-81 Identities = 165/448 (36%), Positives = 256/448 (57%), Gaps = 19/448 (4%) Frame = -3 Query 5 ITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQ 64 I+T + Q KQ Q T A++ A+ NN I A N D+ M FS+++++ + +Q Sbjct 1448611 ISTDMMQQIKQSYQGTSTDKAIRNAISNNDIRKLALNQDNMKGMDTHFSVKVNSKGITDQ 1448432 Query 65 KQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLD 124 K SGRCW+F LN MR ++ + FE SQ Y FF+D+ EK+N F + V+ T+D+P++ Sbjct 1448431 KSSGRCWLFTGLNVMRAKAIDKYHLGSFEFSQTYPFFFDQLEKANLFLQGVIDTSDKPMN 1448252 Query 125 SRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDA 184 + V +L P DGG + ++ ++ KYG+VPK VMPET SS ++ + L+ LKLR+ Sbjct 1448251 DKMVEWLFRNPLSDGGTFTGVADIVSKYGLVPKDVMPETNSSENTARMANLIALKLREQG 1448072 Query 185 VALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRE-- 242 + LR + + KA A IE AK +ML+ YR+L LG PPT+F + QY++ E Sbjct 1448071 LQLRDMASKKAKPAAIENAKVEMLSTIYRMLVLNLGVPPTEFTW------TQYNVKGEPV 1447910 Query 243 ----LTPQTFFKKYVAWNL-DDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLD 297 TP +F KKY L D+Y ++N P+ + Y Y ++ + G+ ++NL Sbjct 1447909 ETATYTPLSFLKKYGDEKLIDNYVMLMNDPS--REYYKCYEIDYDRHRYDGKNWTYVNLP 1447736 Query 298 IDTFKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDY 357 I+ K +A+ LK +++ DVG+ + G++D Y D L T F+M K +R+ Sbjct 1447735 IEDIKEMAIASLKDSTMMYYSCDVGKFLNSDRGLLDVKNYDYDSLMGTTFSMDKKQRIQS 1447556 Query 358 GESLMTHAMVLTGVDI-VDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKK 416 S +HAM L VD+ +GKPTKW VENSWG G +G+ + +D WF+E+ +++V+ K Sbjct 1447555 FASSSSHAMTLMAVDLDKNGKPTKWMVENSWGAGAGYQGHLIMTDEWFNEYTFRLVVETK 1447376 Query 417 YLSADLQDVIKNEYDKPTVLAPWDPMGA 444 Y++ +V+K KP L WDPM A Sbjct 1447375 YVTPKALEVLK---QKPIRLPAWDPMFA 1447301 Features in this part of subject sequence: aminopeptidase C (bleomycin hydrolase) Score = 53.9 bits (128), Expect = 1e-05 Identities = 90/416 (21%), Positives = 159/416 (38%), Gaps = 71/416 (17%) Frame = +2 Query 35 INATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQAQFKIKDFEL 94 ++A A++ + T E S+ NQ +S CW F+AL + + K +++L Sbjct 2236175 LSAMAQDAKPEEGFVFTTVKENPITSIKNQNRSSTCWSFSALGFLESELLRLGK-GEYDL 2236351 Query 95 SQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGI 154 S+ + V KT + + V + + GG + + ++ YG+ Sbjct 2236352 SEMFV---------------VHKTMEDR-GTNYVRYHGDSSFSPGGSFYDIIYCMKNYGL 2236483 Query 155 VPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVA-DKASDADIEAAKQKMLAEDYR 213 VP+ MP N L DAVA + A K + +K L+ Y Sbjct 2236484 VPQEAMPGIMYGDTLPVHNEL-------DAVAEGYINAIAKGKLTKLTPVWKKGLSAIYD 2236642 Query 214 ILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSIINAPTDDKPY 273 LG P F ++ +E TP+TF + + +DY S+ + P+ Sbjct 2236643 TY---LGACPENFTYK----------GKEYTPKTFAES-LGLKAEDYVSLTS--YTHHPF 2236774 Query 274 NHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQSSDRQLGI-M 332 + +E+ N G NL +D F A+ +K G + +GSDV + + G+ + Sbjct 2236775 YSQFAIEIQDNWRNGLS---YNLPLDEFMAVMDNAVKQGYTFAWGSDVSEQGFTRDGVAV 2236945 Query 333 DTNIYKKDDLFNTDFT----MTKAER----------------------LDYGESLMTHAM 366 + K +L +D +T A++ D E+ H M Sbjct 2236946 MPDAAKGAELTGSDMARWTGLTAADKRKELTSKPLPEMEITQEMRQTAFDNWETTDDHGM 2237125 Query 367 VLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADL 422 V+ G+ + V+NSWG KG + AS ++ +++ K L D+ Sbjct 2237126 VIYGIAKDQNGKEYFMVKNSWGTSGKYKGIWYASKAFVAYKTMNILVHKDALPKDI 2237293 >gb|AE015924.1| Download subject sequence spanning the HSP Porphyromonas gingivalis W83, complete genome Length=2343476 Features in this part of subject sequence: aminopeptidase C Score = 296 bits (759), Expect = 1e-78 Identities = 161/445 (36%), Positives = 259/445 (58%), Gaps = 15/445 (3%) Frame = +3 Query 5 ITTGDLAQFKQDLQATPGASALQKAVMNNGINAT-AENTDSKVAMTPTFSIELDTGSVAN 63 +T L + + TP AL+ AV+ NG+ T + TD A FS + + +++ Sbjct 1685346 LTPKVLEEIRSSYAGTPADRALRNAVIANGMTFTNSAKTDFPDAQ---FSHRVQSKGISD 1685516 Query 64 QKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPL 123 Q+QSGRCW+F +N +R + + F S NY+FFWD+ EKSN F + ++ T ++P+ Sbjct 1685517 QQQSGRCWLFTGMNVLRSRMITDNNMDSFFFSHNYSFFWDQLEKSNLFLQGIIDTRNKPI 1685696 Query 124 DSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKD 183 D + V +L P DGGQ+ +S + KYG+VP VMPET +S+ ++ LN +L+ LR+ Sbjct 1685697 DDKMVEWLFKNPIGDGGQYTGVSENLMKYGLVPAEVMPETRNSNNTTSLNRILSKVLRQG 1685876 Query 184 AVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDREL 243 + LR+ A +A +EA K+ +L YR+L LG PPT+F + RD + ++ Sbjct 1685877 GMRLRQAAEKGAGEAKLEAQKKDILKRVYRLLIMNLGEPPTEFTWSMRDASGKVISTQKY 1686056 Query 244 TPQTFFKKYVAWNL-DDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFK 302 TPQ+FFK++V ++ +DY I+N P+ +PY L+ ++ + G+ ++N+ ++ K Sbjct 1686057 TPQSFFKQFVHEDMREDYVMIMNDPS--RPYYKLFEIDYDRHNYDGKNWTYVNVPMEDLK 1686230 Query 303 ALAVKQLKAGESVWFGSDVGQSSDRQLGI--MDTNIYKKDDLFNTDFTMTKAERLDYGES 360 +A+ +K +++ DVG+ DR GI MD N Y L +FT+ K ER+ +S Sbjct 1686231 QMAIASIKDSTMMYYSCDVGKELDRTRGILAMDNNDYA--SLLGEEFTLNKKERIQTFDS 1686404 Query 361 LMTHAMVLTGVDI-VDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLS 419 THAM L VD+ +GKPTKW VENSWG G +G+ + +D WFD + +++V++K+Y+ Sbjct 1686405 GSTHAMTLMAVDLDANGKPTKWMVENSWGANNGAQGHLIITDEWFDAYTFRLVVNKRYVP 1686584 Query 420 ADLQDVIKNEYDKPTVLAPWDPMGA 444 A + D++K P L WDPM A Sbjct 1686585 AKVLDILKT---TPIRLPAWDPMFA 1686650 Features in this part of subject sequence: cysteine peptidase, putative Score = 53.9 bits (128), Expect = 1e-05 Identities = 94/402 (23%), Positives = 164/402 (40%), Gaps = 84/402 (20%) Frame = +3 Query 55 ELDTGSVANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTF---FWDKFEKSNYF 111 E+ V +Q SG CW ++AL + I K + +L++ ++ + DK EK Sbjct 1876293 EVPITPVKDQANSGTCWSYSALGFLESEILRMGK-PEVDLAEMHSVAQSYKDKGEKYVRM 1876469 Query 112 YENVLKTADQPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPE-TYSSSKSS 170 + K+ F Q G +D+L +++ YG+VP+SVM Y + K++ Sbjct 1876470 HG-------------KLNF-----GQGGSFYDVLY-VVKHYGVVPQSVMQGLNYGTKKNA 1876592 Query 171 ELNGLLNLKLRKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEY 230 + +L A+A K + + A K+ A D I +Y LG P F +E Sbjct 1876593 ------HSELADGALAYLKAIVTNPNGKLTPAWKK---AYDGIIDSY-LGTCPETFTYE- 1876739 Query 231 RDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGRE 290 + TP++ F +Y+ N+DDY S+ + P+ + +E+ N G Sbjct 1876740 ---------GKTYTPKS-FAQYLGLNVDDYVSLTS--YTHHPFYTQFALEIEDNWRGSLS 1876883 Query 291 VRHLNLDIDTFKALAVKQLKAGESVWFGSDV----------------------GQSSDRQ 328 N+ I+ + G S+ +GSDV G DR Sbjct 1876884 ---YNMPINELMETMEYAINNGYSIAWGSDVSEVGFTRDGIGVLADVEGIEAKGSDQDRW 1877054 Query 329 LGIMDTNIYKKDDLFNT-------DFTMTKAER-LDYGESLMT--HAMVLTGVDIVDGKP 378 +G+ + K+ ++ T + T+ R Y E +T H MV+ G+ Sbjct 1877055 VGL--SRAEKQAEIIRTVNSADCPEINPTQEFRQKGYDEYSLTDDHGMVIYGIAKNQNGR 1877228 Query 379 TKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSA 420 + V+NSWG+ KG + AS ++ +++ KK + A Sbjct 1877229 KFFMVKNSWGETGKYKGIWYASYNFVAGRTMNIIVHKKAIPA 1877354 >gb|AE015450.1| Download subject sequence spanning the HSP Mycoplasma gallisepticum strain R complete genome Length=996422 Features in this part of subject sequence: nique hyppthetical PepC Score = 275 bits (702), Expect = 4e-72 Identities = 168/472 (35%), Positives = 257/472 (54%), Gaps = 64/472 (13%) Frame = -1 Query 28 KAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQAQF 87 K+V NG N + + +F+++L + NQ Q+GRCW+FA LN +R+ + + Sbjct 608210 KSVSYNGYNFSKNSL--------SFNLDLSAQPITNQFQTGRCWIFAGLNLLRYHLAKEL 608055 Query 88 KIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDMLSA 147 I D ELSQ+Y F DKFEK+NYF E V + D+ ++ R ++F++ DGGQ ML+ Sbjct 608054 NIDDLELSQSYLAF*DKFEKANYFLETVTELRDKKVNDRTLSFILKNGVADGGQ*TMLTN 607875 Query 148 LIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASD-ADIEAAKQK 206 LI+KYG+VPKS+MP+T +S+ +++LN L+NLKL + A K++ +K A++ K K Sbjct 607874 LIKKYGLVPKSIMPDTANSASTNQLNYLINLKLNQ---AASKILDNKDKPVAELNKIKTK 607704 Query 207 MLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDR---------------ELTPQTFFKK 251 L E + +L+ G PTKFDF Y K+ DR TP TF++K Sbjct 607703 ALDEVFYLLSSIYGELPTKFDFSYTKVIKKDSADRSESHFNYLPKKVVETNFTPLTFYQK 607524 Query 252 YVAWNLD--DYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQL 309 Y ++ + S+INAP ++KP+N ++V+ L NV+ E+ H NL+ F L +KQL Sbjct 607523 YFKQLVEKQGFVSVINAPANNKPFNQTFSVKYLNNVIESDEILHYNLEQGLFSYLTIKQL 607344 Query 310 KAGESVWFGSDVGQ-SSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVL 368 + VWFG +V + D + LFN D +++K ++LDY S + HAM++ Sbjct 607343 VNQQPVWFGCEVKNIYLNEAKTFWDDQSFDYQTLFNIDLSLSKNDQLDY*LSSINHAMLI 607164 Query 369 TGVD---------------IVDGKPTKW-----------------KVENSWGDKVGDKGY 396 TGVD +V TK K+ENSWG +G GY Sbjct 607163 TGVDLDLEKFNQIDQEFNQLVKANKTKQAYQYLVEHMDQLTIHK*KIENSWGQDLGHAGY 606984 Query 397 FVASDSWFDEFVYQVVISKKYLSADLQDV-IKNEYDKPT-VLAPWDPMGALA 446 FV SDS+F + YQV I+++ + ++ + + E+DKP +L P DP+G LA Sbjct 606983 FVISDSYFKRYTYQVAINRQLFNQLVEQLKLTKEFDKPVRLLEP*DPIGTLA 606828 Features in this part of subject sequence: PepC Score = 185 bits (469), Expect = 4e-45 Identities = 139/517 (26%), Positives = 233/517 (45%), Gaps = 104/517 (20%) Frame = -2 Query 27 QKAVMNNGINATAENTDSKVAMTPTFSIELD--TGSVANQKQSGRCWMFAALNTMRHGIQ 84 + A++ N IN A N + F ++ T ++ NQ SGRCW+FA LN +R Sbjct 609868 RNALVANDINLMAANVFNPDKNLTEFLVDAHKPTLTITNQDMSGRCWIFAGLNPLRRQTA 609689 Query 85 AQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDM 144 + K+ +F SQ Y FWDK+E++N F +++ AD LD R + + + QDGG + Sbjct 609688 EKLKVSNFVFSQTYMDFWDKYERANVFLNKMIEKADVELDDRDLKAELQSAGQDGGWYGF 609509 Query 145 LSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALR--KLVADKASDADIEA 202 L+ KYG+VP+ VMP+++S + LN LL + L K +R K + K + ++A Sbjct 609508 FENLVNKYGLVPQEVMPDSFSGHNTFILNELLQVVLIKATKEIRAHKKASQKQKEV-VDA 609332 Query 203 AKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDK--------------------------- 235 +K+L + +LAY G P+KFD +Y D K Sbjct 609331 TLKKVL--EMLVLAY--GPVPSKFD*QYVADAKKDEENKELANKEEKSTKTKTEVKTPAQ 609164 Query 236 ---------------QYHIDRELTPQTFFKKYVAWNLDDYQSI-INAPTDDKPYNHLYTV 279 ++ +++TP F K+YV + D+ + T D N Y++ Sbjct 609163 QEEEKAKQELKEIKTEFSFIKQITPLEFSKQYVNYQEYDFLDL*TIGNTIDYKINQRYSL 608984 Query 280 EMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKK 339 + N+ + LN+D + K A+ L A +++ F DV + + G D + Sbjct 608983 KDSNNLFEASDFNFLNVDRNILKFFALANLVAKQTM*FACDVNHYRNNKTGGFDNQQFDY 608804 Query 340 DDLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVDGKP--------------------- 378 LFN DF++ + +++ HAM L+GVD + K Sbjct 608803 QSLFNIDFSVDRNKQVRSHFISSNHAMTLSGVDFDEAKSLLKQKELVKKYKNLKKFDQYQ 608624 Query 379 -----------TKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVIS----------KKY 417 K K+ENSWG+KVG+KG++ +D F++++ +VIS K+ Sbjct 608623 FVLDLSQTFVFKK*KIENSWGEKVGNKGFYYMNDQ*FNDYLIDIVISTKAADDFFKNPKF 608444 Query 418 LSADL---------QDVIKNEYD-KPTVLAPWDPMGA 444 + DL ++++K D KP ++ +DP+GA Sbjct 608443 IDPDLIGLVKQLKTKEILKAGLDTKPILIDGYDPLGA 608333 >gb|AF121254.1|AF121254 Download subject sequence spanning the HSP Enterococcus faecium cysteine aminopeptidase (pepC) gene, partial cds; phospho-beta-glucosidase BglB (bglB), beta-glucoside specific transport protein (bglS), transcription antiterminator (bglR), enterocin B precursor (entB), enterocin B immunity protein (eniB), and induction factor-like protein genes, complete cds; and unknown genes Length=12018 Score = 268 bits (684), Expect = 5e-70 Identities = 132/222 (59%), Positives = 162/222 (72%), Gaps = 0/222 (0%) Frame = -1 Query 5 ITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQ 64 IT +F + QA ALQ+AV+ NGI A+AEN + V TP FSI+L TG VANQ Sbjct 666 ITPDMTTKFNKQFQANIKQQALQRAVVKNGITASAENVSAHVENTPVFSIDLATGKVANQ 487 Query 65 KQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLD 124 QSGRCWMFAALNT RH + QF +K+FELSQNYTFFWDK+EK+NYFYEN++ T + +D Sbjct 486 MQSGRCWMFAALNTFRHKMLNQFHLKEFELSQNYTFFWDKYEKANYFYENIIATGKEAID 307 Query 125 SRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDA 184 SRKVAFL+ TPQQDGGQWDM+ +L +KYG+VPKSVMPE+ +SS S +LN LN LRKDA Sbjct 306 SRKVAFLLATPQQDGGQWDMIVSLFQKYGVVPKSVMPESANSSNSRDLNNYLNKLLRKDA 127 Query 185 VALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKF 226 V LRK+VA + IE K++ML Y LA +LG PP +F Sbjct 126 VVLRKMVAQGETLDAIEEKKEEMLESIYNFLAISLGTPPKEF 1 >dbj|BA000026.2| Download subject sequence spanning the HSP Mycoplasma penetrans HF-2 DNA, complete genome Length=1358633 Features in this part of subject sequence: hypothetical protein aminopeptidase C Score = 256 bits (654), Expect = 1e-66 Identities = 171/463 (36%), Positives = 241/463 (52%), Gaps = 48/463 (10%) Frame = -1 Query 30 VMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQAQFKI 89 + N I + N + FS++L V NQ +SGRC +FAA N +R I + + Sbjct 1313102 LFNTSIYQASYNAQKINKLNQNFSLDLIGLPVENQHKSGRC*LFAATNFIREQIAKKLNL 1312923 Query 90 KDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDMLSALI 149 + LS Y F DK E+SN+F E +++ ++PLD R V + T +DGGQ DM LI Sbjct 1312922 DNLSLSNAYLAF*DKIERSNFFLEAMIENINKPLDDRLVRHFLRTGIEDGGQ*DMAVNLI 1312743 Query 150 EKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAKQKMLA 209 EKYG+VP VM +T ++ + +N LLN KLR LRK + DK S ++ K++M+ Sbjct 1312742 EKYGVVPYDVMKDTAHAADTQTINYLLN*KLRDFTAELRKDI-DK-SPENLSRKKEQMMK 1312569 Query 210 EDYRILAYTLGNPPTKFDFEYRDD--------------------DKQYHIDRELTPQTFF 249 E +++L G P FDFEY D ++Y +D+ LTPQ+F+ Sbjct 1312568 EIFKLLQTFYGEIPQTFDFEYSIDLEKVKEADDNLFYTDSYDKYTRRYFLDKNLTPQSFY 1312389 Query 250 KKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQL 309 +KYV LD++ SII+AP D K + LYT + L NV+ GR V H N+ +D FK L +QL Sbjct 1312388 QKYVDIKLDEFISIIHAPQDTKDFFKLYTFKYLNNVIEGRPVLHCNVPLDLFKYLI*EQL 1312209 Query 310 -KAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVL 368 K V FGSDV D G D ++ ++LFNT F + K E+L Y S MTHAMV+ Sbjct 1312208 EKTKLPV*FGSDVS*FRD*ISGT*DDQLFDIENLFNTSFQLKKGEQLTYRTSFMTHAMVI 1312029 Query 369 TGVDIVD-----------GKPTKW------------KVENSWGDKVGDKGYFVASDSWFD 405 G++ +W K+ENS GD VG GY S S FD Sbjct 1312028 VGLNSNQEENYSLDLSNFSSYEQWSLAAKKMDFNR*KIENS*GDDVGYYGY*TISGS*FD 1311849 Query 406 EFVYQVVISKKYLSADLQDVIKNEYDKPTV--LAPWDPMGALA 446 ++ YQ V+SKK L L ++ ++ L P DP+G LA Sbjct 1311848 KYTYQAVVSKKLLVEALNNLNLPSIEEQVTENLDP*DPIGTLA 1311720 Features in this part of subject sequence: aminopeptidase C Score = 207 bits (528), Expect = 6e-52 Identities = 147/470 (31%), Positives = 234/470 (49%), Gaps = 51/470 (10%) Frame = -3 Query 4 EITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDS--KVAMTPTFSIELDTGSV 61 ++ +L +++++L Q A++NN + A + +S K T +I+ + + Sbjct 1314699 KVNLDELFEYQKELLKDSSFRVSQNALVNNKLEDVAIDFESLKKYNGEYTNNIKPASAKI 1314520 Query 62 ANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVLKTADQ 121 +QK SGRC +FAALN +R +++FE SQ+Y F+DK EK+N F +++ D Sbjct 1314519 THQKNSGRC*IFAALNMIRDKFIEDNNLENFEFSQSYLHFYDKLEKANVFLNHMVDMVDV 1314340 Query 122 PLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLR 181 R + L++ DGG +D LI KYG+VPKS M +++SSS + +N LL+LKL+ Sbjct 1314339 DSTDRVLFSLLSEATGDGGFFD*AKNLILKYGLVPKSEMEDSFSSSNTLTINKLLDLKLK 1314160 Query 182 KDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDR 241 + A+ +RK DK + I K+K L + Y+IL G PP KFD +D ++ Sbjct 1314159 QAAIEIRKYKEDK---SQIFQIKEKYLYDVYKILVSAYGLPPKKFDLFLKDKKEKTKNFY 1313989 Query 242 ELTPQTFFKKYVAWNLDDYQSIINAP-TDDKPY-----NHLYTVEMLGNVVGGREVRHLN 295 LTP TF KK + +N DDY SI+ P KP+ + ++ GN V Sbjct 1313988 GLTPLTFLKK-IKFNFDDYVSIVYTPYRKIKPFQRYELTYANAMQEKGNAV------FTT 1313830 Query 296 LDIDTFKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERL 355 +D TF+ +A+ + +S+ F DV S RQ GI T++Y ++ FN F ++ + Sbjct 1313829 VDQATFRLMALSMMYKKKSI*FACDVDHFSSRQKGI*ATDLYDFENFFNIKFNKDISQHI 1313650 Query 356 DYGESLMTHAMVLTGVDIVDGKPTKWK------------------------------VEN 385 +Y + HAM L G D+ K K +EN Sbjct 1313649 EYSQIGSNHAMTLQGFDLNTKS*EKVKSDYFAKNKSKKLSIDDFKSLVNLIPIKK*NIEN 1313470 Query 386 SWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADLQD---VIKNEYDK 432 S G+K G+KG F SD F+ +VY++V+SK L++ + K E+ K Sbjct 1313469 S*GEKFGNKGIFTISDD*FNNYVYEIVLSKSLFKEFLKNPEFLSKTEFAK 1313320 >gb|AF496529.1| Lactobacillus delbrueckii subsp. lactis aminopeptidase W gene, partial cds Length=439 Score = 149 bits (376), Expect = 3e-34 Identities = 72/145 (49%), Positives = 97/145 (66%), Gaps = 1/145 (0%) Frame = +3 Query 95 SQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGI 154 SQ+Y FFWDK E++NYFY+ ++ TAD+PL R V Q DGGQW M ++LI KYG+ Sbjct 6 SQSYNFFWDKIERANYFYDRIIATADRPLTDRTVRGYFDWCQTDGGQWHMAASLIAKYGV 185 Query 155 VPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAKQKMLAEDYRI 214 VP MPE+++S+ S L+ +L K RKDA+ LR+L A +EAA+ L++ YRI Sbjct 186 VPAYAMPESFNSNHSQALDMVLADKERKDALTLRRL-AQAGDQEKLEAARTDFLSQIYRI 362 Query 215 LAYTLGNPPTKFDFEYRDDDKQYHI 239 +A LG PP FD E+RDDDK YH+ Sbjct 363 MATALGEPPKTFDLEFRDDDKNYHL 437 >emb|AJ866922.1| Lactobacillus sanfranciscensis partial pepC gene for putative cysteine aminopeptidase Length=383 Score = 127 bits (318), Expect = 1e-27 Identities = 58/112 (51%), Positives = 77/112 (68%), Gaps = 0/112 (0%) Frame = -2 Query 5 ITTGDLAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQ 64 +T DLAQ Q L+ + AVM+NGIN TA N + TFSI++ TG+VANQ Sbjct 376 LTNQDLAQMHQKLKDRSEHKIVANAVMSNGINKTATNAQVLAKLNHTFSIDIPTGTVANQ 197 Query 65 KQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKFEKSNYFYENVL 116 K SGRCW+F+ LNT+RH Q+K+KDFELSQ+Y FFWDK E++N FY+ ++ Sbjct 196 KHSGRCWLFSILNTLRHQFATQYKVKDFELSQSYLFFWDKIERANIFYDRMI 41 >gb|AF496520.1| Lactobacillus delbrueckii subsp. lactis aminopeptidase W gene, partial cds Length=299 Score = 86.3 bits (212), Expect = 3e-15 Identities = 42/101 (41%), Positives = 63/101 (62%), Gaps = 2/101 (1%) Frame = +2 Query 238 HIDRELTPQTFFKKYVAWNLDDYQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLD 297 H+D+ LTP F+KKY A +LDDY + NAP D N + + N+ GG +N+ Sbjct 2 HLDKGLTPVXFYKKYCATDLDDYVVLANAP--DHEMNRVLHLGFEDNIKGGYPNLFINVP 175 Query 298 IDTFKALAVKQLKAGESVWFGSDVGQSSDRQLGIMDTNIYK 338 ++ + A+ QLK GE+VWFG+DVG+ DR+ G MD ++Y+ Sbjct 176 MEYLEDAAIAQLKDGEAVWFGNDVGRQMDRKTGFMDLDLYQ 298 >gb|U97360.1|TPU97360 Treponema pallidum HFLK homolog gene, complete cds Length=1145 Score = 54.7 bits (130), Expect = 9e-06 Identities = 30/71 (42%), Positives = 37/71 (52%), Gaps = 0/71 (0%) Frame = -2 Query 10 LAQFKQDLQATPGASALQKAVMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGR 69 L F ++ A P A+ AV G+ A NT+ T FS E G + NQK SGR Sbjct 301 LDTFAHEVAADPIHKAVAGAVARVGLEEAALNTEVARQHTHIFSTETKRGEMTNQKMSGR 122 Query 70 CWMFAALNTMR 80 CW+FAALN R Sbjct 121 CWIFAALNAAR 89 >gb|CP000685.1| Download subject sequence spanning the HSP Flavobacterium johnsoniae UW101, complete genome Length=6096872 Features in this part of subject sequence: peptidase C1B, bleomycin hydrolase Score = 51.6 bits (122), Expect = 7e-05 Identities = 89/409 (21%), Positives = 158/409 (38%), Gaps = 59/409 (14%) Frame = +1 Query 30 VMNNGINATAENTDSKVAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQAQFKI 89 ++ N + A + SK A T + L T SV NQ SG CW ++ N+ + Sbjct 1301422 ILVNSLKLNASDK-SKEAFKFTEVVNLGTTSVKNQGSSGTCWSYST-NSFLESEMIRLGK 1301595 Query 90 KDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDMLSALI 149 + ELSQ F N + E + V DGG ++ + Sbjct 1301596 QPVELSQ-------VFSARNVYVEKGI---------NYVRMHGAVTLGDGGALHDVTNMY 1301727 Query 150 EKYGIVPKSVMPE-TYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAKQKML 208 +KYG VP+ V Y + K+ K + A + ++A + + E Sbjct 1301728 KKYGAVPREVYTGLNYGTDKN---------KFAEMAALIEGVLAAVVKNPNGELTPNWQK 1301880 Query 209 AEDYRILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSIINAPT 268 A I +Y LG P F ++ + TPQ+F K+ V N D+Y + + T Sbjct 1301881 AYAAVIDSY-LGKVPENFTYK----------GKNYTPQSFAKEVVGINPDEYIEMSSFTT 1302027 Query 269 DDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGSDVGQSS--- 325 PY T+ + N + N+ ++ + LK G +V + +DV + S Sbjct 1302028 --SPYYQKTTMMVPDNWSFDQV---YNVKVNDMTDVIDNALKKGYTVAWATDVSEKSFSW 1302192 Query 326 DRQLGIMDTNIY------KKDDLFN---TDFTMTKAERLDYGESLMT---HAMVLTGVDI 373 + + T + +K D+FN + +T R ++ T H M + G+ Sbjct 1302193 KNGVAYVPTKKFDEMTAEEKADMFNGPKAEPEITPEMRQAAFDNYTTTDDHGMHIIGLAK 1302372 Query 374 VDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLSADL 422 + V+NSWG+ KG+ + ++ ++++K + D+ Sbjct 1302373 DQTGKEYYIVKNSWGETNDYKGFLFVTKNFVKYKTTALMVNKGGIPTDI 1302519 >emb|BX842650.1| Download subject sequence spanning the HSP Bdellovibrio bacteriovorus complete genome, strain HD100; segment 5/11 Length=349723 Features in this part of subject sequence: putative aminopeptidase C Score = 51.2 bits (121), Expect = 1e-04 Identities = 64/283 (22%), Positives = 112/283 (39%), Gaps = 38/283 (13%) Frame = -1 Query 148 LIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVADKASDADI--EAAKQ 205 L + I+ ++PE KS + +LN + +K + L ++ AD E + Sbjct 191596 LFSRESILEYGLLPEGAWKPKS---DFMLNPQAKKMSEFLENILVRTQWQADKIQEGPAR 191426 Query 206 KMLAEDYR-----ILAYTLGNPPTKFDFEYRDDDKQYHIDRELTPQTFFKKYV-AWNLDD 259 + L E R + +G P +F+F+ + TP+ F K Y ++ Sbjct 191425 EALLEQGRNQIKDLFRQMVGEMPAQFEFQ----------GKTWTPKEFAKAYFESFEGPM 191276 Query 260 YQSIINAPTDDKPYNHLYTVEMLGNVVGGREVRHLNLDIDTFKALAVKQLKAGESVWFGS 319 Q +IN N E G + L +D ++ A + L G+SV+ Sbjct 191275 LQMVINN-------NRKAATEFTSTKQGDK----LTTSVDLVESTARELLDNGQSVYLSY 191129 Query 320 DV-GQSSDRQLGIMDTNIYKKDDLFNTDFTMTKAERLDYGESLMTHAMVLTG--VDIVDG 376 D + D GIM + T+ R + + HA+ + G +D G Sbjct 191128 DHHAEYVDAATGIMSIRAFHIPAYARP---ATRQMREAFDTNRGGHAVQIVGYELDPRTG 190958 Query 377 KPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQVVISKKYLS 419 + KWK+ NSWG GD+G++ D +F F + + + L+ Sbjct 190957 RVVKWKIRNSWGTHKGDEGHYHMYDDYFRAFAKSITVPEAVLT 190829 >emb|AJ293860.1|LRE293860 Lactobacillus reuteri mapA operon, strain 104R Length=3960 Score = 45.4 bits (106), Expect = 0.005 Identities = 25/38 (65%), Positives = 27/38 (71%), Gaps = 5/38 (13%) Frame = -1 Query 410 QVVISKKYLSADLQDVIKNEYDK-PTVLAPWDPMGALA 446 QVVI+KKYLS DL K +Y K P VL PWDPMG LA Sbjct 3960 QVVINKKYLSEDL----KRDYAKSPVVLKPWDPMGTLA 3859 >gb|CP000284.1| Download subject sequence spanning the HSP Methylobacillus flagellatus KT, complete genome Length=2971517 Features in this part of subject sequence: phosphoribosylaminoimidazole-succinocarboxamide synthase Score = 38.1 bits (87), Expect = 0.84 Identities = 37/127 (29%), Positives = 56/127 (44%), Gaps = 18/127 (14%) Frame = -2 Query 153 GIVPKSVMPETY--SSSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAKQKMLAE 210 G+ + +PE SSK+ + N+ L K A + +ADK + ++ K+ Sbjct 2391148 GLQEAAQLPEPLFTPSSKAEVGDHDENITLEKCAQLIGPELADKVARVSVQLYKEAA--- 2390978 Query 211 DYRILAYTLGN----PPTKFDFEYRDDDKQYHIDRELTPQTFFKKYVAWNLDDYQSIINA 266 AY LG TKF+F + + Y ID LTP + ++ W D YQ N Sbjct 2390977 -----AYALGRGIIIADTKFEFGLDEAGELYLIDEVLTPDS--SRF--WPQDQYQVGSNP 2390825 Query 267 PTDDKPY 273 P+ DK Y Sbjct 2390824 PSFDKQY 2390804 >gb|CP000383.1| Download subject sequence spanning the HSP Cytophaga hutchinsonii ATCC 33406, complete genome Length=4433218 Features in this part of subject sequence: conserved hypothetical protein Score = 36.6 bits (83), Expect = 2.4 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 5/72 (6%) Frame = +1 Query 341 DLFNTDFTMTKAERLDYGESLMTHAMVLTGVDIVDGKPTKWKVENSWGD--KVGDKGYFV 398 DLF TD+ T+ RL + T +L + + + + SW D K GD+ FV Sbjct 3318856 DLFMTDYMPTRFNRLFHNNGDGTFTEILNSPIVAEAS---YSITGSWADYDKDGDQDLFV 3319026 Query 399 ASDSWFDEFVYQ 410 +D F +YQ Sbjct 3319027 VNDKGFSNTLYQ 3319062 >gb|AE017340.1| Download subject sequence spanning the HSP Idiomarina loihiensis L2TR, complete genome Length=2839318 Features in this part of subject sequence: Predicted membrane protein Score = 36.6 bits (83), Expect = 2.4 Identities = 49/211 (23%), Positives = 86/211 (40%), Gaps = 27/211 (12%) Frame = +2 Query 46 VAMTPTFSIELDTGSVANQKQSGRCWMFAALNTMRHGIQAQFKIKDFELSQNYTFFWDKF 105 + + P FS + A +KQ + L + + ++K +DFE +Y+ D+ Sbjct 2224268 LCLIPCFSYGSEAYLNAAEKQ-----FESLLELLPEDEKREWKHRDFEEVMDYSNKLDEL 2224432 Query 106 EKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDMLSALIEKYGIVPKSVMPETYS 165 +K+ + N ++D +FL Q + D+ ++L+ G+ Sbjct 2224433 KKTAEYIRNQSDSSDVD-GILAFSFLADAIQYE---LDLKTSLVNDLGL----------H 2224570 Query 166 SSKSSELNGLLNLKLRKDAVALRKLVADKASDADIEAAKQKMLAEDYRILAYTLGNPPTK 225 +S E+N N+ + A+ + AS A +K + R +A NPPTK Sbjct 2224571 LYRSYEIN---NVNPVRKAIEAELVALQNASGALQLQSKLTKYFKLQREIAELSKNPPTK 2224741 Query 226 FDFEYRDDDKQYHIDRELTPQTFFKKYVAWN 256 EYR D + D EL KKYV ++ Sbjct 2224742 MTLEYRPQDNAWDSDPELV-----KKYVLFD 2224819 >gb|CP000377.1| Download subject sequence spanning the HSP Silicibacter sp. TM1040, complete genome Length=3200938 Features in this part of subject sequence: peptidase C1A, papain Score = 35.4 bits (80), Expect = 5.4 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +2 Query 360 SLMTHAMVLTGVDIVDGKPTKWKVENSWGDKVGDKGYFVASDSWFDEFVYQ 410 +L HAM + G D G ++V NSW G++GYF S F+ FVY+ Sbjct 888926 TLGAHAMTVVGYDDTRGGGA-FEVVNSWSAGWGNRGYFWISYEDFNAFVYE 889075 >gb|CP000494.1| Download subject sequence spanning the HSP Bradyrhizobium sp. BTAi1, complete genome Length=8264687 Features in this part of subject sequence: hypothetical protein Score = 35.0 bits (79), Expect = 7.1 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 4/76 (5%) Frame = -3 Query 134 TPQQDGGQWDMLSALIEKYGIVPKSVMPETYSSSKSSELNGLLNLKLRKDAVALRKLVAD 193 T + GG D+L L G++ S + + L LK R DAVA+R+ VA+ Sbjct 4934601 TTAEQGGSADVLFEL----GMLYASGRDGIVDLIAAHKWFNLAALKGRVDAVAMRREVAE 4934434 Query 194 KASDADIEAAKQKMLA 209 + SDADI AA+++ A Sbjct 4934433 QMSDADIAAAQREARA 4934386 >gb|CP000439.1| Download subject sequence spanning the HSP Francisella tularensis subsp. novicida U112, complete genome Length=1910031 Features in this part of subject sequence: protein of unknown function Score = 34.7 bits (78), Expect = 9.3 Identities = 18/75 (24%), Positives = 32/75 (42%), Gaps = 0/75 (0%) Frame = +3 Query 90 KDFELSQNYTFFWDKFEKSNYFYENVLKTADQPLDSRKVAFLMTTPQQDGGQWDMLSALI 149 K + Y+F+W + ++ K A DS +A L + Q + +D + Sbjct 50256 KKIDKEDRYSFYWTNLLLKISKFRDLAKVASSSTDSFNLALLFDSIQTEIKSFDPVKYFP 50435 Query 150 EKYGIVPKSVMPETY 164 ++G+ SV PE Y Sbjct 50436 REFGVFLNSVTPEVY 50480
  Database: All GenBank+EMBL+DDBJ+PDB sequences (but no EST, STS, GSS,environmental 
samples or phase 0, 1 or 2 HTGS sequences)
    Posted date:  May 25, 2007  5:47 PM
  Number of letters in database: -1,893,608,902
  Number of sequences in database:  638,590
Lambda     K      H
   0.316    0.132    0.386 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 638590
Number of Hits to DB: 34426883
Number of extensions: 402796
Number of successful extensions: 1793
Number of sequences better than 10: 4
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 1779
Number of HSP's successfully gapped: 7
Length of query: 448
Length of database: 2401358390
Length adjustment: 133
Effective length of query: 315
Effective length of database: 715520326
Effective search space: 225388902690
Effective search space used: 225388902690
T: 13
A: 40
X1: 16 (7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 78 (34.7 bits)