Job Title: lef_B.anthracis(Ames_Anc.)

Show Conserved Domains

RID=5P3VX2VZ012, lef_B.anthracis(Ames_Anc.) BLASTP 2.2.16 (Mar-25-2007)
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 5P3VX2VZ012


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           4,984,388 sequences; 1,723,618,044 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports

Query=  lef_B.anthracis(Ames_Anc.)
Length=809


Distance tree of resultsNew  Related Structures

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|NP_652928.1|  lethal factor [Bacillus anthracis str. A2012...  1441    0.0    Gene info
ref|NP_052803.1|  hypothetical protein pxo1_107 [Bacillus anth...  1439    0.0    Gene info
emb|CAC93932.1|  Lef protein [Bacillus anthracis] >emb|CAC9393...  1384    0.0   
pdb|1J7N|A  Chain A, Anthrax Toxin Lethal Factor >pdb|1J7N|B C...  1370    0.0    Related structures
pdb|1PWU|A  Chain A, Crystal Structure Of Anthrax Lethal Facto...  1370    0.0    Related structures
gb|AAR88322.1|  lethal factor domains I-III [Synthetic construct]   962    0.0   
pdb|1YQY|A  Chain A, Structure Of B. Anthrax Lethal Factor In ...   920    0.0    Related structures
gb|AAR88323.1|  lethal factor domain I [Synthetic construct]        477    2e-132
ref|ZP_00236307.1|  lethal factor precursor [Bacillus cereus G...   135    1e-29 
emb|CAC93924.1|  cya [Bacillus anthracis]                           134    2e-29 
emb|CAC93925.1|  cya [Bacillus anthracis]                           134    2e-29 
ref|ZP_00239576.1|  calmodulin-sensitive adenylate cyclase [Ba...   134    3e-29 
ref|NP_052818.1|  hypothetical protein pxo1_122 [Bacillus anth...   134    3e-29  Gene info
gb|AAY15238.1|  edema factor [Bacillus anthracis]                   134    3e-29 
gb|AAA79215.1|  edema factor                                        134    3e-29 
pdb|1XFV|A  Chain A, Crystal Structure Of Anthrax Edema Factor...   133    4e-29  Related structures
pdb|1XFU|A  Chain A, Crystal Structure Of Anthrax Edema Factor...   120    3e-25  Related structures
ref|XP_600663.2|  PREDICTED: similar to nestin [Bos taurus]        38.9    1.4    UniGene infoGene info
ref|XP_685446.2|  PREDICTED: hypothetical protein isoform 1 [Dani  37.7    3.2    UniGene infoGene info
emb|CAL83464.1|  two-component sensor kinase [Clostridium botu...  37.7    3.4   
Alignments
>ref|NP_652928.1| Gene info lethal factor [Bacillus anthracis str. A2012] ref|YP_016503.2| Gene info lethal factor [Bacillus anthracis str. 'Ames Ancestor'] sp|P15917|LEF_BACAN Lethal factor precursor (LF) (Anthrax lethal toxin endopeptidase component) gb|AAM26117.1| Gene info lethal factor [Bacillus anthracis str. A2012] gb|AAT28913.2| Gene info lethal factor [Bacillus anthracis str. 'Ames Ancestor'] gb|AAY15237.1| lethal factor [Bacillus anthracis] Length=809 Score = 1441 bits (3730), Expect = 0.0, Method: Composition-based stats. Identities = 809/809 (100%), Positives = 809/809 (100%), Gaps = 0/809 (0%) Query 1 MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEE 60 MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEE Sbjct 1 MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEE 60 Query 61 RNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGD 120 RNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGD Sbjct 61 RNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGD 120 Query 121 ITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNV 180 ITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNV Sbjct 121 ITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNV 180 Query 181 YYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLE 240 YYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLE Sbjct 181 YYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLE 240 Query 241 QNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLAR 300 QNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLAR Sbjct 241 QNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLAR 300 Query 301 YEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSS 360 YEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSS Sbjct 301 YEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSS 360 Query 361 DFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD 420 DFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD Sbjct 361 DFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD 420 Query 421 INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLT 480 INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLT Sbjct 421 INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLT 480 Query 481 ATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSP 540 ATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSP Sbjct 481 ATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSP 540 Query 541 DTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNIN 600 DTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNIN Sbjct 541 DTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNIN 600 Query 601 QEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNG 660 QEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNG Sbjct 601 QEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNG 660 Query 661 RFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHE 720 RFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHE Sbjct 661 RFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHE 720 Query 721 FGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHST 780 FGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHST Sbjct 721 FGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHST 780 Query 781 DHAERLKVQKNAPKTFQFINDQIKFIINS 809 DHAERLKVQKNAPKTFQFINDQIKFIINS Sbjct 781 DHAERLKVQKNAPKTFQFINDQIKFIINS 809 >ref|NP_052803.1| Gene info hypothetical protein pxo1_107 [Bacillus anthracis] gb|AAA22569.1| Gene info lethal factor precursor gb|AAA79216.1| Gene info lethal factor precursor gb|AAD32411.1| Gene info pXO1-107 [Bacillus anthracis] Length=809 Score = 1439 bits (3725), Expect = 0.0, Method: Composition-based stats. Identities = 808/809 (99%), Positives = 809/809 (100%), Gaps = 0/809 (0%) Query 1 MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEE 60 MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEE Sbjct 1 MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEE 60 Query 61 RNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGD 120 RNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGD Sbjct 61 RNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGD 120 Query 121 ITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNV 180 ITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNV Sbjct 121 ITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNV 180 Query 181 YYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLE 240 YYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLE Sbjct 181 YYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLE 240 Query 241 QNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLAR 300 QNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRML+R Sbjct 241 QNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLSR 300 Query 301 YEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSS 360 YEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSS Sbjct 301 YEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSS 360 Query 361 DFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD 420 DFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD Sbjct 361 DFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD 420 Query 421 INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLT 480 INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLT Sbjct 421 INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLT 480 Query 481 ATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSP 540 ATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSP Sbjct 481 ATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSP 540 Query 541 DTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNIN 600 DTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNIN Sbjct 541 DTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNIN 600 Query 601 QEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNG 660 QEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNG Sbjct 601 QEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNG 660 Query 661 RFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHE 720 RFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHE Sbjct 661 RFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHE 720 Query 721 FGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHST 780 FGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHST Sbjct 721 FGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHST 780 Query 781 DHAERLKVQKNAPKTFQFINDQIKFIINS 809 DHAERLKVQKNAPKTFQFINDQIKFIINS Sbjct 781 DHAERLKVQKNAPKTFQFINDQIKFIINS 809 >emb|CAC93932.1| Lef protein [Bacillus anthracis] emb|CAC93933.1| Lef protein [Bacillus anthracis] Length=781 Score = 1384 bits (3581), Expect = 0.0, Method: Composition-based stats. Identities = 781/781 (100%), Positives = 781/781 (100%), Gaps = 0/781 (0%) Query 29 PLVQGAGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVK 88 PLVQGAGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVK Sbjct 1 PLVQGAGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVK 60 Query 89 KEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLH 148 KEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLH Sbjct 61 KEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLH 120 Query 149 EHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLN 208 EHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLN Sbjct 121 EHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLN 180 Query 209 TIKNASDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQL 268 TIKNASDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQL Sbjct 181 TIKNASDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQL 240 Query 269 YAPEAFNYMDKFNEQEINLSLEELKDQRMLARYEKWEKIKQHYQHWSDSLSEEGRGLLKK 328 YAPEAFNYMDKFNEQEINLSLEELKDQRMLARYEKWEKIKQHYQHWSDSLSEEGRGLLKK Sbjct 241 YAPEAFNYMDKFNEQEINLSLEELKDQRMLARYEKWEKIKQHYQHWSDSLSEEGRGLLKK 300 Query 329 LQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKE 388 LQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKE Sbjct 301 LQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKE 360 Query 389 LLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRD 448 LLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRD Sbjct 361 LLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRD 420 Query 449 IQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNF 508 IQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNF Sbjct 421 IQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNF 480 Query 509 KYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQII 568 KYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQII Sbjct 481 KYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQII 540 Query 569 KQSEKEYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNI 628 KQSEKEYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNI Sbjct 541 KQSEKEYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNI 600 Query 629 VESAYLILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHS 688 VESAYLILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHS Sbjct 601 VESAYLILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHS 660 Query 689 KGLYVPESRSILLHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFI 748 KGLYVPESRSILLHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFI Sbjct 661 KGLYVPESRSILLHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFI 720 Query 749 DIFKEEGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIIN 808 DIFKEEGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIIN Sbjct 721 DIFKEEGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIIN 780 Query 809 S 809 S Sbjct 781 S 781 >pdb|1J7N|A Related structures Chain A, Anthrax Toxin Lethal Factor pdb|1J7N|B Related structures Chain B, Anthrax Toxin Lethal Factor pdb|1JKY|A Related structures Chain A, Crystal Structure Of The Anthrax Lethal Factor (Lf): Wild- Type Lf Complexed With The N-Terminal Sequence Of Mapkk2 pdb|1PWP|A Related structures Chain A, Crystal Structure Of The Anthrax Lethal Factor Complexed With Small Molecule Inhibitor Nsc 12155 pdb|1PWP|B Related structures Chain B, Crystal Structure Of The Anthrax Lethal Factor Complexed With Small Molecule Inhibitor Nsc 12155 pdb|1PWQ|A Related structures Chain A, Crystal Structure Of Anthrax Lethal Factor Complexed With Thioacetyl-Tyr-Pro-Met-Amide, A Metal-Chelating Peptidyl Small Molecule Inhibitor pdb|1PWQ|B Related structures Chain B, Crystal Structure Of Anthrax Lethal Factor Complexed With Thioacetyl-Tyr-Pro-Met-Amide, A Metal-Chelating Peptidyl Small Molecule Inhibitor pdb|1PWV|A Related structures Chain A, Crystal Structure Of Anthrax Lethal Factor Wild-Type Protein Complexed With An Optimised Peptide Substrate. pdb|1PWV|B Related structures Chain B, Crystal Structure Of Anthrax Lethal Factor Wild-Type Protein Complexed With An Optimised Peptide Substrate. pdb|1ZXV|A Related structures Chain A, X-Ray Crystal Structure Of The Anthrax Lethal Factor Bound To A Small Molecule Inhibitor, Bi-Mfm3, 3-{5-[5-(4-Chloro- Phenyl)-Furan-2-Ylmethylene]-4-Oxo-2-Thioxo-Thiazolidin-3- Yl}-Propionic Acid. pdb|1ZXV|B Related structures Chain B, X-Ray Crystal Structure Of The Anthrax Lethal Factor Bound To A Small Molecule Inhibitor, Bi-Mfm3, 3-{5-[5-(4-Chloro- Phenyl)-Furan-2-Ylmethylene]-4-Oxo-2-Thioxo-Thiazolidin-3- Yl}-Propionic Acid. Length=776 Score = 1370 bits (3547), Expect = 0.0, Method: Composition-based stats. Identities = 775/776 (99%), Positives = 776/776 (100%), Gaps = 0/776 (0%) Query 34 AGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAE 93 AGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAE Sbjct 1 AGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAE 60 Query 94 KLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVY 153 KLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVY Sbjct 61 KLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVY 120 Query 154 AKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNA 213 AKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNA Sbjct 121 AKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNA 180 Query 214 SDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEA 273 SDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEA Sbjct 181 SDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEA 240 Query 274 FNYMDKFNEQEINLSLEELKDQRMLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPI 333 FNYMDKFNEQEINLSLEELKDQRML+RYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPI Sbjct 241 FNYMDKFNEQEINLSLEELKDQRMLSRYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPI 300 Query 334 EPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRI 393 EPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRI Sbjct 301 EPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRI 360 Query 394 QVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNID 453 QVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNID Sbjct 361 QVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNID 420 Query 454 ALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSIS 513 ALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSIS Sbjct 421 ALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSIS 480 Query 514 SNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEK 573 SNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEK Sbjct 481 SNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEK 540 Query 574 EYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVESAY 633 EYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVESAY Sbjct 541 EYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVESAY 600 Query 634 LILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYV 693 LILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYV Sbjct 601 LILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYV 660 Query 694 PESRSILLHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKE 753 PESRSILLHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKE Sbjct 661 PESRSILLHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKE 720 Query 754 EGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS 809 EGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS Sbjct 721 EGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS 776 >pdb|1PWU|A Related structures Chain A, Crystal Structure Of Anthrax Lethal Factor Complexed With (3-(N-Hydroxycarboxamido)-2-Isobutylpropanoyl-Trp- Methylamide), A Known Small Molecule Inhibitor Of Matrix Metalloproteases. pdb|1PWU|B Related structures Chain B, Crystal Structure Of Anthrax Lethal Factor Complexed With (3-(N-Hydroxycarboxamido)-2-Isobutylpropanoyl-Trp- Methylamide), A Known Small Molecule Inhibitor Of Matrix Metalloproteases. pdb|1PWW|A Related structures Chain A, Crystal Structure Of Anthrax Lethal Factor Active Site Mutant Protein Complexed With An Optimised Peptide Substrate In The Presence Of Zinc. pdb|1PWW|B Related structures Chain B, Crystal Structure Of Anthrax Lethal Factor Active Site Mutant Protein Complexed With An Optimised Peptide Substrate In The Presence Of Zinc. Length=776 Score = 1370 bits (3546), Expect = 0.0, Method: Composition-based stats. Identities = 774/776 (99%), Positives = 775/776 (99%), Gaps = 0/776 (0%) Query 34 AGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAE 93 AGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAE Sbjct 1 AGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAE 60 Query 94 KLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVY 153 KLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVY Sbjct 61 KLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVY 120 Query 154 AKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNA 213 AKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNA Sbjct 121 AKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNA 180 Query 214 SDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEA 273 SDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEA Sbjct 181 SDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEA 240 Query 274 FNYMDKFNEQEINLSLEELKDQRMLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPI 333 FNYMDKFNEQEINLSLEELKDQRML+RYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPI Sbjct 241 FNYMDKFNEQEINLSLEELKDQRMLSRYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPI 300 Query 334 EPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRI 393 EPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRI Sbjct 301 EPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRI 360 Query 394 QVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNID 453 QVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNID Sbjct 361 QVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNID 420 Query 454 ALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSIS 513 ALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSIS Sbjct 421 ALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSIS 480 Query 514 SNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEK 573 SNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEK Sbjct 481 SNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEK 540 Query 574 EYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVESAY 633 EYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVESAY Sbjct 541 EYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVESAY 600 Query 634 LILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYV 693 LILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYV Sbjct 601 LILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYV 660 Query 694 PESRSILLHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKE 753 PESRSILLHGPSKGVELRNDSEGFIH FGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKE Sbjct 661 PESRSILLHGPSKGVELRNDSEGFIHCFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKE 720 Query 754 EGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS 809 EGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS Sbjct 721 EGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS 776 >gb|AAR88322.1| lethal factor domains I-III [Synthetic construct] Length=573 Score = 962 bits (2487), Expect = 0.0, Method: Composition-based stats. Identities = 554/568 (97%), Positives = 557/568 (98%), Gaps = 2/568 (0%) Query 16 LVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKH 75 L + L G VF+ AGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKH Sbjct 8 LCCVLLLCGAVFVS--PSAGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKH 65 Query 76 IVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKK 135 IVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKK Sbjct 66 IVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKK 125 Query 136 KIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSK 195 KIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSK Sbjct 126 KIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSK 185 Query 196 INQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFA 255 INQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFA Sbjct 186 INQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFA 245 Query 256 YYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLARYEKWEKIKQHYQHWS 315 YYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRML+RYEKWEKIKQHYQHWS Sbjct 246 YYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLSRYEKWEKIKQHYQHWS 305 Query 316 DSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQ 375 DSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQ Sbjct 306 DSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQ 365 Query 376 IDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSP 435 IDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSP Sbjct 366 IDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSP 425 Query 436 SINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTK 495 SINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTK Sbjct 426 SINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTK 485 Query 496 INRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQ 555 INRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQ Sbjct 486 INRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQ 545 Query 556 RNIGLEIKDVQIIKQSEKEYIRIDAKVV 583 RNIGLEIKDVQIIKQSEKEYIRIDAKVV Sbjct 546 RNIGLEIKDVQIIKQSEKEYIRIDAKVV 573 >pdb|1YQY|A Related structures Chain A, Structure Of B. Anthrax Lethal Factor In Complex With A Hydroxamate Inhibitor Length=523 Score = 920 bits (2377), Expect = 0.0, Method: Composition-based stats. Identities = 514/517 (99%), Positives = 515/517 (99%), Gaps = 0/517 (0%) Query 293 KDQRMLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELL 352 KD ML+RYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELL Sbjct 3 KDPGMLSRYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELL 62 Query 353 KRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKL 412 KRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKL Sbjct 63 KRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKL 122 Query 413 KLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYE 472 KLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYE Sbjct 123 KLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYE 182 Query 473 NMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERL 532 NMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERL Sbjct 183 NMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERL 242 Query 533 KWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKI 592 KWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKI Sbjct 243 KWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKI 302 Query 593 QEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVT 652 QEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVT Sbjct 303 QEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVT 362 Query 653 NYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRN 712 NYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRN Sbjct 363 NYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRN 422 Query 713 DSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAE 772 DSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAE Sbjct 423 DSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAE 482 Query 773 AFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS 809 AFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS Sbjct 483 AFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS 519 >gb|AAR88323.1| lethal factor domain I [Synthetic construct] Length=285 Score = 477 bits (1227), Expect = 2e-132, Method: Composition-based stats. Identities = 267/280 (95%), Positives = 269/280 (96%), Gaps = 2/280 (0%) Query 16 LVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKH 75 L + L G VF+ AGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKH Sbjct 8 LCCVLLLCGAVFVS--PSAGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKH 65 Query 76 IVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKK 135 IVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKK Sbjct 66 IVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKK 125 Query 136 KIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSK 195 KIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSK Sbjct 126 KIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSK 185 Query 196 INQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFA 255 INQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFA Sbjct 186 INQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFA 245 Query 256 YYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQ 295 YYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQ Sbjct 246 YYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQ 285 >ref|ZP_00236307.1| lethal factor precursor [Bacillus cereus G9241] gb|EAL15945.1| lethal factor precursor [Bacillus cereus G9241] Length=476 Score = 135 bits (339), Expect = 1e-29, Method: Composition-based stats. Identities = 103/332 (31%), Positives = 179/332 (53%), Gaps = 29/332 (8%) Query 69 LKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLE 128 +KEI++++V+++V+ + + ++L+EK+P +VLE+YK +GG+IYI D +T+H L Sbjct 1 MKEIIRNLVRLDVRSDVDENSKKTQELVEKLPHEVLELYKNVGGEIYITDKRLTQHEELS 60 Query 129 ALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKIL 188 S I GK L EH+V+AK G EP L+I +EDY + ++ VYYE+GK + Sbjct 61 DSSHKDMFIVSSEGKSFPLREHFVFAKGGKEPSLIIH-AEDYASHLS-SVEVYYELGKAI 118 Query 189 SRDI--LSKINQPYQKFLDVLNTIKN---------ASDSDGQDLLFTNQLK---EHPTDF 234 RD L++ KF++ +N + +D DG+DLLF +LK EH Sbjct 119 IRDTFPLNQKELGNPKFINAINEVNQQKEGKGVNAKADEDGRDLLFGKELKKNLEHGQLV 178 Query 235 SVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKD 294 ++ + N +E Q VFAK+FA Y EP +++ L+ YAP FNYM + ++ +++K+ Sbjct 179 DLDLISGNLSEFQHVFAKSFALYYEPHYKEALKSYAPALFNYMLELDQMRFKEISDDVKE 238 Query 295 QRMLARYEKWEKIK------QHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEE 348 + KW K Q +++W ++L+ + ++ K D I L + + Sbjct 239 KNKNVLDFKWYTRKAESWGVQTFKNWKENLTISEKDIITGYT---GSKYDPINEYLRKYD 295 Query 349 KELLKRIQIDSSDFLSTEEKEFLKKLQIDIRD 380 E++ I D L + K+ L+K++ I++ Sbjct 296 GEIIPNIGGD----LDKKSKKALEKIENQIKN 323 >emb|CAC93924.1| cya [Bacillus anthracis] Length=783 Score = 134 bits (337), Expect = 2e-29, Method: Composition-based stats. Identities = 88/254 (34%), Positives = 143/254 (56%), Gaps = 3/254 (1%) Query 44 VKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDV 103 + E D + E+NKT++E K+ + ++VK E E K + + LL+K+P DV Sbjct 34 MNEHYTESDIKRNHKTEKNKTEKEKFKDSINNLVKTEFTNETLDKIQQTQDLLKKIPKDV 93 Query 104 LEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLV 163 LE+Y +GG+IY D D+ +H L+ LSE++K + G+ +V+ K+ P L+ Sbjct 94 LEIYSELGGEIYFTDIDLVEHKELQDLSEEEKNSMNSRGEKVPFASRFVFEKKRETPKLI 153 Query 164 IQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDL-- 221 I + +DY N+E++ VYYEIGK +S DI+SK +FL+++ ++ + SDS Sbjct 154 I-NIKDYAINSEQSKEVYYEIGKGISLDIISKDKSLDPEFLNLIKSLSDDSDSSDLLFSQ 212 Query 222 LFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFN 281 F +L+ + + F+++N E Q F+ AF+YY P HR VL+LYAP+ F YM+K Sbjct 213 KFKEKLELNNKSIDINFIKENLTEFQHAFSLAFSYYFAPDHRTVLELYAPDMFEYMNKLE 272 Query 282 EQEINLSLEELKDQ 295 + E LK + Sbjct 273 KGGFEKISESLKKE 286 >emb|CAC93925.1| cya [Bacillus anthracis] Length=779 Score = 134 bits (337), Expect = 2e-29, Method: Composition-based stats. Identities = 88/254 (34%), Positives = 143/254 (56%), Gaps = 3/254 (1%) Query 44 VKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDV 103 + E D + E+NKT++E K+ + ++VK E E K + + LL+K+P DV Sbjct 34 MNEHYTESDIKRNHKTEKNKTEKEKFKDSINNLVKTEFTNETLDKIQQTQDLLKKIPKDV 93 Query 104 LEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLV 163 LE+Y +GG+IY D D+ +H L+ LSE++K + G+ +V+ K+ P L+ Sbjct 94 LEIYSELGGEIYFTDIDLVEHKELQDLSEEEKNSMNSRGEKVPFASRFVFEKKRETPKLI 153 Query 164 IQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDL-- 221 I + +DY N+E++ VYYEIGK +S DI+SK +FL+++ ++ + SDS Sbjct 154 I-NIKDYAINSEQSKEVYYEIGKGISLDIISKDKSLDPEFLNLIKSLSDDSDSSDLLFSQ 212 Query 222 LFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFN 281 F +L+ + + F+++N E Q F+ AF+YY P HR VL+LYAP+ F YM+K Sbjct 213 KFKEKLELNNKSIDINFIKENLTEFQHAFSLAFSYYFAPDHRTVLELYAPDMFEYMNKLE 272 Query 282 EQEINLSLEELKDQ 295 + E LK + Sbjct 273 KGGFEKISESLKKE 286 >ref|ZP_00239576.1| calmodulin-sensitive adenylate cyclase [Bacillus cereus G9241] gb|EAL12820.1| calmodulin-sensitive adenylate cyclase [Bacillus cereus G9241] Length=800 Score = 134 bits (336), Expect = 3e-29, Method: Composition-based stats. Identities = 89/253 (35%), Positives = 147/253 (58%), Gaps = 6/253 (2%) Query 44 VKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDV 103 + E D + E+NKT++E K+ + ++VK E E K + + LL+K+P DV Sbjct 34 MNEHYTESDIKRNHKTEKNKTEKEKFKDSINNLVKTEFTNETLDKIQQTQDLLKKIPKDV 93 Query 104 LEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLV 163 LE+Y +GG+IY D D+ +H L+ LSE++K + G+ +V+ K+ P L+ Sbjct 94 LEIYSELGGEIYFTDIDLVEHKELQDLSEEEKNSMNSRGEKVPFASRFVFEKKRETPKLI 153 Query 164 IQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLL- 222 I + +DY N+E++ VYYEIGK +S DI+SK +FL+++ ++ + SDS Sbjct 154 I-NIKDYAINSEQSKEVYYEIGKGISLDIISKDKSLDPEFLNLIKSLSDDSDSSDLLFSQ 212 Query 223 -FTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFN 281 F +L+ + + F+++N E Q F+ AF+YY P HR VL+LYAP+ F YM+K Sbjct 213 KFKEKLELNNKSIDINFIKENLTEFQHAFSLAFSYYFAPDHRTVLELYAPDMFEYMNKLE 272 Query 282 E---QEINLSLEE 291 + +EI+ SL++ Sbjct 273 KGGFEEISESLKK 285 >ref|NP_052818.1| Gene info hypothetical protein pxo1_122 [Bacillus anthracis] ref|NP_652900.1| Gene info calmodulin-sensitive adenylate cyclase [Bacillus anthracis str. A2012] ref|YP_016473.2| Gene info calmodulin-sensitive adenylate cyclase [Bacillus anthracis str. 'Ames Ancestor'] sp|P40136|CYAA_BACAN Gene info Calmodulin-sensitive adenylate cyclase precursor (ATP pyrophosphate-lyase) (Adenylyl cyclase) (Edema factor) (EF) (Anthrax edema toxin adenylate cyclase component) gb|AAA22374.1| Gene info edema factor gb|AAD32426.1| Gene info pXO1-122 [Bacillus anthracis] gb|AAM26089.1| Gene info calmodulin-sensitive adenylate cyclase [Bacillus anthracis str. A2012] gb|AAT28883.2| Gene info calmodulin-sensitive adenylate cyclase [Bacillus anthracis str. 'Ames Ancestor'] Length=800 Score = 134 bits (336), Expect = 3e-29, Method: Composition-based stats. Identities = 88/254 (34%), Positives = 143/254 (56%), Gaps = 3/254 (1%) Query 44 VKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDV 103 + E D + E+NKT++E K+ + ++VK E E K + + LL+K+P DV Sbjct 34 MNEHYTESDIKRNHKTEKNKTEKEKFKDSINNLVKTEFTNETLDKIQQTQDLLKKIPKDV 93 Query 104 LEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLV 163 LE+Y +GG+IY D D+ +H L+ LSE++K + G+ +V+ K+ P L+ Sbjct 94 LEIYSELGGEIYFTDIDLVEHKELQDLSEEEKNSMNSRGEKVPFASRFVFEKKRETPKLI 153 Query 164 IQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLL- 222 I + +DY N+E++ VYYEIGK +S DI+SK +FL+++ ++ + SDS Sbjct 154 I-NIKDYAINSEQSKEVYYEIGKGISLDIISKDKSLDPEFLNLIKSLSDDSDSSDLLFSQ 212 Query 223 -FTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFN 281 F +L+ + + F+++N E Q F+ AF+YY P HR VL+LYAP+ F YM+K Sbjct 213 KFKEKLELNNKSIDINFIKENLTEFQHAFSLAFSYYFAPDHRTVLELYAPDMFEYMNKLE 272 Query 282 EQEINLSLEELKDQ 295 + E LK + Sbjct 273 KGGFEKISESLKKE 286 >gb|AAY15238.1| edema factor [Bacillus anthracis] Length=800 Score = 134 bits (336), Expect = 3e-29, Method: Composition-based stats. Identities = 88/254 (34%), Positives = 143/254 (56%), Gaps = 3/254 (1%) Query 44 VKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDV 103 + E D + E+NKT++E K+ + ++VK E E K + + LL+K+P DV Sbjct 34 MNEHYTESDIKRNHKTEKNKTEKEKFKDSINNLVKTEFTNETLDKIQQTQGLLKKIPKDV 93 Query 104 LEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLV 163 LE+Y +GG+IY D D+ +H L+ LSE++K + G+ +V+ K+ P L+ Sbjct 94 LEIYSELGGEIYFTDIDLVEHKELQDLSEEEKNSMNSRGEKVPFASRFVFEKKRETPKLI 153 Query 164 IQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDL-- 221 I + +DY N+E++ VYYEIGK +S DI+SK +FL+++ ++ + SDS Sbjct 154 I-NIKDYAINSEQSKEVYYEIGKGISLDIISKDKSLDPEFLNLIKSLSDDSDSSDLLFSQ 212 Query 222 LFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFN 281 F +L+ + + F+++N E Q F+ AF+YY P HR VL+LYAP+ F YM+K Sbjct 213 KFKEKLELNNKSIDINFIKENLTEFQHAFSLAFSYYFAPDHRTVLELYAPDMFEYMNKLE 272 Query 282 EQEINLSLEELKDQ 295 + E LK + Sbjct 273 KGGFEKISESLKKE 286 >gb|AAA79215.1| edema factor Length=800 Score = 134 bits (336), Expect = 3e-29, Method: Composition-based stats. Identities = 88/254 (34%), Positives = 143/254 (56%), Gaps = 3/254 (1%) Query 44 VKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDV 103 + E D + E+NKT++E K+ + ++VK E E K + + LL+K+P DV Sbjct 34 MNEHYTESDIKRNHKTEKNKTEKEKFKDSINNLVKTEFTNETLDKIQQTQDLLKKIPKDV 93 Query 104 LEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLV 163 LE+Y +GG+IY D D+ +H L+ LSE++K + G+ +V+ K+ P L+ Sbjct 94 LEIYSELGGEIYFTDIDLVEHKELQDLSEEEKNSMNSRGEKVPFASRFVFEKKRETPKLI 153 Query 164 IQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLL- 222 I + +DY N+E++ VYYEIGK +S DI+SK +FL+++ ++ + SDS Sbjct 154 I-NIKDYAINSEQSKEVYYEIGKGISLDIISKDKSLDPEFLNLIKSLSDDSDSSDLLFSQ 212 Query 223 -FTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFN 281 F +L+ + + F+++N E Q F+ AF+YY P HR VL+LYAP+ F YM+K Sbjct 213 KFKEKLELNNKSIDINFIKENLTEFQHAFSLAFSYYFAPDHRTVLELYAPDMFEYMNKLE 272 Query 282 EQEINLSLEELKDQ 295 + E LK + Sbjct 273 KGGFEKISESLKKE 286 >pdb|1XFV|A Related structures Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And 3' Deoxy-Atp pdb|1XFV|B Related structures Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And 3' Deoxy-Atp pdb|1XFV|C Related structures Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And 3' Deoxy-Atp pdb|1XFV|D Related structures Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And 3' Deoxy-Atp pdb|1XFV|E Related structures Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And 3' Deoxy-Atp pdb|1XFV|F Related structures Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And 3' Deoxy-Atp pdb|1XFW|A Related structures Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And 3'5' Cyclic Amp (Camp) pdb|1XFW|B Related structures Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And 3'5' Cyclic Amp (Camp) pdb|1XFW|C Related structures Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And 3'5' Cyclic Amp (Camp) pdb|1XFW|D Related structures Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And 3'5' Cyclic Amp (Camp) pdb|1XFW|E Related structures Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And 3'5' Cyclic Amp (Camp) pdb|1XFW|F Related structures Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And 3'5' Cyclic Amp (Camp) pdb|1XFX|A Related structures Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride pdb|1XFX|B Related structures Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride pdb|1XFX|C Related structures Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride pdb|1XFX|D Related structures Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride pdb|1XFX|E Related structures Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride pdb|1XFX|F Related structures Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride pdb|1XFY|A Related structures Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin pdb|1XFY|B Related structures Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin pdb|1XFY|C Related structures Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin pdb|1XFY|D Related structures Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin pdb|1XFY|E Related structures Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin pdb|1XFY|F Related structures Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin pdb|1XFZ|A Related structures Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 1 Millimolar Exogenously Added Calcium Chloride pdb|1XFZ|B Related structures Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 1 Millimolar Exogenously Added Calcium Chloride pdb|1XFZ|C Related structures Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 1 Millimolar Exogenously Added Calcium Chloride pdb|1XFZ|D Related structures Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 1 Millimolar Exogenously Added Calcium Chloride pdb|1XFZ|E Related structures Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 1 Millimolar Exogenously Added Calcium Chloride pdb|1XFZ|F Related structures Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 1 Millimolar Exogenously Added Calcium Chloride pdb|1Y0V|A Related structures Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate pdb|1Y0V|B Related structures Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate pdb|1Y0V|C Related structures Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate pdb|1Y0V|D Related structures Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate pdb|1Y0V|E Related structures Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate pdb|1Y0V|F Related structures Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length=777 Score = 133 bits (335), Expect = 4e-29, Method: Composition-based stats. Identities = 88/254 (34%), Positives = 143/254 (56%), Gaps = 3/254 (1%) Query 44 VKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDV 103 + E D + E+NKT++E K+ + ++VK E E K + + LL+K+P DV Sbjct 11 MNEHYTESDIKRNHKTEKNKTEKEKFKDSINNLVKTEFTNETLDKIQQTQDLLKKIPKDV 70 Query 104 LEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLV 163 LE+Y +GG+IY D D+ +H L+ LSE++K + G+ +V+ K+ P L+ Sbjct 71 LEIYSELGGEIYFTDIDLVEHKELQDLSEEEKNSMNSRGEKVPFASRFVFEKKRETPKLI 130 Query 164 IQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDL-- 221 I + +DY N+E++ VYYEIGK +S DI+SK +FL+++ ++ + SDS Sbjct 131 I-NIKDYAINSEQSKEVYYEIGKGISLDIISKDKSLDPEFLNLIKSLSDDSDSSDLLFSQ 189 Query 222 LFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFN 281 F +L+ + + F+++N E Q F+ AF+YY P HR VL+LYAP+ F YM+K Sbjct 190 KFKEKLELNNKSIDINFIKENLTEFQHAFSLAFSYYFAPDHRTVLELYAPDMFEYMNKLE 249 Query 282 EQEINLSLEELKDQ 295 + E LK + Sbjct 250 KGGFEKISESLKKE 263 >pdb|1XFU|A Related structures Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) Truncation Mutant, Ef-Delta 64 In Complex With Calmodulin pdb|1XFU|B Related structures Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) Truncation Mutant, Ef-Delta 64 In Complex With Calmodulin pdb|1XFU|C Related structures Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) Truncation Mutant, Ef-Delta 64 In Complex With Calmodulin pdb|1XFU|D Related structures Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) Truncation Mutant, Ef-Delta 64 In Complex With Calmodulin pdb|1XFU|E Related structures Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) Truncation Mutant, Ef-Delta 64 In Complex With Calmodulin pdb|1XFU|F Related structures Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) Truncation Mutant, Ef-Delta 64 In Complex With Calmodulin Length=747 Score = 120 bits (302), Expect = 3e-25, Method: Composition-based stats. Identities = 80/223 (35%), Positives = 128/223 (57%), Gaps = 3/223 (1%) Query 75 HIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDK 134 ++VK E E K + + LL+K+P DVLE+Y +GG+IY D D+ +H L+ LSE++ Sbjct 12 NLVKTEFTNETLDKIQQTQDLLKKIPKDVLEIYSELGGEIYFTDIDLVEHKELQDLSEEE 71 Query 135 KKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILS 194 K + G+ +V+ K+ P L+I + +DY N+E++ VYYEIGK +S DI+S Sbjct 72 KNSMNSRGEKVPFASRFVFEKKRETPKLII-NIKDYAINSEQSKEVYYEIGKGISLDIIS 130 Query 195 KINQPYQKFLDVLNTIKNASDSDGQDL--LFTNQLKEHPTDFSVEFLEQNSNEVQEVFAK 252 K +FL+++ ++ + SDS F +L+ + + F+++N E Q F+ Sbjct 131 KDKSLDPEFLNLIKSLSDDSDSSDLLFSQKFKEKLELNNKSIDINFIKENLTEFQHAFSL 190 Query 253 AFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQ 295 AF+YY P HR VL+LYAP+ F YM+K + E LK + Sbjct 191 AFSYYFAPDHRTVLELYAPDMFEYMNKLEKGGFEKISESLKKE 233 >ref|XP_600663.2| UniGene infoGene info PREDICTED: similar to nestin [Bos taurus] Length=1616 Score = 38.9 bits (89), Expect = 1.4, Method: Composition-based stats. Identities = 30/113 (26%), Positives = 60/113 (53%), Gaps = 13/113 (11%) Query 316 DSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQ---IDSSDFLSTEEKEFLK 372 +SL EE ++K IP+E + + I SL +E E L+ ++ +++ L E +E LK Sbjct 548 NSLEEE----IQKPSIPLEKQSHETIRSLEKENLESLRSLEEENLETLKILEKENQELLK 603 Query 373 KL---QIDIRDSLSEEEKELLNRIQVDSSN---PLSEKEKEFLKKLKLDIQPY 419 L + ++ SL +E ELL I + L ++ +E ++ L+++++ + Sbjct 604 SLEGKETEVMRSLEKETLELLKPIGKEDPQTLPSLGKENQEIMRSLEVNVETF 656 >ref|XP_685446.2| UniGene infoGene info PREDICTED: hypothetical protein isoform 1 [Danio rerio] Length=1000 Score = 37.7 bits (86), Expect = 3.2, Method: Composition-based stats. Identities = 38/160 (23%), Positives = 75/160 (46%), Gaps = 26/160 (16%) Query 278 DKFNEQEINLSLEELKDQRMLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKK 337 D NE+ L +EL++ R+L + E+ + Q S+ L ++ + ++ + KK Sbjct 581 DTKNEEMRFLRRQELRELRLLQKEEQ-----RAQQQLSNKLQQQRDQICRRFEHETTSKK 635 Query 338 ---DDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEF-------LKKLQ-----------I 376 D + ++ +++K+ ++R++ + ++ L E K L K Q Sbjct 636 RQYDTEVENMERQQKQTIERLEQEHTERLRDEAKRIKAEQDKELSKFQNTHKNRKKETAF 695 Query 377 DIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDI 416 D+ S LL RI VD + L E+E+EF++K + D+ Sbjct 696 DVDVSPKHVRNVLLKRISVDLTQTLDEEEQEFVQKQQQDL 735 >emb|CAL83464.1| two-component sensor kinase [Clostridium botulinum A str. ATCC 3502] Length=637 Score = 37.7 bits (86), Expect = 3.4, Method: Composition-based stats. Identities = 47/195 (24%), Positives = 89/195 (45%), Gaps = 9/195 (4%) Query 329 LQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKE 388 L I+ K D + LSQ ++ K +I D + E+ + +L +I L Sbjct 374 LDFTIKEKGDKSLLILSQNINKINKGFKISIEDQIKNEKLK--SELVANISHDLKTPLTS 431 Query 389 LLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRD 448 ++N + +SE EKE K+ L+ + + ++D L + IN K K+ Sbjct 432 IINYTDILIKEKVSEDEKEEFLKI-LNRKSLKLKTLIED---LFEISKINSGKVKLNKQQ 487 Query 449 IQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNF 508 + ++ LL+QSI Y+ +Y+N N+ + T ++ D +++R N + Sbjct 488 VDVVE-LLNQSIAE--YSDTEIYKNKNLTFILKTFLPEIKIDLDGNRMSRVFENLINNSL 544 Query 509 KYSISSNYMIVDINE 523 KYS+S+ + V+I + Sbjct 545 KYSLSNTRIYVEIED 559
  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding 
environmental samples from WGS projects
    Posted date:  May 27, 2007  5:53 PM
  Number of letters in database: 1,723,618,044
  Number of sequences in database:  4,984,388
Lambda     K      H
   0.314    0.134    0.369 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4984388
Number of Hits to DB: 137992848
Number of extensions: 6451324
Number of successful extensions: 29828
Number of sequences better than 10: 174
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 30339
Number of HSP's successfully gapped: 227
Length of query: 809
Length of database: 1723618044
Length adjustment: 141
Effective length of query: 668
Effective length of database: 1020819336
Effective search space: 681907316448
Effective search space used: 681907316448
T: 11
A: 40
X1: 16 (7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (20.8 bits)
S2: 82 (36.2 bits)