Job Title: pagA_B.anthracis(Ames_Anc.)

Show Conserved Domains

RID=5P5KH1UM014, pagA_B.anthracis(Ames_Anc.) BLASTP 2.2.16 (Mar-25-2007)
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 5P5KH1UM014


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           4,984,388 sequences; 1,723,618,044 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports

Query=  pagA_B.anthracis(Ames_Anc.)
Length=764


Distance tree of resultsNew  Related Structures

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|NP_052806.1|  hypothetical protein pxo1_110 [Bacillus anth...  1390    0.0    Gene info
gb|AAA22637.1|  protective antigen precursor [Bacillus anthracis]  1389    0.0   
gb|AAF86457.1|AF268967_1  protective antigen [Bacillus anthrac...  1389    0.0   
gb|AAG24451.1|  protective antigen [Bacillus anthracis]            1386    0.0   
emb|CAC93934.1|  Pag protein [Bacillus anthracis]                  1348    0.0   
emb|CAC93935.1|  Pag protein [Bacillus anthracis]                  1343    0.0   
gb|AAT98414.1|  protective antigen [Bacillus anthracis]            1340    0.0   
gb|AAR88321.1|  protective antigen PA83 [Synthetic construct]      1339    0.0   
pdb|1T6B|X  Chain X, Crystal Structure Of B. Anthracis Protect...  1339    0.0    Related structures
pdb|1ACC|   Chain  , Anthrax Protective Antigen                    1338    0.0    Related structures
emb|CAL49462.1|  protective antigen [Bacillus anthracis]           1333    0.0   
gb|ABA29778.1|  hemaglutinin-neuraminidase/anthrax PA63 fusion...  1045    0.0   
pdb|1TZN|A  Chain A, Crystal Structure Of The Anthrax Toxin Pr...  1030    0.0    Related structures
gb|AAX84029.1|  protective antigen [Bacillus anthracis]            1030    0.0   
ref|ZP_00236306.1|  protective antigen [Bacillus cereus G9241]...   804    0.0   
dbj|BAD14937.1|  pagA [Bacillus anthracis]                          437    1e-120
emb|CAA66612.1|  Sb component [Clostridium spiroforme]              280    2e-73 
emb|CAA51960.1|  iota toxin component Ib [Clostridium perfringens   278    1e-72 
gb|AAB67305.1|  ADP-ribosyltransferase [Clostridium difficile]      277    2e-72 
gb|AAF81761.1|AF271719_2  CdtB [Clostridium difficile]              276    3e-72 
ref|ZP_01802068.1|  hypothetical protein CdifQ_04003037 [Clost...   276    3e-72 
pdb|2J42|A  Chain A, Low Quality Crystal Structure Of The Tran...   262    5e-68  Related structures
dbj|BAA32537.1|  C2 toxin (component-II) [Clostridium botulinum]    259    5e-67 
emb|CAI43278.1|  Isp1b protein [Brevibacillus laterosporus]         247    2e-63 
prf||2005240A  protective antigen                                   236    6e-60 
emb|CAI40767.1|  Isp1a protein [Brevibacillus laterosporus]         233    5e-59 
gb|AAO86514.1|  Vip1Ac [Bacillus thuringiensis]                     228    1e-57 
emb|CAK99632.1|  hypothetical bacterial binary exotoxin b prot...   202    7e-50 
ref|NP_652919.1|  protective antigen-related protein, [Bacillu...   102    1e-19  Gene info
ref|NP_052807.1|  hypothetical protein pxo1_111 [Bacillus anth...  80.5    4e-13  Gene info
gb|AAA22636.1|  cryptic protein [Bacillus anthracis]               80.1    5e-13 
ref|YP_001036747.1|  PA14 [Clostridium thermocellum ATCC 27405...  58.9    1e-06  Gene info
ref|ZP_00110033.1|  COG2133: Glucose/sorbosone dehydrogenases ...  55.1    2e-05 
emb|CAB61235.1|  ADP-ribosyltransferase [Clostridium difficile]    53.9    4e-05 
emb|CAB61234.1|  ADP-ribosyltransferase [Clostridium difficile]    53.5    5e-05 
emb|CAJ74877.1|  unknown protein [Candidatus Kuenenia stuttgartie  53.1    6e-05 
emb|CAB61232.1|  ADP-ribosyltransferase [Clostridium difficile]    52.8    8e-05 
emb|CAB61233.1|  ADP-ribosyltransferase [Clostridium difficile]    52.4    1e-04 
ref|YP_373129.1|  hypothetical protein Bcep18194_B2374 [Burkho...  52.4    1e-04  Gene info
ref|ZP_01182639.1|  hypothetical protein BcerKBAB4DRAFT_5403 [...  51.2    3e-04 
emb|CAJ72575.1|  unknown protein [Candidatus Kuenenia stuttgartie  50.8    3e-04 
gb|AAZ39952.1|  CdtB [Clostridium difficile] >gb|AAZ39953.1| C...  50.4    4e-04 
gb|AAZ39950.1|  CdtB [Clostridium difficile]                       50.1    5e-04 
gb|AAZ39951.1|  CdtB [Clostridium difficile]                       50.1    6e-04 
ref|YP_526620.1|  hypothetical protein Sde_1146 [Saccharophagu...  49.3    8e-04  Gene info
ref|ZP_01576054.1|  PA14 [Clostridium cellulolyticum H10] >gb|...  48.9    0.001 
ref|YP_366068.1|  beta-glucosidase precursor [Xanthomonas camp...  47.0    0.005  Gene info
ref|NP_822148.1|  hydrolase [Streptomyces avermitilis MA-4680]...  46.6    0.007  Gene info
ref|NP_644530.1|  glucan 1,4-beta-glucosidase [Xanthomonas axo...  46.2    0.007  Gene info
ref|YP_210015.1|  putative beta-glucosidase [Bacteroides fragi...  44.7    0.023  Gene info
ref|YP_203062.1|  glucan 1,4-beta-glucosidase [Xanthomonas ory...  43.9    0.044  Gene info
ref|NP_625257.1|  hydrolase (secreted protein) [Streptomyces c...  43.5    0.049  Gene info
ref|YP_273043.1|  glycosyl hydrolase, family 3 [Pseudomonas sy...  43.1    0.068  Gene info
ref|YP_097613.1|  beta-glucosidase [Bacteroides fragilis YCH46...  42.4    0.12   Gene info
emb|CAJ88202.1|  putative hydrolase [Streptomyces ambofaciens ATC  42.0    0.16  
ref|YP_001194392.1|  glycoside hydrolase, family 3 domain prot...  41.6    0.19   Gene info
ref|NP_811860.1|  hypothetical protein BT_2948 [Bacteroides th...  41.6    0.22   Gene info
ref|NP_812212.1|  beta-glucosidase [Bacteroides thetaiotaomicr...  41.2    0.28   Gene info
ref|NP_812026.1|  beta-galactosidase [Bacteroides thetaiotaomi...  41.2    0.29   Gene info
gb|ABP88816.1|  LCCL-related protein CCp5B [Toxoplasma gondii]     40.4    0.47  
ref|ZP_01718029.1|  N-acetylgalactosamine 6-sulfatase (GALNS) ...  39.7    0.72  
ref|ZP_01355705.1|  PA14:TadE-like [Roseiflexus sp. RS-1] >gb|...  39.7    0.75  
ref|ZP_01061671.1|  beta-glucosidase precursor [Flavobacterium...  39.7    0.77  
ref|YP_411917.1|  von Willebrand factor, type A [Nitrosospira ...  39.3    0.93   Gene info
ref|YP_542458.1|  putative outer membrane usher protein YqiG p...  38.9    1.3    Gene info
ref|NP_755663.1|  Hypothetical outer membrane usher protein yq...  38.9    1.3    Gene info
ref|ZP_01531645.1|  PA14 [Roseiflexus castenholzii DSM 13941] ...  38.5    1.4   
ref|NP_810691.1|  beta-glucosidase (gentiobiase) [Bacteroides ...  38.5    1.5    Gene info
ref|YP_593226.1|  glycoside hydrolase, family 3-like [Acidobac...  38.5    1.6    Gene info
ref|XP_001348665.1|  hypothetical protein PF14_0491 [Plasmodiu...  37.7    2.7    Gene info
ref|XP_764263.1|  hypothetical protein TP04_0628 [Theileria pa...  37.7    3.1    Gene info
ref|YP_685097.1|  hypothetical protein RCIX309 [Uncultured met...  36.6    5.5    Gene info
ref|YP_633941.1|  DnaK family protein [Myxococcus xanthus DK 1...  36.6    6.8    Gene info
ref|NP_810141.1|  fructose-1,6-bisphosphatase [Bacteroides the...  36.6    7.1    Gene info
ref|NP_793101.1|  beta-glucosidase [Pseudomonas syringae pv. t...  36.2    8.8    Gene info
ref|XP_628974.1|  carbohydrate-binding domain-containing prote...  36.2    8.9    Gene info
Alignments
>ref|NP_052806.1| Gene info hypothetical protein pxo1_110 [Bacillus anthracis] ref|NP_652920.1| Gene info protective antigen [Bacillus anthracis str. A2012] ref|YP_016495.2| Gene info protective antigen [Bacillus anthracis str. 'Ames Ancestor'] sp|P13423|PAG_BACAN Gene info Protective antigen precursor (PA) (PA-83) (PA83) (Anthrax toxins translocating protein) [Contains: Protective antigen PA-20 (PA20); Protective antigen PA-63 (PA63)] gb|AAD32414.1| Gene info pXO1-110 [Bacillus anthracis] gb|AAG24446.1| Gene info protective antigen [Bacillus anthracis] gb|AAG24447.1| Gene info protective antigen [Bacillus anthracis] gb|AAG24448.1| Gene info protective antigen [Bacillus anthracis] gb|AAG24449.1| Gene info protective antigen [Bacillus anthracis] gb|AAM26109.1| Gene info protective antigen [Bacillus anthracis str. A2012] gb|AAT28905.2| Gene info protective antigen [Bacillus anthracis str. 'Ames Ancestor'] gb|AAY15236.1| Gene info protective antigen [Bacillus anthracis] Length=764 Score = 1390 bits (3599), Expect = 0.0, Method: Composition-based stats. Identities = 764/764 (100%), Positives = 764/764 (100%), Gaps = 0/764 (0%) Query 1 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA 60 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA Sbjct 1 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA 60 Query 61 PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV 120 PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV Sbjct 61 PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV 120 Query 121 DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL 180 DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL Sbjct 121 DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL 180 Query 181 QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH 240 QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH Sbjct 181 QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH 240 Query 241 EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL 300 EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL Sbjct 241 EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL 300 Query 301 SKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST 360 SKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST Sbjct 301 SKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST 360 Query 361 VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL 420 VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL Sbjct 361 VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL 420 Query 421 ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD 480 ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD Sbjct 421 ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD 480 Query 481 TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS 540 TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS Sbjct 481 TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS 540 Query 541 DPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNA 600 DPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNA Sbjct 541 DPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNA 600 Query 601 TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI 660 TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI Sbjct 601 TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI 660 Query 661 DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN 720 DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN Sbjct 661 DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN 720 Query 721 PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG 764 PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG Sbjct 721 PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG 764 >gb|AAA22637.1| protective antigen precursor [Bacillus anthracis] Length=764 Score = 1389 bits (3596), Expect = 0.0, Method: Composition-based stats. Identities = 763/764 (99%), Positives = 764/764 (100%), Gaps = 0/764 (0%) Query 1 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA 60 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA Sbjct 1 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA 60 Query 61 PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV 120 PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV Sbjct 61 PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV 120 Query 121 DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL 180 DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL Sbjct 121 DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL 180 Query 181 QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH 240 QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH Sbjct 181 QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH 240 Query 241 EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL 300 EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL Sbjct 241 EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL 300 Query 301 SKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST 360 SKNEDQSTQNTDS+TRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST Sbjct 301 SKNEDQSTQNTDSETRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST 360 Query 361 VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL 420 VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL Sbjct 361 VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL 420 Query 421 ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD 480 ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD Sbjct 421 ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD 480 Query 481 TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS 540 TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS Sbjct 481 TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS 540 Query 541 DPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNA 600 DPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNA Sbjct 541 DPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNA 600 Query 601 TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI 660 TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI Sbjct 601 TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI 660 Query 661 DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN 720 DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN Sbjct 661 DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN 720 Query 721 PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG 764 PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG Sbjct 721 PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG 764 >gb|AAF86457.1|AF268967_1 protective antigen [Bacillus anthracis] gb|AAG24450.1| protective antigen [Bacillus anthracis] Length=764 Score = 1389 bits (3595), Expect = 0.0, Method: Composition-based stats. Identities = 763/764 (99%), Positives = 763/764 (99%), Gaps = 0/764 (0%) Query 1 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA 60 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA Sbjct 1 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA 60 Query 61 PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV 120 PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV Sbjct 61 PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV 120 Query 121 DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL 180 DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL Sbjct 121 DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL 180 Query 181 QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH 240 QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH Sbjct 181 QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH 240 Query 241 EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL 300 EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL Sbjct 241 EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL 300 Query 301 SKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST 360 SKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST Sbjct 301 SKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST 360 Query 361 VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL 420 VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL Sbjct 361 VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL 420 Query 421 ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD 480 ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD Sbjct 421 ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD 480 Query 481 TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS 540 TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS Sbjct 481 TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS 540 Query 541 DPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNA 600 DPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELN Sbjct 541 DPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNV 600 Query 601 TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI 660 TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI Sbjct 601 TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI 660 Query 661 DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN 720 DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN Sbjct 661 DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN 720 Query 721 PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG 764 PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG Sbjct 721 PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG 764 >gb|AAG24451.1| protective antigen [Bacillus anthracis] Length=764 Score = 1386 bits (3587), Expect = 0.0, Method: Composition-based stats. Identities = 762/764 (99%), Positives = 762/764 (99%), Gaps = 0/764 (0%) Query 1 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA 60 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA Sbjct 1 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA 60 Query 61 PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV 120 PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV Sbjct 61 PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV 120 Query 121 DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL 180 DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL Sbjct 121 DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL 180 Query 181 QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH 240 QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH Sbjct 181 QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH 240 Query 241 EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL 300 EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL Sbjct 241 EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL 300 Query 301 SKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST 360 SKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST Sbjct 301 SKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST 360 Query 361 VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL 420 VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL Sbjct 361 VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL 420 Query 421 ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD 480 ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD Sbjct 421 ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD 480 Query 481 TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS 540 TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS Sbjct 481 TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS 540 Query 541 DPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNA 600 DPLETTKPDMTLKEALKIAFGFNE NGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELN Sbjct 541 DPLETTKPDMTLKEALKIAFGFNESNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNV 600 Query 601 TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI 660 TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI Sbjct 601 TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI 660 Query 661 DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN 720 DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN Sbjct 661 DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN 720 Query 721 PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG 764 PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG Sbjct 721 PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG 764 >emb|CAC93934.1| Pag protein [Bacillus anthracis] Length=743 Score = 1348 bits (3489), Expect = 0.0, Method: Composition-based stats. Identities = 742/743 (99%), Positives = 742/743 (99%), Gaps = 0/743 (0%) Query 9 PLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSST 68 PLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSST Sbjct 1 PLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSST 60 Query 69 TGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINK 128 TGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINK Sbjct 61 TGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINK 120 Query 129 ASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQK 188 ASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQK Sbjct 121 ASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQK 180 Query 189 SSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKY 248 SSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKY Sbjct 181 SSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKY 240 Query 249 KSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQST 308 KSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQST Sbjct 241 KSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQST 300 Query 309 QNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLS 368 QNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLS Sbjct 301 QNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLS 360 Query 369 LAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKEN 428 LAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKEN Sbjct 361 LAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKEN 420 Query 429 QLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNI 488 QLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNI Sbjct 421 QLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNI 480 Query 489 ATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKP 548 ATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKP Sbjct 481 ATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKP 540 Query 549 DMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLD 608 DMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELN TNIYTVLD Sbjct 541 DMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNVTNIYTVLD 600 Query 609 KIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKIL 668 KIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKIL Sbjct 601 KIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKIL 660 Query 669 SGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVY 728 SGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVY Sbjct 661 SGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVY 720 Query 729 AVTKENTIINPSENGDTSTNGIK 751 AVTKENTIINPSENGDTSTNGIK Sbjct 721 AVTKENTIINPSENGDTSTNGIK 743 >emb|CAC93935.1| Pag protein [Bacillus anthracis] Length=741 Score = 1343 bits (3477), Expect = 0.0, Method: Composition-based stats. Identities = 740/741 (99%), Positives = 740/741 (99%), Gaps = 0/741 (0%) Query 11 MALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTG 70 MALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTG Sbjct 1 MALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTG 60 Query 71 DLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKAS 130 DLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKAS Sbjct 61 DLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKAS 120 Query 131 NSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSS 190 NSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSS Sbjct 121 NSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSS 180 Query 191 NSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKS 250 NSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKS Sbjct 181 NSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKS 240 Query 251 SPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQN 310 SPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQN Sbjct 241 SPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQN 300 Query 311 TDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLA 370 TDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLA Sbjct 301 TDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLA 360 Query 371 GERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQL 430 GERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQL Sbjct 361 GERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQL 420 Query 431 SQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIAT 490 SQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIAT Sbjct 421 SQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIAT 480 Query 491 YNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDM 550 YNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDM Sbjct 481 YNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDM 540 Query 551 TLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKI 610 TLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELN TNIYTVLDKI Sbjct 541 TLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNVTNIYTVLDKI 600 Query 611 KLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSG 670 KLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSG Sbjct 601 KLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSG 660 Query 671 YIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAV 730 YIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAV Sbjct 661 YIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAV 720 Query 731 TKENTIINPSENGDTSTNGIK 751 TKENTIINPSENGDTSTNGIK Sbjct 721 TKENTIINPSENGDTSTNGIK 741 >gb|AAT98414.1| protective antigen [Bacillus anthracis] Length=736 Score = 1340 bits (3467), Expect = 0.0, Method: Composition-based stats. Identities = 735/735 (100%), Positives = 735/735 (100%), Gaps = 0/735 (0%) Query 30 EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF 89 EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF Sbjct 2 EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF 61 Query 90 QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY 149 QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY Sbjct 62 QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY 121 Query 150 QRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDN 209 QRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDN Sbjct 122 QRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDN 181 Query 210 DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT 269 DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT Sbjct 182 DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT 241 Query 270 GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHT 329 GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHT Sbjct 242 GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHT 301 Query 330 SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL 389 SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL Sbjct 302 SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL 361 Query 390 NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA 449 NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA Sbjct 362 NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA 421 Query 450 LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV 509 LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV Sbjct 422 LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV 481 Query 510 LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL 569 LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL Sbjct 482 LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL 541 Query 570 QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR 629 QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR Sbjct 542 QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR 601 Query 630 NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY 689 NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY Sbjct 602 NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY 661 Query 690 DMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG 749 DMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG Sbjct 662 DMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG 721 Query 750 IKKILIFSKKGYEIG 764 IKKILIFSKKGYEIG Sbjct 722 IKKILIFSKKGYEIG 736 >gb|AAR88321.1| protective antigen PA83 [Synthetic construct] Length=752 Score = 1339 bits (3465), Expect = 0.0, Method: Composition-based stats. Identities = 730/743 (98%), Positives = 733/743 (98%), Gaps = 6/743 (0%) Query 22 GNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELEN 81 G + V +EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELEN Sbjct 16 GAVFVSPSEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELEN 75 Query 82 IPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGR 141 IPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGR Sbjct 76 IPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGR 135 Query 142 LYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAG 201 LYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSN TSAG Sbjct 136 LYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSN------TSAG 189 Query 202 PTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDP 261 PTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDP Sbjct 190 PTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDP 249 Query 262 YSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKN 321 YSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDS+TRTISKN Sbjct 250 YSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSETRTISKN 309 Query 322 TSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGL 381 TSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGL Sbjct 310 TSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGL 369 Query 382 NTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 441 NTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP Sbjct 370 NTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 429 Query 442 SKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVD 501 SKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVD Sbjct 430 SKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVD 489 Query 502 TGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFG 561 TGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFG Sbjct 490 TGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFG 549 Query 562 FNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIR 621 FNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIR Sbjct 550 FNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIR 609 Query 622 DKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGL 681 DKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGL Sbjct 610 DKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGL 669 Query 682 KEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSE 741 KEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSE Sbjct 670 KEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSE 729 Query 742 NGDTSTNGIKKILIFSKKGYEIG 764 NGDTSTNGIKKILIFSKKGYEIG Sbjct 730 NGDTSTNGIKKILIFSKKGYEIG 752 >pdb|1T6B|X Related structures Chain X, Crystal Structure Of B. Anthracis Protective Antigen Complexed With Human Anthrax Toxin Receptor Length=735 Score = 1339 bits (3465), Expect = 0.0, Method: Composition-based stats. Identities = 735/735 (100%), Positives = 735/735 (100%), Gaps = 0/735 (0%) Query 30 EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF 89 EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF Sbjct 1 EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF 60 Query 90 QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY 149 QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY Sbjct 61 QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY 120 Query 150 QRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDN 209 QRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDN Sbjct 121 QRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDN 180 Query 210 DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT 269 DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT Sbjct 181 DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT 240 Query 270 GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHT 329 GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHT Sbjct 241 GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHT 300 Query 330 SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL 389 SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL Sbjct 301 SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL 360 Query 390 NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA 449 NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA Sbjct 361 NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA 420 Query 450 LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV 509 LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV Sbjct 421 LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV 480 Query 510 LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL 569 LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL Sbjct 481 LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL 540 Query 570 QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR 629 QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR Sbjct 541 QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR 600 Query 630 NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY 689 NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY Sbjct 601 NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY 660 Query 690 DMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG 749 DMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG Sbjct 661 DMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG 720 Query 750 IKKILIFSKKGYEIG 764 IKKILIFSKKGYEIG Sbjct 721 IKKILIFSKKGYEIG 735 >pdb|1ACC| Related structures Chain , Anthrax Protective Antigen Length=735 Score = 1338 bits (3462), Expect = 0.0, Method: Composition-based stats. Identities = 734/735 (99%), Positives = 735/735 (100%), Gaps = 0/735 (0%) Query 30 EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF 89 EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF Sbjct 1 EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF 60 Query 90 QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY 149 QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY Sbjct 61 QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY 120 Query 150 QRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDN 209 QRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDN Sbjct 121 QRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDN 180 Query 210 DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT 269 DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT Sbjct 181 DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT 240 Query 270 GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHT 329 GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDS+TRTISKNTSTSRTHT Sbjct 241 GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSETRTISKNTSTSRTHT 300 Query 330 SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL 389 SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL Sbjct 301 SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL 360 Query 390 NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA 449 NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA Sbjct 361 NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA 420 Query 450 LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV 509 LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV Sbjct 421 LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV 480 Query 510 LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL 569 LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL Sbjct 481 LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL 540 Query 570 QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR 629 QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR Sbjct 541 QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR 600 Query 630 NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY 689 NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY Sbjct 601 NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY 660 Query 690 DMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG 749 DMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG Sbjct 661 DMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG 720 Query 750 IKKILIFSKKGYEIG 764 IKKILIFSKKGYEIG Sbjct 721 IKKILIFSKKGYEIG 735 >emb|CAL49462.1| protective antigen [Bacillus anthracis] Length=735 Score = 1333 bits (3451), Expect = 0.0, Method: Composition-based stats. Identities = 730/735 (99%), Positives = 735/735 (100%), Gaps = 0/735 (0%) Query 30 EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF 89 EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF Sbjct 1 EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF 60 Query 90 QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY 149 QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY Sbjct 61 QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY 120 Query 150 QRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDN 209 QRE+PTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNS+K+RSTSAGPTVPDRDN Sbjct 121 QREDPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSKKRRSTSAGPTVPDRDN 180 Query 210 DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT 269 DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT Sbjct 181 DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT 240 Query 270 GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHT 329 GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHT Sbjct 241 GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHT 300 Query 330 SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL 389 SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL Sbjct 301 SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL 360 Query 390 NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA 449 NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA Sbjct 361 NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA 420 Query 450 LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV 509 LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV Sbjct 421 LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV 480 Query 510 LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL 569 LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL Sbjct 481 LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL 540 Query 570 QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR 629 QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR Sbjct 541 QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR 600 Query 630 NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY 689 NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY Sbjct 601 NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY 660 Query 690 DMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG 749 DMLNISSL+QDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG Sbjct 661 DMLNISSLQQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG 720 Query 750 IKKILIFSKKGYEIG 764 IK+ILIFSKKGYEIG Sbjct 721 IKRILIFSKKGYEIG 735 >gb|ABA29778.1| hemaglutinin-neuraminidase/anthrax PA63 fusion protein [synthetic construct] Length=618 Score = 1045 bits (2701), Expect = 0.0, Method: Composition-based stats. Identities = 565/568 (99%), Positives = 566/568 (99%), Gaps = 0/568 (0%) Query 197 STSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWS 256 STSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWS Sbjct 51 STSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWS 110 Query 257 TASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTR 316 TASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDS+TR Sbjct 111 TASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSETR 170 Query 317 TISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWA 376 TISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWA Sbjct 171 TISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWA 230 Query 377 ETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAP 436 ETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKA ENQLSQILAP Sbjct 231 ETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKADENQLSQILAP 290 Query 437 NNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENG 496 NNYYPSKNLAPIALNAQ DFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENG Sbjct 291 NNYYPSKNLAPIALNAQKDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENG 350 Query 497 RVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEAL 556 RVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEAL Sbjct 351 RVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEAL 410 Query 557 KIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKM 616 KIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKM Sbjct 411 KIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKM 470 Query 617 NILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIE 676 NILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIE Sbjct 471 NILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIE 530 Query 677 DTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTI 736 DTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTI Sbjct 531 DTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTI 590 Query 737 INPSENGDTSTNGIKKILIFSKKGYEIG 764 INPSENGDTSTNGIKKILIFSKKGYEIG Sbjct 591 INPSENGDTSTNGIKKILIFSKKGYEIG 618 >pdb|1TZN|A Related structures Chain A, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor pdb|1TZN|B Related structures Chain B, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor pdb|1TZN|C Related structures Chain C, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor pdb|1TZN|D Related structures Chain D, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor pdb|1TZN|E Related structures Chain E, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor pdb|1TZN|F Related structures Chain F, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor pdb|1TZN|G Related structures Chain G, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor pdb|1TZN|H Related structures Chain H, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor pdb|1TZN|I Related structures Chain I, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor pdb|1TZN|J Related structures Chain J, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor pdb|1TZN|K Related structures Chain K, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor pdb|1TZN|L Related structures Chain L, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor pdb|1TZN|M Related structures Chain M, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor pdb|1TZN|O Related structures Chain O, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor pdb|1TZO|A Related structures Chain A, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore pdb|1TZO|B Related structures Chain B, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore pdb|1TZO|C Related structures Chain C, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore pdb|1TZO|D Related structures Chain D, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore pdb|1TZO|E Related structures Chain E, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore pdb|1TZO|F Related structures Chain F, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore pdb|1TZO|G Related structures Chain G, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore pdb|1TZO|H Related structures Chain H, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore pdb|1TZO|I Related structures Chain I, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore pdb|1TZO|J Related structures Chain J, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore pdb|1TZO|K Related structures Chain K, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore pdb|1TZO|L Related structures Chain L, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore pdb|1TZO|M Related structures Chain M, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore pdb|1TZO|O Related structures Chain O, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Length=562 Score = 1030 bits (2663), Expect = 0.0, Method: Composition-based stats. Identities = 562/562 (100%), Positives = 562/562 (100%), Gaps = 0/562 (0%) Query 203 TVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPY 262 TVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPY Sbjct 1 TVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPY 60 Query 263 SDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNT 322 SDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNT Sbjct 61 SDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNT 120 Query 323 STSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLN 382 STSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLN Sbjct 121 STSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLN 180 Query 383 TADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPS 442 TADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPS Sbjct 181 TADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPS 240 Query 443 KNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDT 502 KNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDT Sbjct 241 KNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDT 300 Query 503 GSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGF 562 GSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGF Sbjct 301 GSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGF 360 Query 563 NEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRD 622 NEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRD Sbjct 361 NEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRD 420 Query 623 KRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLK 682 KRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLK Sbjct 421 KRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLK 480 Query 683 EVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSEN 742 EVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSEN Sbjct 481 EVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSEN 540 Query 743 GDTSTNGIKKILIFSKKGYEIG 764 GDTSTNGIKKILIFSKKGYEIG Sbjct 541 GDTSTNGIKKILIFSKKGYEIG 562 >gb|AAX84029.1| protective antigen [Bacillus anthracis] Length=561 Score = 1030 bits (2662), Expect = 0.0, Method: Composition-based stats. Identities = 561/561 (100%), Positives = 561/561 (100%), Gaps = 0/561 (0%) Query 204 VPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYS 263 VPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYS Sbjct 1 VPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYS 60 Query 264 DFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTS 323 DFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTS Sbjct 61 DFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTS 120 Query 324 TSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNT 383 TSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNT Sbjct 121 TSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNT 180 Query 384 ADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSK 443 ADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSK Sbjct 181 ADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSK 240 Query 444 NLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTG 503 NLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTG Sbjct 241 NLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTG 300 Query 504 SNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFN 563 SNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFN Sbjct 301 SNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFN 360 Query 564 EPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDK 623 EPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDK Sbjct 361 EPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDK 420 Query 624 RFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKE 683 RFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKE Sbjct 421 RFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKE 480 Query 684 VINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENG 743 VINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENG Sbjct 481 VINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENG 540 Query 744 DTSTNGIKKILIFSKKGYEIG 764 DTSTNGIKKILIFSKKGYEIG Sbjct 541 DTSTNGIKKILIFSKKGYEIG 561 >ref|ZP_00236306.1| protective antigen [Bacillus cereus G9241] gb|EAL15944.1| protective antigen [Bacillus cereus G9241] Length=760 Score = 804 bits (2076), Expect = 0.0, Method: Composition-based stats. Identities = 456/761 (59%), Positives = 576/761 (75%), Gaps = 4/761 (0%) Query 1 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA 60 MKKRKV IPL+A+STIL +S NL +IQA QE+ +L E++SQGLLGYYF+DL+F+ Sbjct 1 MKKRKVFIPLLAVSTILAASPVNLNIIQANTTQEDSILQGKETNSQGLLGYYFNDLDFKN 60 Query 61 PMVVTSSTTGDLSIPSSELEN-IPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMW 119 P V+T+ TGDLSI +SE+E+ + +E QYFQSAIW+GF+ V+K EYTF+TS +NHVT+ Sbjct 61 PTVITTLETGDLSIDNSEIESTLSNEKQYFQSAIWTGFVNVEKDGEYTFSTSDNNHVTIS 120 Query 120 VDDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDN 179 V+DQEV+N+ S+ +KI LEKG+LY+I ++YQRE+P+EKG+ F+LYWT N E I Sbjct 121 VNDQEVMNRTSDLHKIWLEKGQLYEITVKYQRESPSEKGIGFQLYWTTPDNTTETIPKSK 180 Query 180 LQLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNI 239 L LP+LK KSS SR +RS + + D DNDGIPDSLE+EGYTVDVKNKR+ L+PW+ + Sbjct 181 LLLPKLKAKSSKSRTERSANMNREIVDEDNDGIPDSLEIEGYTVDVKNKRSILTPWVPTV 240 Query 240 HEKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENII 299 HEKKGL KY+SSP+KWSTASDPYSDFEKVTGRIDK VS EAR P +AA+P V VDME II Sbjct 241 HEKKGLRKYQSSPQKWSTASDPYSDFEKVTGRIDKKVSLEARDPRIAAFPNVTVDMEKII 300 Query 300 LSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSS 359 +SK ED+S Q SQ TIS TSTS+THT E H + HAS FD GGSVSAG SNSNSS Sbjct 301 ISKIEDKSKQQGGSQGNTISTGTSTSKTHTLEEHADVSFHASLFDFGGSVSAGISNSNSS 360 Query 360 TVAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQT 419 TV ID S S E++W+ET+G+NTAD A+LNANIR+ NTGTAPIYN L TTSLVLG NQT Sbjct 361 TVTIDTSESTNIEKSWSETLGVNTADAAKLNANIRFKNTGTAPIYNALSTTSLVLGNNQT 420 Query 420 LATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRL 479 +ATIKAKENQ++Q++APN YYPSK LA I+LNAQDDFSSTPITMNYNQ +ELEKTK+LRL Sbjct 421 IATIKAKENQMAQLIAPNEYYPSKKLAAISLNAQDDFSSTPITMNYNQLMELEKTKKLRL 480 Query 480 DTDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNP 539 DTDQVYGNI +N GRV V+T NWS LPQI+ETTARII + + ERR+AAV+P Sbjct 481 DTDQVYGNIGEFNHSKGRVEVNTNLNWSNFLPQIEETTARIILQEDNNDSTERRVAAVDP 540 Query 540 SDPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELN 599 +D LE TKPD+TLKEALK+A+GF E N L+Y+ KDI+ F+F FD++T+QNI+ QL Sbjct 541 NDFLEMTKPDVTLKEALKLAYGFKEENRQLKYKEKDISRFEFVFDKETNQNIQQQLKGRK 600 Query 600 ATNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLN 659 NIY LD I+LNAKMNIL+RD F Y + VGA++ +K H++VI S E L Sbjct 601 FKNIYEALDNIQLNAKMNILVRDANFRY-VDGKRVGANDWFIKTTHQQVIKWSEESATLK 659 Query 660 IDKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYIS 719 IDK+ ++++GY++EI + G KE++N RYD ++I S+ +DG F+DFKK+ND PL I+ Sbjct 660 IDKNTTEMMAGYLIEIVEPSGKKELVNSRYDSIDIFSILKDGTVFLDFKKHNDNTPLRIN 719 Query 720 NPNYKVNVYAVTKENTIINPSENGDTSTNGIKK-ILIFSKK 759 N VN+YA+TKE + E + N +K +L+ S K Sbjct 720 NGE-TVNIYAITKERKNLAIEEGRFPNINDSEKGVLVLSLK 759 >dbj|BAD14937.1| pagA [Bacillus anthracis] Length=240 Score = 437 bits (1125), Expect = 1e-120, Method: Composition-based stats. Identities = 238/240 (99%), Positives = 240/240 (100%), Gaps = 0/240 (0%) Query 195 KRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEK 254 KRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEK Sbjct 1 KRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEK 60 Query 255 WSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQ 314 WSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVD+ENIILSKNEDQSTQNTDSQ Sbjct 61 WSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDIENIILSKNEDQSTQNTDSQ 120 Query 315 TRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERT 374 TRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERT Sbjct 121 TRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERT 180 Query 375 WAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQIL 434 WAETMGLNTADTARLNA+IRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQIL Sbjct 181 WAETMGLNTADTARLNADIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQIL 240 >emb|CAA66612.1| Sb component [Clostridium spiroforme] Length=879 Score = 280 bits (717), Expect = 2e-73, Method: Composition-based stats. Identities = 225/624 (36%), Positives = 342/624 (54%), Gaps = 55/624 (8%) Query 26 VIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSE 85 + Q QE NE SS GL+GYYF+D +F+ ++ G+L +++E + +E Sbjct 29 ITQNYDNQEVETTNEKTVSSNGLMGYYFADEHFKDLELMAPVKNGELKFEKNKVEKLLTE 88 Query 86 NQY-FQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQ 144 + +S W+G I K EYT +T DN V M ++ + I +N+ K+ + KG+ Y Sbjct 89 EKTNIKSIRWTGRIIPSKDGEYTLSTDKDN-VLMQINAEGEI---ANTLKVNMIKGQEYS 144 Query 145 IKIQYQRENP--TEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSN----------- 191 I+I+ Q ++ + KLYW + K +I NL L + + N Sbjct 145 IRIEIQDKDIGYVDDLSSPKLYW-ELNGDKTLIPEKNLFLRDYSKIDENDPFIPKDNFFD 203 Query 192 ----SRKKRSTSA-GPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLT 246 SR R S G D DND IPD+ E GYT+ K + W + ++G Sbjct 204 LKLKSRSARLASGWGDEDLDTDNDNIPDAYEKNGYTI----KDSIAVKW-EDSFAQQGYK 258 Query 247 KYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQ 306 KY SS + +TA DPY+D++K +G DK + EAR PLVAAYP+V V ME +I+S NE Sbjct 259 KYLSSYLESNTAGDPYTDYQKASGSFDKAIKAEARDPLVAAYPVVGVGMEKLIISTNEHA 318 Query 307 STQNTDSQTRTISKNTSTSRT--HTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAID 364 ST Q +T+S+NT+ S+T +T+ V N F GS++ +S++ ++ A+ Sbjct 319 ST----DQGKTVSRNTTNSKTDANTAGVAINIAYQNGF---TGSITTNYSHTTENSTAVQ 371 Query 365 HSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIK 424 +S GE +W ++ +N ++A +NAN+RY NTGTAP+Y V PTT+LVL TL TIK Sbjct 372 NS---NGE-SWNTSLSINKGESAYINANVRYYNTGTAPMYKVTPTTNLVL-DGDTLTTIK 426 Query 425 AKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQV 484 A++NQ+ L+PN YP K L+P+ALN D FSS I +NY+Q +L+ KQ++L+T QV Sbjct 427 AQDNQIGNNLSPNETYPKKGLSPLALNTMDQFSSRLIPINYDQLKKLDAGKQIKLETTQV 486 Query 485 YGNIATYNFENGRVRVDT-GSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPL 543 GN Y +N + ++ T G++WS+ + QI +A II + ++ ERR+ A + S+P Sbjct 487 SGN---YGIKNSQGQIITEGNSWSDYISQIDSLSASIILDTGS-DVFERRVTAKDSSNPE 542 Query 544 ETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITE--FDFNFDQQTSQNIKNQLAELNAT 601 + T P +T+ EA++ AFG + L + G I E + FD T+ IK +L LN Sbjct 543 DKT-PVLTIGEAIEKAFGATKNGEILYFNGMPIDESCVELIFDGNTANLIKERLNALNDK 601 Query 602 NIYTVLDKIKLNAKMNILIRDKRF 625 IY V +L M ILI+ + Sbjct 602 KIYNV----QLERGMKILIKTSTY 621 >emb|CAA51960.1| iota toxin component Ib [Clostridium perfringens] Length=875 Score = 278 bits (710), Expect = 1e-72, Method: Composition-based stats. Identities = 218/610 (35%), Positives = 335/610 (54%), Gaps = 45/610 (7%) Query 28 QAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSE-N 86 Q + Q+ + NE+ SS GL+GYYF+D +F+ ++ GDL +++ + +E N Sbjct 33 QNDTNQKEEITNENTLSSNGLMGYYFADEHFKDLELMAPIKNGDLKFEEKKVDKLLTEDN 92 Query 87 QYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIK 146 +S W+G I + EY +T N V M ++ + I K + K+ ++KG+ Y I+ Sbjct 93 SSIKSIRWTGRIIPSEDGEYILSTDR-NDVLMQINAKGDIAK---TLKVNMKKGQAYNIR 148 Query 147 IQYQREN--PTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSR----------K 194 I+ Q +N + KLYW + NK VI +NL + + N + Sbjct 149 IEIQDKNLGSIDNLSVPKLYWELNGNKT-VIPEENLFFRDYSKIDENDPFIPNNNFFDVR 207 Query 195 KRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEK 254 S + D DND IPD+ E GYT+ K + W + E+ G KY SS + Sbjct 208 FFSAAWEDEDLDTDNDNIPDAYEKNGYTI----KDSIAVKWNDSFAEQ-GYKKYVSSYLE 262 Query 255 WSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQ 314 +TA DPY+D++K +G IDK + EAR PLVAAYP+V V MEN+I+S NE S+ Q Sbjct 263 SNTAGDPYTDYQKASGSIDKAIKLEARDPLVAAYPVVGVGMENLIISTNEHASS----DQ 318 Query 315 TRTISKNTSTSRTHTSEVHGNAEVHASFFD-IGGSVSAGFSNSNSSTVAIDHSLSLAGER 373 +T+S+ T+ S+T + V + A + + G+++ +S++ ++ A+ S Sbjct 319 GKTVSRATTNSKTDANTV--GVSISAGYQNGFTGNITTSYSHTTDNSTAVQDS----NGE 372 Query 374 TWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQI 433 +W + +N ++A +NAN+RY NTGTAP+Y V PTT+LVL +TLATIKA++NQ+ Sbjct 373 SWNTGLSINKGESAYINANVRYYNTGTAPMYKVTPTTNLVL-DGETLATIKAQDNQIGNN 431 Query 434 LAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNF 493 L+PN YP K L+P+ALN D F++ I +NY+Q +L+ KQ++L+T QV GN T N Sbjct 432 LSPNETYPKKGLSPLALNTMDQFNARLIPINYDQLKKLDSGKQIKLETTQVSGNYGTKN- 490 Query 494 ENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLK 553 G++ + G++WS + QI +A II + ERR+AA +P + T P++T+ Sbjct 491 SQGQI-ITEGNSWSNYISQIDSVSASIILDTGSQTF-ERRVAAKEQGNPEDKT-PEITIG 547 Query 554 EALKIAFGFNEPNGNLQYQGKDITE--FDFNFDQQTSQNIKNQLAELNATNIYTVLDKIK 611 EA+K AF + L + G I E + FD TS+ IK QL L+ IY V K Sbjct 548 EAIKKAFSATKNGELLYFNGIPIDESCVELIFDDNTSEIIKEQLKYLDDKKIYNV----K 603 Query 612 LNAKMNILIR 621 L MNILI+ Sbjct 604 LERGMNILIK 613 >gb|AAB67305.1| ADP-ribosyltransferase [Clostridium difficile] Length=876 Score = 277 bits (709), Expect = 2e-72, Method: Composition-based stats. Identities = 216/605 (35%), Positives = 334/605 (55%), Gaps = 46/605 (7%) Query 33 QENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQY-FQS 91 ++ ++NE + GL+GYYFSD +F+ ++ G+L +++ + +++ +S Sbjct 40 KKKEIVNEDILPNNGLMGYYFSDEHFKDLKLMAPIKDGNLKFEEKKVDKLLDKDKSDVKS 99 Query 92 AIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQYQR 151 W+G I K EYT +T D+ V M V+ + I SN+ K+ ++KG+ Y+++I+ Q Sbjct 100 IRWTGRIIPSKDGEYTLSTDRDD-VLMQVNTESTI---SNTLKVNMKKGKEYKVRIELQD 155 Query 152 EN--PTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNS---------RKKRSTSA 200 +N + LYW + K++I +NL L + + K + Sbjct 156 KNLGSIDNLSSPNLYW-ELDGMKKIIPEENLFLRDYSNIEKDDPFIPNNNFFDPKLMSDW 214 Query 201 GPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASD 260 D DND IPDS E GYT+ K W + E+ G KY S+ + +TA D Sbjct 215 EDEDLDTDNDNIPDSYERNGYTI----KDLIAVKWEDSFAEQ-GYKKYVSNYLESNTAGD 269 Query 261 PYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISK 320 PY+D+EK +G DK + EAR PLVAAYPIV V ME +I+S NE ST Q +T+S+ Sbjct 270 PYTDYEKASGSFDKAIKTEARDPLVAAYPIVGVGMEKLIISTNEHAST----DQGKTVSR 325 Query 321 NTSTSRT--HTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAET 378 T+ S+T +T+ V N F +V+ +S++ ++ A+ S +W Sbjct 326 ATTNSKTESNTAGVSVNVGYQNGF---TANVTTNYSHTTDNSTAVQDS----NGESWNTG 378 Query 379 MGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNN 438 + +N ++A +NAN+RY NTGTAP+Y V PTT+LVL TL+TIKA+ENQ+ L+P + Sbjct 379 LSINKGESAYINANVRYYNTGTAPMYKVTPTTNLVL-DGDTLSTIKAQENQIGNNLSPGD 437 Query 439 YYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRV 498 YP K L+P+ALN D FSS I +NY+Q +L+ KQ++L+T QV GN T N +G++ Sbjct 438 TYPKKGLSPLALNTMDQFSSRLIPINYDQLKKLDAGKQIKLETTQVSGNFGTKN-SSGQI 496 Query 499 RVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKI 558 V G++WS+ + QI +A II + ++ + ERR+ A N DP E P++T+ EA++ Sbjct 497 -VTEGNSWSDYISQIDSISASIILDTENESY-ERRVTAKNLQDP-EDKTPELTIGEAIEK 553 Query 559 AFGFNEPNGNLQYQGKDITE--FDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKM 616 AFG + +G L + I E + FD T+ IK+ L L+ IY V KL M Sbjct 554 AFGATKKDGLLYFNDIPIDESCVELIFDDNTANKIKDSLKTLSDKKIYNV----KLERGM 609 Query 617 NILIR 621 NILI+ Sbjct 610 NILIK 614 >gb|AAF81761.1|AF271719_2 CdtB [Clostridium difficile] Length=876 Score = 276 bits (706), Expect = 3e-72, Method: Composition-based stats. Identities = 215/605 (35%), Positives = 334/605 (55%), Gaps = 46/605 (7%) Query 33 QENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQY-FQS 91 ++ ++NE + GL+GYYF+D +F+ ++ G+L +++ + +++ +S Sbjct 40 KKKEIVNEDILPNNGLMGYYFTDEHFKDLKLMAPIKDGNLKFEEKKVDKLLDKDKSDVKS 99 Query 92 AIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQYQR 151 W+G I K EYT +T D+ V M V+ + I SN+ K+ ++KG+ Y+++I+ Q Sbjct 100 IRWTGRIIPSKDGEYTLSTDRDD-VLMQVNTESTI---SNTLKVNMKKGKEYKVRIELQD 155 Query 152 EN--PTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNS---------RKKRSTSA 200 +N + LYW + K++I +NL L + + K + Sbjct 156 KNLGSIDNLSSPNLYW-ELDGMKKIIPEENLFLRDYSNIEKDDPFIPNNNFFDPKLMSDW 214 Query 201 GPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASD 260 D DND IPDS E GYT+ K W + E+ G KY S+ + +TA D Sbjct 215 EDEDLDTDNDNIPDSYERNGYTI----KDLIAVKWEDSFAEQ-GYKKYVSNYLESNTAGD 269 Query 261 PYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISK 320 PY+D+EK +G DK + EAR PLVAAYPIV V ME +I+S NE ST Q +T+S+ Sbjct 270 PYTDYEKASGSFDKAIKTEARDPLVAAYPIVGVGMEKLIISTNEHAST----DQGKTVSR 325 Query 321 NTSTSRT--HTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAET 378 T+ S+T +T+ V N F +V+ +S++ ++ A+ S +W Sbjct 326 ATTNSKTESNTAGVSVNVGYQNGF---TANVTTNYSHTTDNSTAVQDS----NGESWNTG 378 Query 379 MGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNN 438 + +N ++A +NAN+RY NTGTAP+Y V PTT+LVL TL+TIKA+ENQ+ L+P + Sbjct 379 LSINKGESAYINANVRYYNTGTAPMYKVTPTTNLVL-DGDTLSTIKAQENQIGNNLSPGD 437 Query 439 YYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRV 498 YP K L+P+ALN D FSS I +NY+Q +L+ KQ++L+T QV GN T N +G++ Sbjct 438 TYPKKGLSPLALNTMDQFSSRLIPINYDQLKKLDAGKQIKLETTQVSGNFGTKN-SSGQI 496 Query 499 RVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKI 558 V G++WS+ + QI +A II + ++ + ERR+ A N DP E P++T+ EA++ Sbjct 497 -VTEGNSWSDYISQIDSISASIILDTENESY-ERRVTAKNLQDP-EDKTPELTIGEAIEK 553 Query 559 AFGFNEPNGNLQYQGKDITE--FDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKM 616 AFG + +G L + I E + FD T+ IK+ L L+ IY V KL M Sbjct 554 AFGATKKDGLLYFNDIPIDESCVELIFDDNTANKIKDSLKTLSDKKIYNV----KLERGM 609 Query 617 NILIR 621 NILI+ Sbjct 610 NILIK 614 >ref|ZP_01802068.1| hypothetical protein CdifQ_04003037 [Clostridium difficile QCD-32g58] Length=876 Score = 276 bits (706), Expect = 3e-72, Method: Composition-based stats. Identities = 215/605 (35%), Positives = 334/605 (55%), Gaps = 46/605 (7%) Query 33 QENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQY-FQS 91 ++ ++NE + GL+GYYF+D +F+ ++ G+L +++ + +++ +S Sbjct 40 KKKEIVNEDILPNNGLMGYYFTDEHFKDLKLMAPIKDGNLKFEEKKVDKLLDKDKSDVKS 99 Query 92 AIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQYQR 151 W+G I K EYT +T D+ V M V+ + I SN+ K+ ++KG+ Y+++I+ Q Sbjct 100 IRWTGRIIPSKDGEYTLSTDRDD-VLMQVNTESTI---SNTLKVNMKKGKEYKVRIELQD 155 Query 152 EN--PTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNS---------RKKRSTSA 200 +N + LYW + K++I +NL L + + K + Sbjct 156 KNLGSIDNLSSPNLYW-ELDGMKKIIPEENLFLRDYSNIEKDDPFIPNNNFFDPKLMSDW 214 Query 201 GPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASD 260 D DND IPDS E GYT+ K W + E+ G KY S+ + +TA D Sbjct 215 EDEDLDTDNDNIPDSYERNGYTI----KDLIAVKWEDSFAEQ-GYKKYVSNYLESNTAGD 269 Query 261 PYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISK 320 PY+D+EK +G DK + EAR PLVAAYPIV V ME +I+S NE ST Q +T+S+ Sbjct 270 PYTDYEKASGSFDKAIKTEARDPLVAAYPIVGVGMEKLIISTNEHAST----DQGKTVSR 325 Query 321 NTSTSRT--HTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAET 378 T+ S+T +T+ V N F +V+ +S++ ++ A+ S +W Sbjct 326 ATTNSKTESNTAGVSVNVGYQNGF---TANVTTNYSHTTDNSTAVQDS----NGESWNTG 378 Query 379 MGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNN 438 + +N ++A +NAN+RY NTGTAP+Y V PTT+LVL TL+TIKA+ENQ+ L+P + Sbjct 379 LSINKGESAYINANVRYYNTGTAPMYKVTPTTNLVL-DGDTLSTIKAQENQIGNNLSPGD 437 Query 439 YYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRV 498 YP K L+P+ALN D FSS I +NY+Q +L+ KQ++L+T QV GN T N +G++ Sbjct 438 TYPKKGLSPLALNTMDQFSSRLIPINYDQLKKLDAGKQIKLETTQVSGNFGTKN-SSGQI 496 Query 499 RVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKI 558 V G++WS+ + QI +A II + ++ + ERR+ A N DP E P++T+ EA++ Sbjct 497 -VTEGNSWSDYISQIDSISASIILDTENESY-ERRVTAKNLQDP-EDKTPELTIGEAIEK 553 Query 559 AFGFNEPNGNLQYQGKDITE--FDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKM 616 AFG + +G L + I E + FD T+ IK+ L L+ IY V KL M Sbjct 554 AFGATKKDGLLYFNDIPIDESCVELIFDDNTANKIKDSLKTLSDKKIYNV----KLERGM 609 Query 617 NILIR 621 NILI+ Sbjct 610 NILIK 614 >pdb|2J42|A Related structures Chain A, Low Quality Crystal Structure Of The Transport Component C2- Ii Of The C2-Toxin From Clostridium Botulinum Length=721 Score = 262 bits (670), Expect = 5e-68, Method: Composition-based stats. Identities = 219/627 (34%), Positives = 343/627 (54%), Gaps = 48/627 (7%) Query 32 KQENRLLNESES--SSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF 89 K EN + N +++ + GL+GYYF + +F +++ + G+L+ ++ +I N+ Sbjct 5 KFENSVKNSNKNYFTINGLMGYYFEN-DFFNLNIISPTLDGNLTFSKEDINSILG-NKII 62 Query 90 QSAIWSGFIKVKKSDEYTFATSADN-HVTMWVDDQEVINKASN-SNKIRLEKGRLYQIKI 147 +SA W G IK + EY +T++ N V + + E+ N + N SN + L +G +Y I+I Sbjct 63 KSARWIGLIKPSITGEYILSTNSPNCRVEL---NGEIFNLSLNTSNTVNLIQGNVYDIRI 119 Query 148 -QYQRENPTEKGLD-FKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTV- 204 Q EN K + KLYW S KE+I S+ L LK SN+ +K T+ Sbjct 120 EQLMSENQLLKNYEGIKLYWETSDIIKEIIPSEVL----LKPNYSNTNEKSKFIPNNTLF 175 Query 205 ----------PDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEK 254 D D DGIPD E+ GYTV + + + +N G KY S+P K Sbjct 176 SNAKLKANANRDTDRDGIPDEWEINGYTVMNQKAVAWDDKFAAN-----GYKKYVSNPFK 230 Query 255 WSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQ 314 TA+DPY+DFEKV+G+ID +VS AR P+++AYPIV V ME +++SK+E + +T S Sbjct 231 PCTANDPYTDFEKVSGQIDPSVSMVARDPMISAYPIVGVQMERLVVSKSETITGDSTKSM 290 Query 315 TRTISKNTSTSRTHTSEVHGNAEVHASFFDI-GGSVSAGFSNSNSSTVAIDHSLSLAGER 373 +++ S +++ T +EV G+ ++ F + S SA +S++ +T +D + GE Sbjct 291 SKSTSHSSTNINTVGAEVSGSLQLAGGIFPVFSMSASANYSHTWQNTSTVDDT---TGE- 346 Query 374 TWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQI 433 ++++ + +NTA++A +N NIRY NTGTAP+YNV PTT++V+ K Q++ATIK +E+ + Sbjct 347 SFSQGLSINTAESAYINPNIRYYNTGTAPVYNVTPTTTIVIDK-QSVATIKGQESLIGDY 405 Query 434 LAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNF 493 L P YP P+ALN D FSS I +NYNQ ++ + L T Q GN A YN Sbjct 406 LNPGGTYPIIGEPPMALNTMDQFSSRLIPINYNQLKSIDNGGTVMLSTSQFTGNFAKYN- 464 Query 494 ENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLK 553 NG + D G+NW L I+ TTA + + D + + A N SDP E P +TL+ Sbjct 465 SNGNLVTD-GNNWGPYLGTIKSTTASLTLSLPD-QTTQVAVVAPNFSDP-EDKTPRLTLE 521 Query 554 EALKIAFGFNEPNGNLQYQGKDIT---EFDFNFDQQTSQNIKNQLAELNATNIYTVLDKI 610 +AL AF + NG + G +I+ + D+ T+ + +NQL +I + I Sbjct 522 QALVKAFRLEKKNGKFYFHGMEISANQKIQVFLDRNTNVDFENQLKNTANKDIMNCI--I 579 Query 611 KLNAKMNILIRDKRFHYDRNNIAVGAD 637 K N MNIL++ F + ++I + D Sbjct 580 KRN--MNILVKVITFKENISSINIIND 604 >dbj|BAA32537.1| C2 toxin (component-II) [Clostridium botulinum] Length=721 Score = 259 bits (662), Expect = 5e-67, Method: Composition-based stats. Identities = 219/629 (34%), Positives = 344/629 (54%), Gaps = 52/629 (8%) Query 32 KQENRLLNESES--SSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF 89 K EN + N +++ + GL+GYYF + +F +++ + G+L+ ++ +I N+ Sbjct 5 KFENSVKNSNKNYFTINGLMGYYFEN-DFFNLNIISPTLDGNLTFSKEDINSILG-NKII 62 Query 90 QSAIWSGFIKVKKSDEYTFATSADN-HVTMWVDDQEVINKASN-SNKIRLEKGRLYQIKI 147 +SA W G IK + EY +T++ N V + + E+ N + N SN + L +G +Y I+I Sbjct 63 KSARWIGLIKPSITGEYILSTNSPNCRVEL---NGEIFNLSLNTSNTVNLIQGNVYDIRI 119 Query 148 -QYQRENPTEKGLD-FKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTV- 204 Q EN K + KLYW S KE+I S+ L LK SN+ +K T+ Sbjct 120 EQLMSENQLLKNYEGIKLYWETSDIIKEIIPSEVL----LKPNYSNTNEKSKFIPNNTLF 175 Query 205 ----------PDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEK 254 D D DGIPD E+ GYTV + + + +N G KY S+P K Sbjct 176 SNAKLKANANRDTDRDGIPDEWEINGYTVMNQKAVAWDDKFAAN-----GYKKYVSNPFK 230 Query 255 WSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQ 314 TA+DPY+DFEKV+G+ID +VS AR P+++AYPIV V ME +++SK+E + +T S Sbjct 231 PCTANDPYTDFEKVSGQIDPSVSMVARDPMISAYPIVGVQMERLVVSKSETITGDSTKSM 290 Query 315 TRTISKNTSTSRTHTSEVHGNAEVHASFFDI-GGSVSAGFSNSNSSTVAIDHSLSLAGER 373 +++ S +++ T +EV G+ ++ F + S SA +S++ +T +D + GE Sbjct 291 SKSTSHSSTNINTVGAEVSGSLQLAGGIFPVFSMSASANYSHTWQNTSTVDDT---TGE- 346 Query 374 TWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQI 433 ++++ + +NT ++A +N NIRY NTGTAP+YNV PTT++V+ K Q++ATIK +E+ + Sbjct 347 SFSQGLSINTGESAYINPNIRYYNTGTAPVYNVTPTTTIVIDK-QSVATIKGQESLIGDY 405 Query 434 LAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNF 493 L P YP P+ALN D FSS I +NYNQ ++ + L T Q GN A YN Sbjct 406 LNPGGTYPIIGEPPMALNTMDQFSSRLIPINYNQLKSIDNGGTVMLSTSQFTGNFAKYN- 464 Query 494 ENGRVRVDTGSNWSEVLPQIQETTARII--FNGKDLNLVERRIAAVNPSDPLETTKPDMT 551 NG + D G+NW L I+ TTA + F+G+ + + A N SDP + T P +T Sbjct 465 SNGNLVTD-GNNWGPYLGTIKSTTASLTLSFSGQTTQVA---VVAPNFSDPEDKT-PKLT 519 Query 552 LKEALKIAFGFNEPNGNLQYQGKDIT---EFDFNFDQQTSQNIKNQLAELNATNIYTVLD 608 L++AL AF + NG + G +I+ + D T+ + +NQL +I + Sbjct 520 LEQALVKAFALEKKNGKFYFHGLEISKNEKIQVFLDSNTNNDFENQLKNTADKDIMHCI- 578 Query 609 KIKLNAKMNILIRDKRFHYDRNNIAVGAD 637 IK N MNIL++ F + ++I + D Sbjct 579 -IKRN--MNILVKVITFKENISSINIIND 604 >emb|CAI43278.1| Isp1b protein [Brevibacillus laterosporus] Length=785 Score = 247 bits (630), Expect = 2e-63, Method: Composition-based stats. Identities = 200/614 (32%), Positives = 306/614 (49%), Gaps = 51/614 (8%) Query 28 QAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENI-PSEN 86 Q QEN+ E E +GLLGYYF F + + L ++ + + Sbjct 37 QLSTAQENQ---EKEVDRKGLLGYYFKGKEFNHLTLFAPTRDNTLIYDQQTVDFLLDKKQ 93 Query 87 QYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIK 146 Q +QS W G I+ K++ ++TF S D + + +D + + +K N + LEKG+L IK Sbjct 94 QEYQSIRWIGLIQSKETGDFTFNLSDDKNAIIEIDGKTISHKGQNKQVVHLEKGKLVPIK 153 Query 147 IQYQRENPTEKGL----DFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAG- 201 I+YQ + + +FKL+ DSQ + + D L+ PE +K + ++++ Sbjct 154 IEYQSDQIVNRDSKIFKEFKLFKVDSQQQSHQVQLDELRNPEFNKKETQQFLEKASKTNI 213 Query 202 --------PTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPE 253 D D D IPD E GYT+ K + + + KG TK+ S+P Sbjct 214 FTQNMKRDEDATDTDGDSIPDLWEENGYTIQNKVAVKWDDSFAA-----KGYTKFVSNPF 268 Query 254 KWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDS 313 T DPY+D+EK +D + E +PLVAA+P V+V++E +ILS NED S Sbjct 269 DSHTVGDPYTDYEKAARDLDLANAKETFNPLVAAFPSVNVNLEKVILSPNEDLSN----- 323 Query 314 QTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGER 373 ++ ++ST+ ++T+ + E + I VSA + +S TVA + S Sbjct 324 ---SVESHSSTNWSYTNTEGASIEAGSGPLGISYGVSANY--QHSETVAKEWGTST---- 374 Query 374 TWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQI 433 T NTA LNAN+RY N GT IY V PTT VL N T+ATI AK N + Sbjct 375 --GNTSQFNTASAGYLNANVRYNNVGTGAIYEVKPTTGFVL-DNDTVATITAKSNSTALS 431 Query 434 LAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNF 493 ++P YP K IA+N DDF+S PIT+N Q ++ K L L+T+Q G Y Sbjct 432 ISPGESYPKKGQNGIAINTMDDFNSHPITLNKQQLDQIFNNKPLMLETNQADG---VYKI 488 Query 494 ENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLK 553 ++ + TG W+ V+ QIQ TA II + + + E+R+AA + +P + T P ++LK Sbjct 489 KDTSGNIVTGGEWNGVIQQIQAKTASIIVDTGE-GVSEKRVAAKDYDNPEDKT-PSLSLK 546 Query 554 EALKIAF--GFNEPNGNLQYQGKDITEFDF--NFDQQTSQNIKNQLAELNA--TNIYTVL 607 EALK+ + E +G L Y K I E D+ T++ +K QL ++ ++ + Sbjct 547 EALKLGYPEEIKEKDGLLYYNDKPIYESSVMTYLDENTAKEVKEQLNDITGKFKDVKQLF 606 Query 608 DKIKLNAKMNILIR 621 D +KL KMN I+ Sbjct 607 D-VKLTPKMNFTIK 619 >prf||2005240A protective antigen Length=127 Score = 236 bits (601), Expect = 6e-60, Method: Composition-based stats. Identities = 127/127 (100%), Positives = 127/127 (100%), Gaps = 0/127 (0%) Query 1 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA 60 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA Sbjct 1 MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA 60 Query 61 PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV 120 PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV Sbjct 61 PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV 120 Query 121 DDQEVIN 127 DDQEVIN Sbjct 121 DDQEVIN 127 >emb|CAI40767.1| Isp1a protein [Brevibacillus laterosporus] Length=871 Score = 233 bits (593), Expect = 5e-59, Method: Composition-based stats. Identities = 210/657 (31%), Positives = 327/657 (49%), Gaps = 71/657 (10%) Query 1 MKKRKVLIPLMALSTILVSS--TGNLEVIQAEVKQENRLLNESESSS------QGLLGYY 52 MK K + + + T+ S GN+ + A K N++ +++S +GLLGYY Sbjct 1 MKYMKKGLSSVVIGTLFASMFLNGNVNAVYANSKT-NQIATTTQASKDNQIDREGLLGYY 59 Query 53 FSDLNFQAPMVVTSSTTGDLSIPSSELEN--IPSENQYFQSAIWSGFIKVKKSDEYTFAT 110 F +F + + + T + I + N + ++Q + S W G I+ + ++TF Sbjct 60 FKGKDFN-DLTLFAPTRDNTLIYDQQTANTLVDQKHQEYHSIRWIGLIQSSATGDFTFKL 118 Query 111 SADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQYQRENP----TEKGLDFKLYWT 166 S D + + +D + + K +N + LEKG+L QIKI+YQ ++ + + KL+ Sbjct 119 SDDENAIIELDGKVISEKGNNKQSVHLEKGQLVQIKIEYQSDDALHIDNKIFKELKLFKI 178 Query 167 DSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTV----------PDRDNDGIPDSL 216 DSQN + + D L+ PE +K + K+++ D D D IPD Sbjct 179 DSQNHSQQVQQDELRNPEFNKKETQVFLKKASKTNLFTQKTKRDIDEDTDTDGDSIPDVW 238 Query 217 EVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNV 276 E GYT+ K W ++ KG K+ S+P + T DPYSD+EK + + Sbjct 239 EENGYTIQNK----VAVKWDDSL-ASKGYQKFTSNPLEAHTVGDPYSDYEKAARDMPLSN 293 Query 277 SPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNA 336 + E +PLVAA+P V+V +E +ILSKNED S SQ+ T+ S T+T V+ NA Sbjct 294 AKETFNPLVAAFPSVNVSLEKVILSKNEDLSHSVESSQS------TNWSYTNTEGVNVNA 347 Query 337 EVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMG--LNTADTARLNANIR 394 +G S +V HS ++A E A G +N A++A LNAN+R Sbjct 348 G------------WSGLGPSFGVSVNYQHSETVANEWGSATNDGTHINGAESAYLNANVR 395 Query 395 YVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIALNAQD 454 Y N GT IY PTTS +L T+ TIKAKEN + + P+ YP K IA+N D Sbjct 396 YNNVGTGAIYETKPTTSFIL-DGTTIGTIKAKENTTALTILPDQSYPEKGKNGIAINTMD 454 Query 455 DFSSTPITMNYNQF-LELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEVLPQI 513 DF+S PI +N Q L K + L+TDQV G A + NG + + +W+ + +I Sbjct 455 DFNSRPIPLNKEQLNTYLSNKKPILLETDQVEGKYAIKD-TNGNITI--AGDWNGITDEI 511 Query 514 QETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAF--GFNEPNGNLQY 571 TA II + + + E+R+AA + ++P + T P++++KEALK+A+ E +G L Y Sbjct 512 SAKTASIIVDNGN-QMSEKRVAAKDYTNPEDKT-PNLSVKEALKLAYPDEIEEKDGLLFY 569 Query 572 QGKDITEFDFN--FDQQTSQNIKNQLAELNAT-----NIYTVLDKIKLNAKMNILIR 621 + I E D+ T++ I+ QL + + N+Y V KL KMN I+ Sbjct 570 NDQPIFEASVQSYVDEYTAKQIRKQLNDSTGSFKDVKNLYDV----KLEPKMNFTIK 622 >gb|AAO86514.1| Vip1Ac [Bacillus thuringiensis] Length=775 Score = 228 bits (580), Expect = 1e-57, Method: Composition-based stats. Identities = 192/629 (30%), Positives = 312/629 (49%), Gaps = 75/629 (11%) Query 28 QAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELEN--IPSE 85 Q Q+N+ + E +GLLGYYF +F + + + + T + I + N + + Sbjct 37 QISTTQKNQ---QKEMDRKGLLGYYFKGKDF-SNLTMFAPTRDNTLIYDQQTANKLLDKK 92 Query 86 NQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQI 145 Q +QS W G I+ K+ ++TF S D + +D + + NK + LEK +L I Sbjct 93 QQQYQSIRWIGLIQSKEKGDFTFNLSEDEQAIIEIDGKIISNKGKEKQVVHLEKEKLVPI 152 Query 146 KIQYQRENP----TEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAG 201 KI+YQ + ++ +FKL+ DSQN+ + + D L+ PE +K S +++ Sbjct 153 KIEYQSDTKFNIDSKTFKEFKLFKIDSQNQSQQVKRDELRNPEFNKKESREFLAKASKTN 212 Query 202 PTV----------PDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSS 251 + D D D IPD E GYT+ K W + ++G KY SS Sbjct 213 FFMQKMKRDIDEDTDTDGDSIPDLWEENGYTIQNK----VAVKW-DDKFAQQGYVKYLSS 267 Query 252 PEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNT 311 P + T DPY+D+EK G I K+ + R+PLVAA+P ++VDM +ILSK+ + S Sbjct 268 PYQAHTVGDPYTDWEKAAGDIPKSNAAATRNPLVAAFPSINVDMRKMILSKDSNLS---- 323 Query 312 DSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSS---TVAIDHSLS 368 N++ + ++ S + N+E G S+ AGF S + H+ + Sbjct 324 ---------NSAEAHSNNSYTYANSE--------GASIEAGFGPKGFSFGVSANYQHTET 366 Query 369 LAGE--RTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAK 426 + + + + T N+A LNAN+ Y N GT IY+ PTTS +L ++ T+ATI AK Sbjct 367 VGSDWGNSKSNTEQFNSASAGYLNANVHYNNVGTGGIYDAQPTTSFIL-QDSTIATITAK 425 Query 427 ENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYG 486 N + + + YP+ I+L DDF+S PIT+N Q + + ++++TDQ G Sbjct 426 SNATALSIPSGDRYPASKEG-ISLKTMDDFNSHPITLNKPQLDAVLNNEVIKINTDQTDG 484 Query 487 NIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETT 546 + + + G WS ++ +I+ TA II + D +E RIAA + +P + T Sbjct 485 RYGIIGVDG---KAEIGDRWSPIIDEIKGRTASIIIDPADGKALETRIAAKDYKNPEDKT 541 Query 547 KPDMTLKEALKIAFGFN---EPNGNLQYQGKD----ITEFDFN-------FDQQTSQNIK 592 P +T+KE LKIA+ + + +G L Y+ K+ +T+ + D+ TS+ + Sbjct 542 -PSLTIKEGLKIAYPESISEDKDGILFYEYKNDEGKVTKKQLSEENIMPYLDEDTSKEFE 600 Query 593 NQLAELNATNIYTVLDKIKLNAKMNILIR 621 QL++ +A +Y IKL KMNI IR Sbjct 601 RQLSDGSAKGLY----DIKLTPKMNITIR 625 >emb|CAK99632.1| hypothetical bacterial binary exotoxin b protein [Spiroplasma citri] Length=438 Score = 202 bits (514), Expect = 7e-50, Method: Composition-based stats. Identities = 136/367 (37%), Positives = 201/367 (54%), Gaps = 19/367 (5%) Query 206 DRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDF 265 D D+DGIPD E+ GYTV+ + + PW H+ KYKS P T DPYSD Sbjct 26 DSDDDGIPDCWEINGYTVE----KGLIVPWDDKKHKTGKFIKYKSDPYNSHTTGDPYSDA 81 Query 266 EKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDS----QTRTISKN 321 EKV G+ID+ V PEA HPLVAAYP + V M +ILS N + + + S ++ TIS + Sbjct 82 EKVLGKIDQGVLPEAHHPLVAAYPKIGVMMNKMILSNNFNVTNEEGRSVGQQKSNTISVS 141 Query 322 TSTSRTHTSEVHGNAEVHASFF---DIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAET 378 TS+S T + V + S F + ++S +S++ SS + ++ S +TW + Sbjct 142 TSSSNTEATTVGASVSAEISLFPSLSVSANISHEWSSTVSSEHSSSNTSSEEQGQTWTHS 201 Query 379 MGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQ---TLATIKAKENQLSQILA 435 +G+NT++ A LN N++Y+N GTAPIY V PT + VLG + T+ATI AK N + ++ Sbjct 202 LGINTSEVAYLNGNVKYLNVGTAPIYEVCPTLNFVLGIGELSNTIATIIAKSNTTANVIL 261 Query 436 PNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFEN 495 P +P K IA N D+F+S PI +NY Q L+ L++ T Q G TY + Sbjct 262 PGAIFPDKVQNSIAWNTIDNFNSQPIKLNYEQVEALQTGVPLQIQTIQTSGLYKTYTADM 321 Query 496 GRVRVDTGSNWSEVLPQIQETTA--RIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLK 553 + V+ W ++ I TA +IF D+ ERR++ + + +P++TL Sbjct 322 LPM-VNEYQKWEHIMVDIYNRTACLNLIFENGDIQ--ERRVSVRKEDNYDDQLQPELTLG 378 Query 554 EALKIAF 560 EA +IAF Sbjct 379 EAFQIAF 385 >ref|NP_652919.1| Gene info protective antigen-related protein, [Bacillus anthracis str. A2012] ref|YP_016494.2| Gene info protective antigen-related protein, (pxo1-111) [Bacillus anthracis str. 'Ames Ancestor'] sp|P13422|Y6163_BACAN Hypothetical protein pXO1-111/BXA0163/GBAA_pXO1_0163 gb|AAM26108.1| Gene info protective antigen-related protein, (pXO1-111) [Bacillus anthracis str. A2012] gb|AAT28903.2| Gene info protective antigen-related protein, (pXO1-111) [Bacillus anthracis str. 'Ames Ancestor'] Length=225 Score = 102 bits (253), Expect = 1e-19, Method: Composition-based stats. Identities = 68/183 (37%), Positives = 106/183 (57%), Gaps = 23/183 (12%) Query 595 LAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTE 654 + L NIY LD+IKLNAKMNIL+RD +HYD N VG D+S +K A+++++N S++ Sbjct 1 MESLGINNIYNALDRIKLNAKMNILVRDP-YHYDNNGNIVGVDDSYLKNAYKQILNWSSD 59 Query 655 GLLLNIDKDIRKILSGYIVEIEDTE-------------GLKEVINDRYDMLNISSLRQDG 701 G+ LN+D+D+ + LSGY+++I+ G + + Y +L+ DG Sbjct 60 GVSLNLDEDVNQALSGYMLQIKKPSNHLTNSPVTITLAGKDSGVGELYRVLS------DG 113 Query 702 KTFIDFKKYNDKLPLYISNPNYKVNVYAVTKEN-TIINPSENGDTSTNGIKKILIFSKKG 760 F+DF K+++ + +P V VYAVTKE+ + ENG+ + N +K L+ S K Sbjct 114 TGFLDFNKFDENWRSLV-DPGDDVYVYAVTKEDFNAVTRDENGNIA-NKLKNTLVLSGKI 171 Query 761 YEI 763 EI Sbjct 172 KEI 174 >ref|NP_052807.1| Gene info hypothetical protein pxo1_111 [Bacillus anthracis] gb|AAD32415.1| Gene info pXO1-111 [Bacillus anthracis] Length=204 Score = 80.5 bits (197), Expect = 4e-13, Method: Composition-based stats. Identities = 56/162 (34%), Positives = 92/162 (56%), Gaps = 23/162 (14%) Query 616 MNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEI 675 MNIL+RD +HYD N VG D+S +K A+++++N S++G+ LN+D+D+ + LSGY+++I Sbjct 1 MNILVRDP-YHYDNNGNIVGVDDSYLKNAYKQILNWSSDGVSLNLDEDVNQALSGYMLQI 59 Query 676 EDTE-------------GLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPN 722 + G + + Y +L+ DG F+DF K+++ + +P Sbjct 60 KKPSNHLTNSPVTITLAGKDSGVGELYRVLS------DGTGFLDFNKFDENWRSLV-DPG 112 Query 723 YKVNVYAVTKEN-TIINPSENGDTSTNGIKKILIFSKKGYEI 763 V VYAVTKE+ + ENG+ + N +K L+ S K EI Sbjct 113 DDVYVYAVTKEDFNAVTRDENGNIA-NKLKNTLVLSGKIKEI 153 >gb|AAA22636.1| cryptic protein [Bacillus anthracis] Length=192 Score = 80.1 bits (196), Expect = 5e-13, Method: Composition-based stats. Identities = 56/162 (34%), Positives = 92/162 (56%), Gaps = 23/162 (14%) Query 616 MNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEI 675 MNIL+RD +HYD N VG D+S +K A+++++N S++G+ LN+D+D+ + LSGY+++I Sbjct 1 MNILVRDP-YHYDNNGNIVGVDDSYLKNAYKQILNWSSDGVSLNLDEDVNQALSGYMLQI 59 Query 676 EDTE-------------GLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPN 722 + G + + Y +L+ DG F+DF K+++ + +P Sbjct 60 KKPSNHLTNSPVTITLAGKDSGVGELYRVLS------DGAGFLDFNKFDENWRSLV-DPG 112 Query 723 YKVNVYAVTKEN-TIINPSENGDTSTNGIKKILIFSKKGYEI 763 V VYAVTKE+ + ENG+ + N +K L+ S K EI Sbjct 113 DDVYVYAVTKEDFNAVTRDENGNIA-NKLKNTLVLSGKIKEI 153 >ref|YP_001036747.1| Gene info PA14 [Clostridium thermocellum ATCC 27405] gb|ABN51554.1| Gene info PA14 [Clostridium thermocellum ATCC 27405] Length=644 Score = 58.9 bits (141), Expect = 1e-06, Method: Composition-based stats. Identities = 37/97 (38%), Positives = 54/97 (55%), Gaps = 10/97 (10%) Query 91 SAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVIN-------KASNSNKIRLEKGRLY 143 S W G I + ++EYTF T A+ V +W+++ +I+ +A NS KI L+ GR Y Sbjct 548 SVRWVGKIDTRYTEEYTFHTVANGGVRVWINNVLIIDNWQNQGKEAENSGKIELKAGRQY 607 Query 144 QIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL 180 IK++Y N E KL W+ + KKEV+ S NL Sbjct 608 DIKVEYC--NYGEPAF-IKLLWSSQRQKKEVVPSKNL 641 Score = 57.4 bits (137), Expect = 4e-06, Method: Composition-based stats. Identities = 44/156 (28%), Positives = 73/156 (46%), Gaps = 13/156 (8%) Query 44 SSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKS 103 + GL G Y+++++F V D + ++ Y S W+G ++ + S Sbjct 355 TGSGLRGEYYNNMDFSRFQFVRIDPCIDFDWGEGTPDQSIGKDTY--SVRWTGKVEPRYS 412 Query 104 DEYTFATSADNHVTMWVDDQEVINK------ASNSNKIRLEKGRLYQIKIQYQRENPTEK 157 + YTF T D+ V +WVD +I+K +S +I LE G+ Y IK++Y + + Sbjct 413 ETYTFYTVTDDGVRLWVDGVLLIDKWKSQSATEHSEQIYLEAGKKYDIKMEYYQH---VR 469 Query 158 GLDFKLYWTDSQNKKEVISSDNLQLPE--LKQKSSN 191 KL W+ +KE+I S L + L QK N Sbjct 470 AASAKLMWSSKSQQKEIIPSSQLYPSDGPLPQKDVN 505 >ref|ZP_00110033.1| COG2133: Glucose/sorbosone dehydrogenases [Nostoc punctiforme PCC 73102] Length=1162 Score = 55.1 bits (131), Expect = 2e-05, Method: Composition-based stats. Identities = 43/146 (29%), Positives = 68/146 (46%), Gaps = 15/146 (10%) Query 43 SSSQGLLGYYFSDLNFQAPMVVTSSTT--GDLSIPSSELENIPSENQYFQSAIWSGFIKV 100 S GL Y+ +++F V + T D S + P+ SA W+G ++ Sbjct 41 SQGDGLKAEYYDNIDFTNLKVTRTDATVNNDWGYGSPD----PTVGADTFSARWTGQVQA 96 Query 101 KKSDEYTFATSADNHVTMWVDDQEVINKASNSN------KIRLEKGRLYQIKIQYQRENP 154 K S+ Y F T+AD+ V +WV+ Q++IN+ N + I L G+ Y IK++Y Sbjct 97 KYSETYNFYTTADDGVRLWVNGQQIINQFVNQSATESVGSIALVAGQKYDIKLEYFENTV 156 Query 155 TEKGLDFKLYWTDSQNKKEVISSDNL 180 T KL W+ + KE+I L Sbjct 157 TAVS---KLAWSSANQTKEIIPQSQL 179 Score = 54.3 bits (129), Expect = 3e-05, Method: Composition-based stats. Identities = 47/179 (26%), Positives = 82/179 (45%), Gaps = 15/179 (8%) Query 10 LMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTT 69 + A+S + SS + I + + ++ + + GL Y+ +++F V + T Sbjct 156 VTAVSKLAWSSANQTKEIIPQSQLYSQSAGPAIGNGNGLKAEYYDNIDFTNLKVTRTDAT 215 Query 70 --GDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVIN 127 D S + P+ SA W+G ++ K S+ Y F T+AD+ V +WV+ Q++IN Sbjct 216 VNNDWGYGSPD----PTVGADTFSARWTGQVQAKYSETYNFYTTADDGVRLWVNGQQIIN 271 Query 128 KASNSN------KIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL 180 + N + I L G+ Y IK++Y T KL W+ + KE+I L Sbjct 272 QFVNQSATESVGSIALVAGQKYDIKLEYFENTVTAVS---KLAWSSATQTKEIIPQSQL 327 >emb|CAB61235.1| ADP-ribosyltransferase [Clostridium difficile] Length=149 Score = 53.9 bits (128), Expect = 4e-05, Method: Composition-based stats. Identities = 47/154 (30%), Positives = 73/154 (47%), Gaps = 17/154 (11%) Query 134 KIRLEKGRLYQIKIQYQREN--PTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSN 191 K+ ++KG+ Y+++I+ Q +N + LYW + K++I +NL L + N Sbjct 2 KVNMKKGKEYKVRIELQDKNLGSIDNLSSPNLYW-ELDGMKKIIPEENLFLRDYSNIEKN 60 Query 192 S---------RKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEK 242 K + D DND IPDS E GYT+ K W + E+ Sbjct 61 DPFIPNNNFFDPKLMSDWEDEDLDTDNDNIPDSYERNGYTI----KDLIAVKWEDSFAEQ 116 Query 243 KGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNV 276 G KY S+ + +TA DPY+D+EK +G DK + Sbjct 117 -GYKKYVSNYLESNTAGDPYTDYEKASGSFDKAI 149 >emb|CAB61234.1| ADP-ribosyltransferase [Clostridium difficile] Length=149 Score = 53.5 bits (127), Expect = 5e-05, Method: Composition-based stats. Identities = 47/154 (30%), Positives = 73/154 (47%), Gaps = 17/154 (11%) Query 134 KIRLEKGRLYQIKIQYQREN--PTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSN 191 K+ ++KG+ Y+++I+ Q +N + LYW + K++I +NL L + N Sbjct 2 KVNMKKGKEYKVRIELQDKNLGSIDNLSSPNLYW-ELDGIKKIIPEENLFLRDYSNIEKN 60 Query 192 S---------RKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEK 242 K + D DND IPDS E GYT+ K W + E+ Sbjct 61 DPFIPNNNFFDPKLMSDWEDEDLDTDNDNIPDSYERNGYTI----KDLIAVKWEDSFAEQ 116 Query 243 KGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNV 276 G KY S+ + +TA DPY+D+EK +G DK + Sbjct 117 -GYKKYVSNYLESNTAGDPYTDYEKASGSFDKAI 149 >emb|CAJ74877.1| unknown protein [Candidatus Kuenenia stuttgartiensis] Length=948 Score = 53.1 bits (126), Expect = 6e-05, Method: Composition-based stats. Identities = 45/182 (24%), Positives = 81/182 (44%), Gaps = 21/182 (11%) Query 20 STGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQ-APMVVTSSTTGDLSIPSSE 78 S G VI A + LN ++ GL Y+ + + P+ T + P++ Sbjct 776 SRGRESVIPARALLPQKPLNTLKNRQNGLSVKYYDTIEWHDEPIYEDIDTEIEFDWPNNS 835 Query 79 LENIPSENQYFQSA---IWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASN---- 131 ++F S IW GFI + +D YTF S+D+ +++++ +I+ + Sbjct 836 A-------KFFNSPFGIIWEGFINIDTADTYTFVLSSDDGSWLYINNALIIDNGGSHMVR 888 Query 132 --SNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKS 189 S + LEKG+ ++IKI+Y E + G F+L W +S I + + E + Sbjct 889 EKSGSVFLEKGK-HKIKIKYFDE---KGGAVFRLLWKNSDGSVVKIPVERFSVHENESSE 944 Query 190 SN 191 +N Sbjct 945 AN 946 Score = 37.4 bits (85), Expect = 3.6, Method: Composition-based stats. Identities = 31/113 (27%), Positives = 58/113 (51%), Gaps = 15/113 (13%) Query 91 SAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKA------SNSNKIRLEKGRLYQ 144 S + G+I +K + +YTF ++D+ +++++ +I+ S S I L+KG +++ Sbjct 696 SIAYEGYIIIKNAGQYTFTLASDDGSWLYINENLLIDNGGVHRVQSKSETITLKKG-VHK 754 Query 145 IKIQYQRENPTEKGLDFKLYWTD-SQNKKEVISSDNLQLPELKQKSSNSRKKR 196 + I+Y + G KL W S+ ++ VI + L L QK N+ K R Sbjct 755 MVIKYFDKG---GGAVLKLTWKPLSRGRESVIPARAL----LPQKPLNTLKNR 800 >emb|CAB61232.1| ADP-ribosyltransferase [Clostridium difficile] Length=149 Score = 52.8 bits (125), Expect = 8e-05, Method: Composition-based stats. Identities = 48/163 (29%), Positives = 74/163 (45%), Gaps = 35/163 (21%) Query 134 KIRLEKGRLYQIKIQYQREN--PTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSN 191 K+ ++KG+ Y+ +I+ Q +N + LYW + K++I ++NL L + N Sbjct 2 KVNMKKGKEYKFRIELQDKNLGSIDNLSSPNLYW-ELDGIKKIIPAENLFLRDYSNIEKN 60 Query 192 SRKKRSTSAGPTVP------------------DRDNDGIPDSLEVEGYTVDVKNKRTFLS 233 P +P D DND IPDS E GYT+ K Sbjct 61 D---------PFIPNNNFFDPRLMSDWEDEDLDTDNDNIPDSYERNGYTI----KDLIAV 107 Query 234 PWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNV 276 W + E+ G KY S+ + +TA DPY+D+EK +G DK + Sbjct 108 KWEDSFAEQ-GYKKYVSNYLESNTAGDPYTDYEKASGSFDKAI 149 >emb|CAB61233.1| ADP-ribosyltransferase [Clostridium difficile] Length=149 Score = 52.4 bits (124), Expect = 1e-04, Method: Composition-based stats. Identities = 46/154 (29%), Positives = 73/154 (47%), Gaps = 17/154 (11%) Query 134 KIRLEKGRLYQIKIQYQREN--PTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSN 191 K+ ++KG+ Y+++I+ Q +N + LYW + K++I +NL L + + Sbjct 2 KVNMKKGKEYKVRIELQDKNLGSIDNLSSPNLYW-ELDGMKKIIPEENLFLRDYSTIEKD 60 Query 192 S---------RKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEK 242 K + D DND IPDS E GYT+ K W + E+ Sbjct 61 DPFIPNNNFFDPKLMSDWEDEDLDTDNDNIPDSYERNGYTI----KDLIAVKWEDSFAEQ 116 Query 243 KGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNV 276 G KY S+ + +TA DPY+D+EK +G DK + Sbjct 117 -GYKKYVSNYLESNTAGDPYTDYEKASGSFDKAI 149 >ref|YP_373129.1| Gene info hypothetical protein Bcep18194_B2374 [Burkholderia sp. 383] gb|ABB12485.1| Gene info conserved hypothetical protein [Burkholderia sp. 383] Length=772 Score = 52.4 bits (124), Expect = 1e-04, Method: Composition-based stats. Identities = 33/139 (23%), Positives = 68/139 (48%), Gaps = 19/139 (13%) Query 20 STGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSEL 79 ST ++ + + R+LN + Y++D F P+ + + D + + Sbjct 606 STAEVQALASAFSSRLRVLNAT----------YYNDTTFTTPVFSSITPLVDFDLNTERG 655 Query 80 ENIPSENQYFQS---AI-WSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINK-----AS 130 + P ++ + AI W+G + + K+D YTF+ ++DN +W+D ++VI+K A+ Sbjct 656 TDSPDASKGMNATNYAIRWTGALDIPKADNYTFSVTSDNVARVWIDGRKVIDKEQPGLAT 715 Query 131 NSNKIRLEKGRLYQIKIQY 149 +I L + R I+++Y Sbjct 716 AKGRIHLAQKRNVPIRVEY 734 >ref|ZP_01182639.1| hypothetical protein BcerKBAB4DRAFT_5403 [Bacillus weihenstephanensis KBAB4] gb|EAR78181.1| hypothetical protein BcerKBAB4DRAFT_5403 [Bacillus weihenstephanensis KBAB4] Length=721 Score = 51.2 bits (121), Expect = 3e-04, Method: Composition-based stats. Identities = 57/237 (24%), Positives = 106/237 (44%), Gaps = 20/237 (8%) Query 206 DRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDF 265 D D DGI + LE+ GY ++ + + K K+ ++P ++ DP++D Sbjct 74 DWDQDGISNDLEIRGYKIEFNRQTGKNEAQAWDPERDKDKLKFITNPMSANSDGDPFTDA 133 Query 266 EKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTS 325 +V + + S +P+VA P + V ++ I ++ + N S + K+ ST Sbjct 134 YEV--QYYGSNSDTEFNPMVANIPNLQVGIKRIGVTPLAAITDSNGGSIDKGWEKSVSTQ 191 Query 326 RTHTSEVHGNAEVHASFF------DIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETM 379 + V S +VS G+S +++ T ++ W+ Sbjct 192 HSFGVGAGVEGGVEGSAAGPVPSGKASLNVSYGYSKTSTDTERYSSNID------WSTAK 245 Query 380 GLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKA-----KENQLS 431 +++A A+++ + Y NTGTA NV P ++ LG ++ ++T+KA K NQLS Sbjct 246 TVDSAKAAKVSLQLEYKNTGTASAQNVSPHFNIRLG-DKIISTVKATQDRYKANQLS 301 >emb|CAJ72575.1| unknown protein [Candidatus Kuenenia stuttgartiensis] Length=1336 Score = 50.8 bits (120), Expect = 3e-04, Method: Composition-based stats. Identities = 40/143 (27%), Positives = 70/143 (48%), Gaps = 14/143 (9%) Query 47 GLLGYYFSDLNFQAPMVVTSSTTGDLSIP-SSELENIPSENQYFQSAIWSGFIKVKKSDE 105 GL G YF+ NF+ ++ + D + +S + I +N S W G I++ +S + Sbjct 1200 GLKGSYFNGKNFEKFVLSRTDRKIDFNWGLNSPCQRINEDNF---SVRWDGLIRIDESGD 1256 Query 106 YTFATSADNHVTMWVDDQEVINK------ASNSNKIRLEKGRLYQIKIQYQRENPTEKGL 159 YTF T +D+ V + +D VI+ + ++I ++KG ++I I+Y N K Sbjct 1257 YTFYTVSDDGVRLKIDGYIVIDNWTKHSATEDKSEISMKKG-WHKISIEY---NDVGKSA 1312 Query 160 DFKLYWTDSQNKKEVISSDNLQL 182 KL W+ S K ++ S +L Sbjct 1313 RIKLLWSSSSINKSLVPSTHLSF 1335 Score = 50.8 bits (120), Expect = 3e-04, Method: Composition-based stats. Identities = 44/143 (30%), Positives = 70/143 (48%), Gaps = 18/143 (12%) Query 47 GLLGYYFSDLNFQAPMVVTSSTTGDLSIP---SSELENIPSENQYFQSAIWSGFIKVKKS 103 GL G YF+ NF+ V S T ++ +S + I +N Q W+G I++ +S Sbjct 1035 GLKGSYFNGKNFEK--FVLSRTDNKINFNWKRNSPCQGINKDNFSVQ---WNGLIRIDES 1089 Query 104 DEYTFATSADNHVTMWVDDQEVINK----ASNSNKIR--LEKGRLYQIKIQYQRENPTEK 157 +YTF T +D+ V + +D +I+ S NK + L KG ++I I+Y N T Sbjct 1090 GDYTFYTVSDDGVRLKIDGDMLIDNWTSHTSKENKAKRYLRKG-WHRIFIEY---NDTGY 1145 Query 158 GLDFKLYWTDSQNKKEVISSDNL 180 +L W+ S K ++ S NL Sbjct 1146 DAKIRLLWSSSSLNKSLVPSTNL 1168 >gb|AAZ39952.1| CdtB [Clostridium difficile] gb|AAZ39953.1| CdtB [Clostridium difficile] gb|AAZ39954.1| CdtB [Clostridium difficile] Length=145 Score = 50.4 bits (119), Expect = 4e-04, Method: Composition-based stats. Identities = 47/160 (29%), Positives = 72/160 (45%), Gaps = 35/160 (21%) Query 137 LEKGRLYQIKIQYQREN--PTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRK 194 ++KG+ Y+ +I+ Q +N + LYW + K++I ++NL L + N Sbjct 1 MKKGKEYKFRIELQDKNLGSIDNLSSPNLYW-ELDGIKKIIPAENLFLRDYSNIEKND-- 57 Query 195 KRSTSAGPTVP------------------DRDNDGIPDSLEVEGYTVDVKNKRTFLSPWI 236 P +P D DND IPDS E GYT+ K W Sbjct 58 -------PFIPNNNFFDPRLMSDWEDEDLDTDNDNIPDSYERNGYTI----KDLIAVKWE 106 Query 237 SNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNV 276 + E+ G KY S+ + +TA DPY+D+EK +G DK + Sbjct 107 DSFAEQ-GYKKYVSNYLESNTAGDPYTDYEKASGSFDKAI 145 >gb|AAZ39950.1| CdtB [Clostridium difficile] Length=145 Score = 50.1 bits (118), Expect = 5e-04, Method: Composition-based stats. Identities = 45/151 (29%), Positives = 71/151 (47%), Gaps = 17/151 (11%) Query 137 LEKGRLYQIKIQYQREN--PTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNS-- 192 ++KG+ Y+++I+ Q +N + LYW + K++I +NL L + + Sbjct 1 MKKGKEYKVRIELQDKNLGSIDNLSSPNLYW-ELDGMKKIIPEENLFLRDYSNIEKDDPF 59 Query 193 -------RKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGL 245 K + D DND IPDS E GYT+ K W + E+ G Sbjct 60 IPNNNFFDPKLMSDWEDEDLDTDNDNIPDSYERNGYTI----KDLIAVKWEDSFAEQ-GY 114 Query 246 TKYKSSPEKWSTASDPYSDFEKVTGRIDKNV 276 KY S+ + +TA DPY+D+EK +G DK + Sbjct 115 KKYVSNYLESNTAGDPYTDYEKASGSFDKAI 145 >gb|AAZ39951.1| CdtB [Clostridium difficile] Length=145 Score = 50.1 bits (118), Expect = 6e-04, Method: Composition-based stats. Identities = 45/151 (29%), Positives = 71/151 (47%), Gaps = 17/151 (11%) Query 137 LEKGRLYQIKIQYQREN--PTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNS-- 192 ++KG+ Y+++I+ Q +N + LYW + K++I +NL L + + Sbjct 1 MKKGKEYKVRIELQDKNLGSIDNLSSPNLYW-ELDGMKKIIPEENLFLRDYSTIEKDDPF 59 Query 193 -------RKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGL 245 K + D DND IPDS E GYT+ K W + E+ G Sbjct 60 IPNNNFFDPKLMSDWEDEDLDTDNDNIPDSYERNGYTI----KDLIAVKWEDSFAEQ-GY 114 Query 246 TKYKSSPEKWSTASDPYSDFEKVTGRIDKNV 276 KY S+ + +TA DPY+D+EK +G DK + Sbjct 115 KKYVSNYLESNTAGDPYTDYEKASGSFDKAI 145 >ref|YP_526620.1| Gene info hypothetical protein Sde_1146 [Saccharophagus degradans 2-40] gb|ABD80408.1| Gene info PA14 [Saccharophagus degradans 2-40] Length=1504 Score = 49.3 bits (116), Expect = 8e-04, Method: Composition-based stats. Identities = 37/141 (26%), Positives = 66/141 (46%), Gaps = 12/141 (8%) Query 18 VSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSS 77 V S + I A+ ++ S++ + GL G Y++ N + TT D + S Sbjct 470 VLSDTEVTTIMAQTHVCPTVMCASDAPASGLYGEYYNSTNLTGIPSTRTDTTIDFNWGSG 529 Query 78 E--LENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASN---- 131 + I S+N S W+G+++ +++ Y F T +D+ V +WVD VI+ +N Sbjct 530 SPGVTGIGSDNF---SIDWNGYVRAEETGTYFFQTESDDGVRLWVDGNLVIDNWTNHSPT 586 Query 132 ---SNKIRLEKGRLYQIKIQY 149 S + L G+ Y + +QY Sbjct 587 VNISTGVTLTAGQAYPVTLQY 607 Score = 48.1 bits (113), Expect = 0.002, Method: Composition-based stats. Identities = 33/115 (28%), Positives = 62/115 (53%), Gaps = 13/115 (11%) Query 45 SQGLLGYYFSDLNFQAPMV---VTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVK 101 + GL G Y++ ++F ++ V ++ D + + + NQ+ S W+G+I+V+ Sbjct 663 TPGLEGEYYNTVDFTGGVIGTRVDATVDYDWGTGPPGVTGV-NANQF--SVDWNGYIRVE 719 Query 102 KSDEYTFATSADNHVTMWVDDQEVINKASN-------SNKIRLEKGRLYQIKIQY 149 ++ Y+F T +D+ V +WV Q +IN S+ S+ I LE G Y I++Q+ Sbjct 720 ETGYYSFQTDSDDGVRLWVGGQLLINNWSDHAVVTDTSSGISLEAGETYPIQMQF 774 >ref|ZP_01576054.1| PA14 [Clostridium cellulolyticum H10] gb|EAV69816.1| PA14 [Clostridium cellulolyticum H10] Length=1172 Score = 48.9 bits (115), Expect = 0.001, Method: Composition-based stats. Identities = 32/114 (28%), Positives = 53/114 (46%), Gaps = 19/114 (16%) Query 83 PSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDD----------------QEVI 126 P N S +WSG+I + +YTF T D+ V +W+D Q+ Sbjct 606 PKVNADHYSVVWSGYIMPEFDADYTFYTRTDDGVKLWIDINRNGIFDINELLISNWQKHS 665 Query 127 NKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL 180 +NS +++EKG+ Y+I+++Y E KL W++ KEV+ + L Sbjct 666 ETENNSRSVQMEKGKKYRIRMEYYE---NEYDAVAKLLWSNPSKAKEVVPNSQL 716 >ref|YP_366068.1| Gene info beta-glucosidase precursor [Xanthomonas campestris pv. vesicatoria str. 85-10] emb|CAJ26068.1| Gene info beta-glucosidase precursor [Xanthomonas campestris pv. vesicatoria str. 85-10] Length=902 Score = 47.0 bits (110), Expect = 0.005, Method: Composition-based stats. Identities = 35/130 (26%), Positives = 63/130 (48%), Gaps = 24/130 (18%) Query 41 SESSSQGLLGYYFS--DLNFQAPMVVTSSTTG---DLSIPSSEL---------ENIPSEN 86 + S +GL G YF DL+ +V + G D P+ L E +P++N Sbjct 478 ANSPERGLRGEYFRNRDLSGTPALVRVDAQIGFKWDRGSPTDNLLARGEAGPSEAVPADN 537 Query 87 QYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNK-------IRLEK 139 S WSG + + Y +AD+ V +++D + VI++ S S++ ++L+ Sbjct 538 F---SIRWSGQLVPPTTGTYHLEAAADDGVRLYLDGKPVIDRWSTSDRLHADGVDVQLQA 594 Query 140 GRLYQIKIQY 149 GR YQ++++Y Sbjct 595 GRAYQVRLEY 604 >ref|NP_822148.1| Gene info hydrolase [Streptomyces avermitilis MA-4680] dbj|BAC68683.1| Gene info putative hydrolase [Streptomyces avermitilis MA-4680] Length=883 Score = 46.6 bits (109), Expect = 0.007, Method: Composition-based stats. Identities = 28/101 (27%), Positives = 44/101 (43%), Gaps = 10/101 (9%) Query 91 SAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVI-------NKASNSNKIRLEKGRLY 143 S W+G + +KS TF+ + DN +WVD + I ++ S + L GR Y Sbjct 104 SVRWTGEVVPEKSGPTTFSITGDNGFRLWVDGKLTIDHWVDDWDREQTSQPVDLTAGRAY 163 Query 144 QIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPE 184 IK++Y G + L WT K + +LP+ Sbjct 164 DIKVEYFEHF---GGSNLHLRWTPPGGSKSAVPQSAFRLPD 201 >ref|NP_644530.1| Gene info glucan 1,4-beta-glucosidase [Xanthomonas axonopodis pv. citri str. 306] gb|AAM39066.1| Gene info glucan 1,4-beta-glucosidase [Xanthomonas axonopodis pv. citri str. 306] Length=901 Score = 46.2 bits (108), Expect = 0.007, Method: Composition-based stats. Identities = 34/130 (26%), Positives = 64/130 (49%), Gaps = 24/130 (18%) Query 41 SESSSQGLLGYYFS--DLNFQAPMVVTSSTTG---DLSIPSSEL---------ENIPSEN 86 + S +GL G YF DL+ + +V + G D P+ L E +P++N Sbjct 477 ANSPERGLRGEYFRNRDLSGKPALVRVDAQIGFKWDRGSPTDNLLARGEAGPSEAVPADN 536 Query 87 QYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNK-------IRLEK 139 S WSG + + Y +AD+ V +++D + VI++ S S++ ++L+ Sbjct 537 F---SIRWSGQLVPPTTGTYHLEAAADDGVRLYLDGKPVIDRWSTSDRLHADGVDVQLQA 593 Query 140 GRLYQIKIQY 149 GR Y+++++Y Sbjct 594 GRAYEVRLEY 603 >ref|YP_210015.1| Gene info putative beta-glucosidase [Bacteroides fragilis NCTC 9343] emb|CAH06053.1| Gene info putative beta-glucosidase [Bacteroides fragilis NCTC 9343] Length=832 Score = 44.7 bits (104), Expect = 0.023, Method: Composition-based stats. Identities = 30/121 (24%), Positives = 62/121 (51%), Gaps = 11/121 (9%) Query 37 LLNESESSSQGLLGYYFSDLNFQA-PMVVTSSTTGDLSIPS-SELENIPSENQYFQSAIW 94 + ++E +G YF ++N + P V + T + S + L+ +P E Q+ S W Sbjct 419 IFTDTERKQKGFRAQYFDNMNLEGTPKVEQTETKINYSWSGGTGLKEMPKE-QF--SVRW 475 Query 95 SGFIKVKKSDEYTFATSADNHVTMWVDDQEVINK------ASNSNKIRLEKGRLYQIKIQ 148 +G I +++DEY F D+ +++D + + ++ +++ + LE G+ Y +KI+ Sbjct 476 NGTICPQETDEYLFTLGGDDGYRLYIDGKLIADEWHEGAFRNSTYRCMLEAGKKYDLKIE 535 Query 149 Y 149 Y Sbjct 536 Y 536 >ref|YP_203062.1| Gene info glucan 1,4-beta-glucosidase [Xanthomonas oryzae pv. oryzae KACC10331] ref|YP_453195.1| Gene info glucan 1,4-beta-glucosidase [Xanthomonas oryzae pv. oryzae MAFF 311018] gb|AAW77677.1| Gene info glucan 1,4-beta-glucosidase [Xanthomonas oryzae pv. oryzae KACC10331] dbj|BAE70921.1| Gene info glucan 1,4-beta-glucosidase [Xanthomonas oryzae pv. oryzae MAFF 311018] Length=904 Score = 43.9 bits (102), Expect = 0.044, Method: Composition-based stats. Identities = 34/130 (26%), Positives = 62/130 (47%), Gaps = 24/130 (18%) Query 41 SESSSQGLLGYYFS--DLNFQAPMVVTSSTTG---DLSIPSSEL---------ENIPSEN 86 + S +GL G YF DL+ + +V + G D P+ L E +P++N Sbjct 480 ANSPERGLRGEYFRNRDLSGKPALVRVDAQIGFTWDRGSPTDNLLARGEAGPSEAVPADN 539 Query 87 QYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNK-------IRLEK 139 S WSG + + Y +AD+ V +++D + VI++ S S++ ++L+ Sbjct 540 F---SIRWSGQLVPPTTGTYHLEAAADDGVRLYLDGKPVIDRWSTSDRLHADGVDVQLQA 596 Query 140 GRLYQIKIQY 149 GR Y +++ Y Sbjct 597 GRSYDLRLDY 606 >ref|NP_625257.1| Gene info hydrolase (secreted protein) [Streptomyces coelicolor A3(2)] emb|CAB61926.1| Gene info putative hydrolase (putative secreted protein) [Streptomyces coelicolor A3(2)] Length=872 Score = 43.5 bits (101), Expect = 0.049, Method: Composition-based stats. Identities = 27/101 (26%), Positives = 45/101 (44%), Gaps = 10/101 (9%) Query 91 SAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVI-------NKASNSNKIRLEKGRLY 143 S W+G + +++ +TF+ DN +WV Q I ++ + I L G+ Y Sbjct 90 SVRWTGKLVPEETGAHTFSIIGDNGFRLWVGGQLAIDHWVDDWDREQTAQPIELTAGQSY 149 Query 144 QIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPE 184 IK++Y G + L WT+ KE I +LP+ Sbjct 150 DIKLEYFEH---YGGSNLHLRWTEPGGSKEAIPQSAFRLPD 187 >ref|YP_273043.1| Gene info glycosyl hydrolase, family 3 [Pseudomonas syringae pv. phaseolicola 1448A] gb|AAZ33746.1| Gene info glycosyl hydrolase, family 3 [Pseudomonas syringae pv. phaseolicola 1448A] Length=852 Score = 43.1 bits (100), Expect = 0.068, Method: Composition-based stats. Identities = 34/134 (25%), Positives = 59/134 (44%), Gaps = 22/134 (16%) Query 40 ESESSSQGLLGYYFSDLNFQAPMVVTSSTTG---DLSIPSSELENIPSENQYFQ------ 90 E +S +QGL YF++++ VT + G D S S+ N S F Sbjct 386 EDKSGAQGLKAEYFNNVDLSGDPAVTRTEPGVNWDWSTGSNSTVNGVSNTTGFNPAGGSF 445 Query 91 SAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVI-------------NKASNSNKIRL 137 SA ++G IK S + F AD +WV+D+ ++ + + + L Sbjct 446 SARFTGVIKPTVSGDQVFKIHADGAYRLWVNDELILESDGEPVALDLVYDPPKSGKAVHL 505 Query 138 EKGRLYQIKIQYQR 151 + G+ Y +K++Y+R Sbjct 506 KAGQEYSVKLEYRR 519 >ref|YP_097613.1| Gene info beta-glucosidase [Bacteroides fragilis YCH46] dbj|BAD47079.1| Gene info beta-glucosidase [Bacteroides fragilis YCH46] Length=832 Score = 42.4 bits (98), Expect = 0.12, Method: Composition-based stats. Identities = 29/121 (23%), Positives = 61/121 (50%), Gaps = 11/121 (9%) Query 37 LLNESESSSQGLLGYYFSDLNFQA-PMVVTSSTTGDLSIPS-SELENIPSENQYFQSAIW 94 + ++E +G YF ++N + P V + T + S + L+ +P E Q+ S W Sbjct 419 IFTDTERKQKGFRAQYFDNMNLEGTPKVEQTETKINYSWSGGTGLKEMPKE-QF--SVRW 475 Query 95 SGFIKVKKSDEYTFATSADNHVTMWVDDQEVINK------ASNSNKIRLEKGRLYQIKIQ 148 +G I +++DEY F D+ +++D + + ++ +++ + LE G+ Y + I+ Sbjct 476 NGTICPQETDEYLFTLGGDDGYRLYIDGKLIADEWHEGAFRNSTYRCMLEAGKKYDLMIE 535 Query 149 Y 149 Y Sbjct 536 Y 536 >emb|CAJ88202.1| putative hydrolase [Streptomyces ambofaciens ATCC 23877] Length=1079 Score = 42.0 bits (97), Expect = 0.16, Method: Composition-based stats. Identities = 34/158 (21%), Positives = 67/158 (42%), Gaps = 19/158 (12%) Query 91 SAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVI-------NKASNSNKIRLEKGRLY 143 +A W+G I+ + +YTF S DN +++DD+ VI + S +RL G + Sbjct 91 TARWTGQIEAPATGDYTFHASGDNGFRLFIDDEPVIDHWEPDWDNEQTSASVRLAAGEKH 150 Query 144 QIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQ-------LPELKQKSSNSRKKR 196 + +++ ++ G + L W+ K+V+ P + + R+ + Sbjct 151 RFRLEMFQDT---GGANMFLRWSTPAMPKQVVPMSAFTPPAGFEVYPVEPSVAEDGRRVQ 207 Query 197 STSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSP 234 + G D + + D LE+E T + + +SP Sbjct 208 ARFEGEV--GGDVEALADHLEIEADTTPMPVESVVVSP 243 >ref|YP_001194392.1| Gene info glycoside hydrolase, family 3 domain protein [Flavobacterium johnsoniae UW101] gb|ABQ05073.1| Gene info glycoside hydrolase, family 3 domain protein [Flavobacterium johnsoniae UW101] Length=886 Score = 41.6 bits (96), Expect = 0.19, Method: Composition-based stats. Identities = 28/121 (23%), Positives = 61/121 (50%), Gaps = 10/121 (8%) Query 35 NRLLNESESSSQGLLGYYFSDLNFQA-PMVVTSSTTGDLSIPSSELENIPSENQYFQSAI 93 ++ L + S GL G YF++ N + P + + + P + + + ++ S Sbjct 485 SKYLFTPDESQNGLKGEYFNNRNLEGTPALTRIDSQLEFDWPWAPGDGVNVDDF---SIR 541 Query 94 WSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASN------SNKIRLEKGRLYQIKI 147 W+GF+K ++ + S+D+ + M++DDQ VI+ + + +EKG+ Y+++I Sbjct 542 WTGFLKSDQALDGWLGLSSDDGIRMYIDDQLVIDNWTKGATSMVTTPKNIEKGKKYKVRI 601 Query 148 Q 148 + Sbjct 602 E 602 >ref|NP_811860.1| Gene info hypothetical protein BT_2948 [Bacteroides thetaiotaomicron VPI-5482] gb|AAO78054.1| Gene info conserved hypothetical protein [Bacteroides thetaiotaomicron VPI-5482] Length=897 Score = 41.6 bits (96), Expect = 0.22, Method: Composition-based stats. Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 11/86 (12%) Query 94 WSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINK--------ASNSNKIRLEKGRLYQI 145 WSG +K + EYT AD+ ++++ + +I+ KI LE G++Y I Sbjct 311 WSGKLKAPSTGEYTLGIQADDGARLYINGELLIDDWKSHSFSYQPTQKKISLEAGKMYDI 370 Query 146 KIQYQRENPTEKGLDFKLYWTDSQNK 171 K++Y + + + KL W K Sbjct 371 KLEYYQHEWSSR---IKLSWIRPDKK 393 >ref|NP_812212.1| Gene info beta-glucosidase [Bacteroides thetaiotaomicron VPI-5482] gb|AAO78406.1| Gene info beta-glucosidase [Bacteroides thetaiotaomicron VPI-5482] Length=825 Score = 41.2 bits (95), Expect = 0.28, Method: Composition-based stats. Identities = 29/118 (24%), Positives = 62/118 (52%), Gaps = 13/118 (11%) Query 44 SSQGLLGYYFSDLNFQ-APMVVTSSTTGDLSIPS-SELENIPSENQYFQSAIWSGFIKVK 101 + +G YF +++F+ AP+V + + S + +ELE +P + YF S W + V Sbjct 418 NEKGFHAEYFKNIHFEGAPVVKQTEKKINYSWAAGTELEGMPKD--YF-SVKWYSTMCVD 474 Query 102 KSDEYTFATSADNHVTMWVDDQEVIN-------KASNSNKIRLEKGRLYQIKIQYQRE 152 ++ +Y F D+ ++++DQ +I+ + +N K L+ G Y ++++Y ++ Sbjct 475 ETADYEFTLGGDDGYKLFINDQPIIDDWTPGGFRTTNVTKT-LKAGEKYHVRVEYYQQ 531 >ref|NP_812026.1| Gene info beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482] gb|AAO78220.1| Gene info beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482] Length=1133 Score = 41.2 bits (95), Expect = 0.29, Method: Composition-based stats. Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 7/76 (9%) Query 86 NQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIR------LEK 139 NQ F SAIW G +K +S Y ++D + + V+ Q ++++ N+ ++ L+ Sbjct 890 NQSF-SAIWDGKLKAPQSGTYMIGVTSDQGMRLSVNGQRIVDEWRNNKELTVVRPFLLKA 948 Query 140 GRLYQIKIQYQRENPT 155 G ++++Y + NPT Sbjct 949 GDEVAVRVEYSQRNPT 964 >gb|ABP88816.1| LCCL-related protein CCp5B [Toxoplasma gondii] Length=998 Score = 40.4 bits (93), Expect = 0.47, Method: Composition-based stats. Identities = 40/173 (23%), Positives = 69/173 (39%), Gaps = 41/173 (23%) Query 40 ESESSSQGLLGYYFSDLNFQ-APMVVTSSTTGDLSIPSS-ELENIPSENQYFQSAIWSGF 97 E E G+ GYY+ + F AP + D + +E + S+ QY S W G+ Sbjct 214 EDEPFPDGIKGYYYGNARFSGAPRAIRIDRAIDFVFAGAGPVEGLTSQ-QY--SIRWDGY 270 Query 98 IKVKKSDEYTFATSADNHVTMWVDDQEVI----------------------------NKA 129 + +S ++TF+ D+ V ++ + Q +I + Sbjct 271 LLAPRSGDFTFSIETDSGVRVFFNQQPIIVDRMPPATETDAIGDKIVPLTAVAGHPGSHT 330 Query 130 SNSNKIRLEKGRLYQIKIQ------YQRENPTEKGLDFKLYWTDSQNKKEVIS 176 + S + L G Y+++++ ++ EN L KL W KKEVIS Sbjct 331 TESVPLELTAGEKYKLRVELVHTCHFKYENSDSASL--KLSWQSPGVKKEVIS 381 >ref|ZP_01718029.1| N-acetylgalactosamine 6-sulfatase (GALNS) [Algoriphagus sp. PR1] gb|EAZ83060.1| N-acetylgalactosamine 6-sulfatase (GALNS) [Algoriphagus sp. PR1] Length=682 Score = 39.7 bits (91), Expect = 0.72, Method: Composition-based stats. Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 11/110 (10%) Query 76 SSELENIPS-ENQYFQSAIWSGFIKVKKSDEYTF-ATSADNHVTMWVDDQEVIN-----K 128 S ++ N+P E + +W+G+I V +S +YTF A +H M + D VI+ Sbjct 573 SEKVVNLPGVEGENGNLVVWTGYINVPESGKYTFSADREQSHFFMRIHDIAVIDGNYKIA 632 Query 129 ASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSD 178 S + +E G + +KI + + + K KL W KEVIS D Sbjct 633 DSAEGSVYMEAG-YHPVKIYLMKNDKSAK---LKLSWQFEDKPKEVISPD 678 >ref|ZP_01355705.1| PA14:TadE-like [Roseiflexus sp. RS-1] gb|EAT28901.1| PA14:TadE-like [Roseiflexus sp. RS-1] Length=578 Score = 39.7 bits (91), Expect = 0.75, Method: Composition-based stats. Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 9/95 (9%) Query 86 NQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVIN----KASNSN-KIRLEKG 140 N YF S W+G ++ S EYTF D+ V +WV+ ++IN K+ +N +I L Sbjct 381 NNYF-SVRWTGQVEPLFSGEYTFFADTDDGVRVWVNGVQIINDWRTKSGEANGRITLTAC 439 Query 141 RLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVI 175 + I ++Y ++ + L W+ + K+VI Sbjct 440 QRVSITVEYFEWTGNQRAI---LSWSHANQPKQVI 471 >ref|ZP_01061671.1| beta-glucosidase precursor [Flavobacterium sp. MED217] gb|EAQ48634.1| beta-glucosidase precursor [Leeuwenhoekiella blandensis MED217] Length=873 Score = 39.7 bits (91), Expect = 0.77, Method: Composition-based stats. Identities = 30/120 (25%), Positives = 56/120 (46%), Gaps = 17/120 (14%) Query 41 SESSSQGLLGYYFSDLNFQAPMVVTS-----STTGDLSIPSSELENIPSENQYFQSAIWS 95 + S QGL YF++ ++ + T T D++ P L + QY S +WS Sbjct 455 TASGKQGLDAAYFNNSKWEGDPLFTQIDDKVDFTWDINTPDPRL----ALQQY--SVLWS 508 Query 96 GFIKVKKSDEYTFATSADNHVTMWVDD------QEVINKASNSNKIRLEKGRLYQIKIQY 149 GF+ V ++ Y F+ ++ ++D + + + N+ ++ LE G+ Y I I+Y Sbjct 509 GFLSVPETGRYYFSDWGKPYLDFQIEDLVSGGGKHTHHPSVNAKEVYLEAGKNYAITIKY 568 >ref|YP_411917.1| Gene info von Willebrand factor, type A [Nitrosospira multiformis ATCC 25196] gb|ABB74525.1| Gene info von Willebrand factor, type A [Nitrosospira multiformis ATCC 25196] Length=888 Score = 39.3 bits (90), Expect = 0.93, Method: Composition-based stats. Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 2/71 (2%) Query 343 FDIGGSVSAGFSNSNSSTVAI--DHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGT 400 F++ + GF N ++VA+ D L + R W N DTA N +R V TG Sbjct 329 FEMTAGPTGGFGTPNGTSVAVASDPILPVTYARLWLSYTSTNPGDTASGNVTVRCVQTGE 388 Query 401 APIYNVLPTTS 411 + + N+ T+ Sbjct 389 SWVINIAANTT 399 >ref|YP_542458.1| Gene info putative outer membrane usher protein YqiG precursor [Escherichia coli UTI89] ref|YP_855135.1| Gene info putative outer membrane usher protein YqiG precursor [Escherichia coli APEC O1] gb|ABE08927.1| Gene info putative outer membrane usher protein YqiG precursor [Escherichia coli UTI89] gb|ABJ02557.1| Gene info putative outer membrane usher protein YqiG precursor [Escherichia coli APEC O1] Length=840 Score = 38.9 bits (89), Expect = 1.3, Method: Composition-based stats. Identities = 32/141 (22%), Positives = 65/141 (46%), Gaps = 4/141 (2%) Query 40 ESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIK 99 ES S GY FSD ++ + SS GD SI + + + S NQYF++ + ++ Sbjct 459 ESTGSQITFAGYRFSDKDYVSMSEYLSSRNGDESIDNEKESYVISLNQYFETLELNSYLN 518 Query 100 VKKSDEYTFATSADNHVTMW----VDDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPT 155 V ++ + A++ + V++ + D + I+ + ++IR + Q + Sbjct 519 VTRNTYWDSASNTNYSVSVSKNFDIGDFKGISASLAVSRIRWDDDEENQYYFSFSLPLQQ 578 Query 156 EKGLDFKLYWTDSQNKKEVIS 176 + + + + T S N ++IS Sbjct 579 NRNISYSMQRTGSSNTSQMIS 599 >ref|NP_755663.1| Gene info Hypothetical outer membrane usher protein yqiG precursor [Escherichia coli CFT073] gb|AAN82236.1|AE016766_324 Gene info Hypothetical outer membrane usher protein yqiG precursor [Escherichia coli CFT073] Length=840 Score = 38.9 bits (89), Expect = 1.3, Method: Composition-based stats. Identities = 32/141 (22%), Positives = 65/141 (46%), Gaps = 4/141 (2%) Query 40 ESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIK 99 ES S GY FSD ++ + SS GD SI + + + S NQYF++ + ++ Sbjct 459 ESTGSQITFAGYRFSDKDYVSMSEYLSSRNGDESIDNEKESYVISLNQYFETLELNSYLN 518 Query 100 VKKSDEYTFATSADNHVTMW----VDDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPT 155 V ++ + A++ + V++ + D + I+ + ++IR + Q + Sbjct 519 VTRNTYWDSASNTNYSVSVSKNFDIGDFKGISASLAVSRIRWDDDEENQYYFSFSLPLQQ 578 Query 156 EKGLDFKLYWTDSQNKKEVIS 176 + + + + T S N ++IS Sbjct 579 NRNISYSMQRTGSSNTSQMIS 599 >ref|ZP_01531645.1| PA14 [Roseiflexus castenholzii DSM 13941] gb|EAV26730.1| PA14 [Roseiflexus castenholzii DSM 13941] Length=584 Score = 38.5 bits (88), Expect = 1.4, Method: Composition-based stats. Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 9/95 (9%) Query 86 NQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVIN----KASNSN-KIRLEKG 140 N YF S W+G ++ S EYTF + D+ V +WV+ ++IN K S +N +I L Sbjct 381 NDYF-SVRWTGQVEPLFSGEYTFYANTDDGVRVWVNGVQIINDWRTKNSETNGRITLTAC 439 Query 141 RLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVI 175 + I ++Y ++ + L W + K+VI Sbjct 440 QRVNITVEYFEWTGSQNAI---LSWQHANVPKQVI 471 >ref|NP_810691.1| Gene info beta-glucosidase (gentiobiase) [Bacteroides thetaiotaomicron VPI-5482] gb|AAO76885.1| Gene info beta-glucosidase (gentiobiase) [Bacteroides thetaiotaomicron VPI-5482] Length=853 Score = 38.5 bits (88), Expect = 1.5, Method: Composition-based stats. Identities = 29/118 (24%), Positives = 59/118 (50%), Gaps = 8/118 (6%) Query 38 LNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGF 97 L + E+ +GL YF + + V + + P+++ + P + S W+G Sbjct 452 LIQGENFPEGLQAEYFDNTRLEGTPRVRKESWINFE-PANQAPD-PFLPKSPLSVRWTGK 509 Query 98 IKVKKSDEYTFATSADNHVTMWVDDQEVINK------ASNSNKIRLEKGRLYQIKIQY 149 +K S YTF+ ++D+ + +++Q +I+ +++S I LE G+ YQ+K +Y Sbjct 510 LKPTVSGRYTFSFTSDDGCRLSINNQMLIDAWQAHAVSTDSASIYLEAGKEYQLKAEY 567 >ref|YP_593226.1| Gene info glycoside hydrolase, family 3-like [Acidobacteria bacterium Ellin345] gb|ABF43152.1| Gene info glycoside hydrolase, family 3-like [Acidobacteria bacterium Ellin345] Length=831 Score = 38.5 bits (88), Expect = 1.6, Method: Composition-based stats. Identities = 28/127 (22%), Positives = 60/127 (47%), Gaps = 7/127 (5%) Query 29 AEVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQY 88 ++V + ++ + GL+ +F++ + P +T T ++ S P+ Q Sbjct 410 SDVFKTTSFTTTADGDTHGLVTEFFNNKDLTGPPALTR-TDEHIAFNWSGGPYAPNGQQE 468 Query 89 FQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINK------ASNSNKIRLEKGRL 142 SA ++G+ YTFA S D+ ++VDD+ VI + + + L+ G+ Sbjct 469 NFSARFTGYYTPAADGTYTFAVSGDDGFRLFVDDKPVIEQWVYQGETIVTKALDLKAGQH 528 Query 143 YQIKIQY 149 Y+++++Y Sbjct 529 YKLRLEY 535 >ref|XP_001348665.1| Gene info hypothetical protein PF14_0491 [Plasmodium falciparum 3D7] gb|AAN37104.1|AE014824_23 Gene info hypothetical protein [Plasmodium falciparum 3D7] Length=852 Score = 37.7 bits (86), Expect = 2.7, Method: Composition-based stats. Identities = 43/177 (24%), Positives = 75/177 (42%), Gaps = 48/177 (27%) Query 42 ESSSQGLLGYYFSDLNFQA-PMVVTSST----TGDLSIPSSELENIPSENQYFQSAIWSG 96 E + GL+ Y+++ F P + + D IP +ENIP Q+F S W G Sbjct 201 EEKADGLMASYYNNAYFSGYPTAIHNDKYINFIWDTGIP---IENIPY--QHF-SIRWDG 254 Query 97 FIKVKKSDEYTFATSADNHVTMWVDDQEVINK---------------------------- 128 ++K+ +SD Y F+ D + +++D+ +I Sbjct 255 YLKIPESDNYIFSVDHDCGIRIFLDNSPIIVDNMPFPKEEESEEIRPISIQSFDKMNSKV 314 Query 129 -ASNSNKIRLEKGRLYQIKIQY------QRENPTEKGLDFKLYWTDSQNKKEVISSD 178 +NS K+ L G+ Y+I+I+Y + NP + LYW + +E+I S+ Sbjct 315 HKTNSEKLGLIGGKKYKIRIEYFHLSTMKFANPHISHI--ILYWKSNNIMEEIIPSN 369 >ref|XP_764263.1| Gene info hypothetical protein TP04_0628 [Theileria parva strain Muguga] gb|EAN31980.1| Gene info hypothetical protein TP04_0628 [Theileria parva] Length=651 Score = 37.7 bits (86), Expect = 3.1, Method: Composition-based stats. Identities = 42/172 (24%), Positives = 72/172 (41%), Gaps = 33/172 (19%) Query 36 RLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIP--SENQYFQSAI 93 +L ++ + S GL+G Y+S+ F+ P V ST D I + +P + Y S Sbjct 324 KLFSDIYNVSDGLIGTYYSNNTFEFPAV---STRIDPQINLLFVNKMPIIGISPYKFSIR 380 Query 94 WSGFIKVKKSDEYTFATSADNHVTMWVDDQEVIN-------------------------- 127 W G++KV S Y F D++ + ++ E+IN Sbjct 381 WEGYLKVPHSGNYVFELDTDSYGRVELNGSEIINLGIRVDGNDEIGYKFFIDPVIQRNDL 440 Query 128 KASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDN 179 KAS S + L G+ YQIK++ + + Y+ + E+++S N Sbjct 441 KASQSQQ--LIGGKFYQIKVEMSHSQQYKYTDGSESYFNLPASSFEIVTSLN 490 >ref|YP_685097.1| Gene info hypothetical protein RCIX309 [Uncultured methanogenic archaeon RC-I] emb|CAJ35771.1| Gene info hypothetical protein [uncultured methanogenic archaeon RC-I] Length=199 Score = 36.6 bits (83), Expect = 5.5, Method: Composition-based stats. Identities = 42/166 (25%), Positives = 70/166 (42%), Gaps = 33/166 (19%) Query 6 VLIPLMALSTILV--SSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYF------SDLN 57 VL ++ ST+L SS G Q + QE L +G+ +Y+ SDL Sbjct 20 VLAGILIASTVLAFASSHGKTAADQLKELQEPGL-------KKGVSAFYYTIDPATSDLA 72 Query 58 FQAPMVV------TSSTTGDLSIPSSEL-ENIPSENQYFQSAIWSGFIKVKKSDEYTFAT 110 P + T T +S +S L E P +N IW+G++ + YTF Sbjct 73 SADPNKILPDSYATRRTENAISADASTLPEEAPDQNGMI---IWTGYVAIPAEGTYTFTL 129 Query 111 SADNHVTMWVDDQEVINKASN-------SNKIRLEKGRLYQIKIQY 149 + +W+D ++++ N S ++L G L++IK +Y Sbjct 130 DSAGGSWLWIDGRQIVANPGNHPRASVSSLPVQLSAG-LHRIKARY 174 >ref|YP_633941.1| Gene info DnaK family protein [Myxococcus xanthus DK 1622] gb|ABF86446.1| Gene info DnaK family protein [Myxococcus xanthus DK 1622] Length=1293 Score = 36.6 bits (83), Expect = 6.8, Method: Composition-based stats. Identities = 37/160 (23%), Positives = 61/160 (38%), Gaps = 6/160 (3%) Query 177 SDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWI 236 SD + + S+ S + + T P P S + D T + I Sbjct 479 SDTSTIRATAEASTTSVEPDTDEGNETAPTSSGTAAPASETRDAKAGDASPTETPTATSI 538 Query 237 SNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDME 296 +++ E + +SPE +TA+ P + + G P A PL A P+ E Sbjct 539 TSV-EPTTEAGHVASPEASATAAPPRAQSDAEAGDASTTQPPAATSPLSDA-PVAEASNE 596 Query 297 NIILSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNA 336 + E Q+ T Q+ + ST+ THT + G+A Sbjct 597 ----AATEPQAAAPTTEQSGPSVASESTTTTHTDDPSGSA 632 >ref|NP_810141.1| Gene info fructose-1,6-bisphosphatase [Bacteroides thetaiotaomicron VPI-5482] gb|AAO76335.1| Gene info fructose-1,6-bisphosphatase [Bacteroides thetaiotaomicron VPI-5482] Length=664 Score = 36.6 bits (83), Expect = 7.1, Method: Composition-based stats. Identities = 35/131 (26%), Positives = 56/131 (42%), Gaps = 22/131 (16%) Query 444 NLAPIALNAQDDFSSTPITM----------NYNQFLELEKTKQLRLDTDQVYGNIATYNF 493 NL P+A A D ++ P T+ NYN+ K LRL T Q++ I F Sbjct 274 NLLPLATFAMDTYADDPCTIFMPKMNFADTNYNE-------KTLRLIT-QMHKAITIIQF 325 Query 494 ----ENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPD 549 E R + G + ++L +I ++ GK+ L + V+P+DP T + Sbjct 326 KLEAEIIDRRPEFGMSNRKLLEKIDFERGVFVYEGKEYALRDTNFPTVDPADPYRLTDEE 385 Query 550 MTLKEALKIAF 560 L E + +F Sbjct 386 RELVEKIHYSF 396 >ref|NP_793101.1| Gene info beta-glucosidase [Pseudomonas syringae pv. tomato str. DC3000] gb|AAO56796.1| Gene info beta-glucosidase [Pseudomonas syringae pv. tomato str. DC3000] Length=913 Score = 36.2 bits (82), Expect = 8.8, Method: Composition-based stats. Identities = 28/112 (25%), Positives = 46/112 (41%), Gaps = 25/112 (22%) Query 54 SDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSAD 113 S+ + P ST G+L+ +S S ++G I +S E F AD Sbjct 474 SNTSTSDPYTTKGSTAGELNGDTSS-----------TSIRYTGKITPTQSGEQVFKVRAD 522 Query 114 NHVTMWVDDQEVINKASNS--------------NKIRLEKGRLYQIKIQYQR 151 V +WV+ +++I+ KI LE G+ Y +K++Y R Sbjct 523 GAVRLWVNGKKIIDNGDGKPLPGNSIPPTIPEFAKINLEAGQSYDVKLEYSR 574 >ref|XP_628974.1| Gene info carbohydrate-binding domain-containing protein [Dictyostelium discoideum AX4] gb|EAL60558.1| Gene info carbohydrate-binding domain-containing protein [Dictyostelium discoideum AX4] Length=1137 Score = 36.2 bits (82), Expect = 8.9, Method: Composition-based stats. Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 1/85 (1%) Query 404 YNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIAL-NAQDDFSSTPIT 462 Y++ P T + N K+ QL ++PN S ++ L +AQ F TP T Sbjct 735 YDLNPITIKLTPNNAVSGNDKSGVYQLRFPVSPNCRSQSYRISSAKLTDAQGHFGVTPST 794 Query 463 MNYNQFLELEKTKQLRLDTDQVYGN 487 N+N F++ + QLR++T GN Sbjct 795 YNFNPFIKFLSSNQLRINTTCPIGN 819
  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding 
environmental samples from WGS projects
    Posted date:  May 27, 2007  5:53 PM
  Number of letters in database: 1,723,618,044
  Number of sequences in database:  4,984,388
Lambda     K      H
   0.311    0.128    0.355 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4984388
Number of Hits to DB: 128163844
Number of extensions: 5694925
Number of successful extensions: 16461
Number of sequences better than 10: 24
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 16684
Number of HSP's successfully gapped: 43
Length of query: 764
Length of database: 1723618044
Length adjustment: 140
Effective length of query: 624
Effective length of database: 1025803724
Effective search space: 640101523776
Effective search space used: 640101523776
T: 11
A: 40
X1: 16 (7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (20.8 bits)
S2: 82 (36.2 bits)