Job Title: capA_B.anthracis(Ames Anc.)

Show Conserved Domains

RID=5P71X32Y012, capA_B.anthracis(Ames Anc.) BLASTP 2.2.16 (Mar-25-2007)
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 5P71X32Y012


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           4,984,388 sequences; 1,723,618,044 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports

Query=  capA_B.anthracis(Ames Anc.)
Length=411


Distance tree of resultsNew  
Score E Sequences producing significant alignments: (Bits) Value ref|NP_053211.1| hypothetical protein pxo2_56 [Bacillus anthr... 786 0.0 Gene info gb|AAA22288.1| 46 Kd encapsulation protein CapA 784 0.0 ref|YP_080918.1| poly-gamma-glutamate synthesis protein [Baci... 364 5e-99 Gene info ref|NP_391469.1| hypothetical protein BSU35880 [Bacillus subt... 351 4e-95 Gene info dbj|BAB40950.1| ywtB [Bacillus subtilis] 350 6e-95 gb|AAY85942.1| PgaA [Bacillus subtilis] 347 5e-94 dbj|BAD14938.1| CapA [Bacillus anthracis] 214 8e-54 ref|NP_951098.1| capsule biosynthesis protein, putative [Geob... 181 6e-44 Gene info ref|ZP_01389407.1| capsule biosynthesis protein, putative [Ge... 174 6e-42 ref|YP_386459.1| capsule biosynthesis protein, putative [Geob... 173 2e-41 Gene info ref|ZP_01592720.1| capsule biosynthesis protein, putative [Ge... 162 4e-38 ref|YP_001229075.1| Putative enzyme of poly-gamma-glutamate b... 160 1e-37 Gene info ref|YP_074355.1| hypothetical protein STH526 [Symbiobacterium... 159 3e-37 Gene info ref|YP_900304.1| capsule biosynthesis protein, putative [Pelo... 153 2e-35 Gene info ref|YP_001036934.1| Putative enzyme of poly-gamma-glutamate b... 146 2e-33 Gene info ref|ZP_01620324.1| hypothetical protein L8106_16464 [Lyngbya ... 145 3e-33 ref|YP_633062.1| putative polyglutamate synthase CapA [Myxoco... 144 8e-33 Gene info gb|AAK64444.1|AF377339_5 polyglutamate synthase CapA [Myxococcus 144 8e-33 ref|YP_447952.1| putative poly-gamma-glutamate biosynthesis p... 144 1e-32 Gene info ref|ZP_00236620.1| capA protein, putative [Bacillus cereus G9... 142 3e-32 ref|NP_831556.1| Capsule biosynthesis protein capA [Bacillus ... 140 1e-31 Gene info ref|ZP_01463066.1| polyglutamate synthase CapA [Stigmatella a... 140 1e-31 ref|NP_978256.1| hypothetical protein BCE_1940 [Bacillus cere... 140 2e-31 Gene info ref|ZP_00742485.1| Capsule biosynthesis protein capA [Bacillu... 138 6e-31 ref|YP_036028.1| conserved hypothetical protein, possible cap... 137 9e-31 Gene info ref|ZP_01183700.1| capsule biosynthesis protein capA [Bacillu... 137 1e-30 ref|YP_083266.1| conserved hypothetical protein; possible cap... 137 2e-30 Gene info ref|YP_894465.1| possible capsule biosynthesis protein [Bacil... 136 2e-30 Gene info ref|NP_844272.1| hypothetical protein BA1855 [Bacillus anthra... 136 2e-30 Gene info ref|YP_001048222.1| Putative enzyme of poly-gamma-glutamate b... 131 7e-29 Gene info ref|YP_293341.1| putative poly-gamma-glutamate biosynthesis e... 131 8e-29 Gene info ref|YP_284418.1| putative poly-gamma-glutamate biosynthesis e... 130 1e-28 Gene info ref|YP_012632.1| hypothetical protein LMOf2365_0020 [Listeria... 129 3e-28 Gene info gb|EBA22002.1| hypothetical protein LMRG_02446 [Listeria monocyt 129 3e-28 gb|EBA30238.1| hypothetical protein LMHG_01613 [Listeria mono... 129 3e-28 ref|ZP_00232690.1| conserved hypothetical protein [Listeria m... 129 3e-28 ref|ZP_00230811.1| conserved hypothetical protein [Listeria m... 129 3e-28 ref|NP_463550.1| hypothetical protein lmo0017 [Listeria monoc... 129 3e-28 Gene info ref|YP_002048.1| putative lipoprotein [Leptospira interrogans... 129 4e-28 Gene info ref|NP_711855.1| Capsule biosynthesis protein capA [Leptospir... 129 5e-28 Gene info gb|EBA30591.1| hypothetical protein LMIG_00292 [Listeria mono... 128 5e-28 ref|YP_359604.1| capA domain protein [Carboxydothermus hydrog... 126 2e-27 Gene info ref|ZP_01425218.1| Putative enzyme of poly-gamma-glutamate bi... 125 4e-27 ref|YP_147857.1| poly-gamma-glutamate biosynthesis (capsule f... 125 4e-27 Gene info ref|ZP_01542067.1| conserved hypothetical protein [Shewanella... 125 4e-27 ref|NP_682591.1| poly-gamma-glutamic synthesis PgsA protein h... 124 7e-27 Gene info ref|YP_378984.1| Putative enzyme of poly-gamma-glutamate bios... 124 9e-27 Gene info ref|YP_001203514.1| hypothetical protein; putative metallo-de... 124 9e-27 Gene info ref|YP_076491.1| putative poly-gamma-glutamate biosynthesis e... 124 1e-26 Gene info ref|ZP_00615511.1| similar to Putative enzyme of poly-gamma-g... 123 2e-26 ref|YP_001231695.1| Putative enzyme of poly-gamma-glutamate b... 123 3e-26 Gene info ref|YP_797675.1| Poly-gamma-glutamate biosynthesis [Leptospir... 122 4e-26 Gene info ref|YP_877614.1| capsule biosynthesis protein capA [Clostridi... 122 6e-26 Gene info ref|NP_624217.1| putative enzyme of poly-gamma-glutamate bios... 121 6e-26 Gene info ref|YP_982634.1| putative poly-gamma-glutamate biosynthesis e... 119 3e-25 Gene info ref|YP_001161126.1| hypothetical protein Strop_4320 [Salinisp... 119 4e-25 Gene info ref|YP_001046594.1| Putative enzyme of poly-gamma-glutamate b... 119 5e-25 Gene info ref|ZP_01649625.1| Putative enzyme of poly-gamma-glutamate bi... 118 7e-25 ref|YP_269402.1| hypothetical protein CPS_2688 [Colwellia psy... 118 8e-25 Gene info ref|ZP_01672783.1| Putative enzyme of poly-gamma-glutamate bi... 117 1e-24 ref|YP_658558.1| poly-gamma-glutamate biosynthesis/capsule bi... 117 1e-24 Gene info ref|YP_001126007.1| Putative enzyme of poly-gamma-glutamate b... 117 1e-24 Gene info ref|YP_001158428.1| hypothetical protein Strop_1584 [Salinisp... 117 2e-24 Gene info ref|ZP_00569973.1| similar to Putative enzyme of poly-gamma-g... 117 2e-24 emb|CAK18893.1| hypothetical protein [Ruminococcus flavefaciens] 116 3e-24 ref|ZP_01311108.1| Putative enzyme of poly-gamma-glutamate bi... 115 4e-24 ref|YP_958922.1| Putative enzyme of poly-gamma-glutamate bios... 115 5e-24 Gene info ref|ZP_01575958.1| poly-gamma-glutamate synthesis protein (ca... 115 7e-24 ref|YP_628409.1| CapA family protein [Myxococcus xanthus DK 1... 114 9e-24 Gene info ref|ZP_01668594.1| putative enzyme of poly-gamma-glutamate bi... 114 1e-23 ref|ZP_01463805.1| capsule biosynthesis protein CapA [Stigmat... 113 2e-23 ref|YP_643269.1| poly-gamma-glutamate synthesis protein (caps... 113 2e-23 Gene info gb|AAQ74380.1| poly-gamma-glutamate synthesis protein [Hydra mag 113 3e-23 UniGene info ref|YP_138651.1| hypothetical protein stu0110 [Streptococcus ... 112 3e-23 Gene info ref|YP_723582.1| Putative enzyme of poly-gamma-glutamate bios... 112 3e-23 Gene info ref|NP_781225.1| encapsulation protein capA [Clostridium teta... 112 5e-23 Gene info ref|NP_842273.1| possible poly-gamma-glutamate synthesis prot... 112 6e-23 Gene info ref|YP_710372.1| hypothetical protein; putative signal peptid... 110 1e-22 Gene info ref|YP_300440.1| poly-gamma-glutamate synthesis protein PgsA ... 110 2e-22 Gene info ref|YP_479183.1| poly-gamma-glutamate biosynthesis protein [F... 110 2e-22 Gene info ref|NP_469859.1| hypothetical protein lin0516 [Listeria innoc... 109 3e-22 Gene info ref|YP_288205.1| hypothetical protein Tfu_0144 [Thermobifida ... 108 5e-22 Gene info ref|YP_464763.1| putative enzyme of poly-gamma-glutamate bios... 108 5e-22 Gene info ref|NP_464044.1| hypothetical protein lmo0516 [Listeria monoc... 108 6e-22 Gene info ref|ZP_00230916.1| capA domain protein [Listeria monocytogene... 108 9e-22 ref|YP_013150.1| capA domain protein [Listeria monocytogenes ... 107 1e-21 Gene info ref|ZP_00232357.1| capA domain protein [Listeria monocytogene... 107 1e-21 gb|EBA24133.1| hypothetical protein LMRG_00197 [Listeria monocyt 107 1e-21 ref|ZP_01649421.1| Putative enzyme of poly-gamma-glutamate bi... 107 2e-21 ref|NP_969633.1| putative capsule biosynthesis protein [Bdell... 106 2e-21 Gene info ref|NP_721253.1| hypothetical protein SMU.843 [Streptococcus ... 106 3e-21 Gene info gb|EBA32775.1| hypothetical protein LMIG_02687 [Listeria mono... 106 3e-21 ref|NP_969818.1| capsule biosynthesis protein capA [Bdellovib... 106 3e-21 Gene info ref|NP_269033.1| hypothetical protein SPy0818 [Streptococcus ... 105 4e-21 Gene info ref|YP_602214.1| Capsule biosynthesis protein capA [Streptoco... 105 4e-21 Gene info ref|YP_280081.1| capsule biosynthesis protein [Streptococcus ... 105 5e-21 Gene info ref|ZP_01620698.1| poly-gamma-glutamic synthesis PgsA protein... 105 5e-21 ref|NP_691512.1| hypothetical protein OB0591 [Oceanobacillus ... 105 6e-21 Gene info ref|NP_802565.1| hypothetical protein SPs1303 [Streptococcus ... 105 7e-21 Gene info ref|ZP_00910663.1| encapsulation protein CapA [Clostridium be... 104 1e-20
Alignments
>ref|NP_053211.1| Gene info hypothetical protein pxo2_56 [Bacillus anthracis] ref|NP_653031.1| Gene info capsule biosynthesis protein CapA [Bacillus anthracis str. A2012] ref|YP_016574.2| Gene info capsule biosynthesis protein capa, (pxo2-56) [Bacillus anthracis str. 'Ames Ancestor'] sp|P19579|CAPA_BACAN Gene info Capsule biosynthesis protein capA gb|AAF13661.1|AF188935_59 Gene info pXO2-56 [Bacillus anthracis] gb|AAM26220.1| Gene info capsule biosynthesis protein CapA, (pXO2-56) [Bacillus anthracis str. A2012] gb|AAT28994.2| Gene info capsule biosynthesis protein CapA, (pXO2-56) [Bacillus anthracis str. 'Ames Ancestor'] gb|ABG25872.1| putative CapA [Bacillus circulans] gb|ABG25875.1| putative CapA [Bacillus sp. CBD119] Length=411 Score = 786 bits (2029), Expect = 0.0, Method: Composition-based stats. Identities = 411/411 (100%), Positives = 411/411 (100%), Gaps = 0/411 (0%) Query 1 MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKL 60 MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKL Sbjct 1 MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKL 60 Query 61 TMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKAD 120 TMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKAD Sbjct 61 TMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKAD 120 Query 121 KNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFK 180 KNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFK Sbjct 121 KNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFK 180 Query 181 DVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNA 240 DVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNA Sbjct 181 DVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNA 240 Query 241 DLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLG 300 DLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLG Sbjct 241 DLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLG 300 Query 301 NFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTSALDKNRVYRQLTKD 360 NFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTSALDKNRVYRQLTKD Sbjct 301 NFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTSALDKNRVYRQLTKD 360 Query 361 TSKGALWSKKDDKLEIKLNHKHVIEKMKKREKQEHQDKQEKENQVSVETTT 411 TSKGALWSKKDDKLEIKLNHKHVIEKMKKREKQEHQDKQEKENQVSVETTT Sbjct 361 TSKGALWSKKDDKLEIKLNHKHVIEKMKKREKQEHQDKQEKENQVSVETTT 411 >gb|AAA22288.1| 46 Kd encapsulation protein CapA Length=411 Score = 784 bits (2025), Expect = 0.0, Method: Composition-based stats. Identities = 410/411 (99%), Positives = 410/411 (99%), Gaps = 0/411 (0%) Query 1 MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKL 60 MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKL Sbjct 1 MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKL 60 Query 61 TMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKAD 120 TMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKAD Sbjct 61 TMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKAD 120 Query 121 KNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFK 180 KNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFK Sbjct 121 KNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFK 180 Query 181 DVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNA 240 DVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNA Sbjct 181 DVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNA 240 Query 241 DLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLG 300 DLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLG Sbjct 241 DLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLG 300 Query 301 NFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTSALDKNRVYRQLTKD 360 NFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPV SALDKNRVYRQLTKD Sbjct 301 NFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVASALDKNRVYRQLTKD 360 Query 361 TSKGALWSKKDDKLEIKLNHKHVIEKMKKREKQEHQDKQEKENQVSVETTT 411 TSKGALWSKKDDKLEIKLNHKHVIEKMKKREKQEHQDKQEKENQVSVETTT Sbjct 361 TSKGALWSKKDDKLEIKLNHKHVIEKMKKREKQEHQDKQEKENQVSVETTT 411 >ref|YP_080918.1| Gene info poly-gamma-glutamate synthesis protein [Bacillus licheniformis ATCC 14580] ref|YP_093346.1| Gene info YwtB [Bacillus licheniformis ATCC 14580] gb|AAU25280.1| Gene info poly-gamma-glutamate synthesis protein [Bacillus licheniformis ATCC 14580] gb|AAU42653.1| Gene info YwtB [Bacillus licheniformis DSM 13] emb|CAJ77626.1| capsular polyglutamate biosynthesis like protein [Bacillus licheniformis] emb|CAJ77632.1| capsular polyglutamate biosynthesis like protein [Bacillus licheniformis] Length=389 Score = 364 bits (935), Expect = 5e-99, Method: Composition-based stats. Identities = 186/391 (47%), Positives = 272/391 (69%), Gaps = 11/391 (2%) Query 1 MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKL 60 M+++L FQEKLL K+ KKK ++V IVLP+I ++ TWV + + + +E+ KL Sbjct 1 MKKQLNFQEKLLKLTKQEKKKTNKHVFIVLPVIFCLMFVFTWVGSAKTPSQMDKKEDAKL 60 Query 61 TMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKAD 120 T T VGDIMMGR+V+++ N +G++ VF++V PY SD+++GNFE+PV + K+YQ+A+ Sbjct 61 TATFVGDIMMGRNVEKVTNLHGSESVFKNVKPYFNVSDFITGNFENPV--TNAKDYQEAE 118 Query 121 KNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFK 180 KNIHL +E+V+ +K+ F+VLN ANNH DYG G KDT+ F +L+ VGAG N + Sbjct 119 KNIHLQTNQESVETLKKLNFSVLNFANNHAMDYGEDGLKDTLNKFSNENLELVGAGNNLE 178 Query 181 DVK-NIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGN 239 D K ++ YQNVNGV++ATLGFTD + A K + G L ++P + + I++A Sbjct 179 DAKQHVSYQNVNGVKIATLGFTDVYTKNFTAKKNRGGVLPLSPKIFIPMIAEASK----K 234 Query 240 ADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSL 299 ADLV+V+ HWG+EYDN+P+ RQ+ LAKA+ DAGAD+I+G HPHVL+ +VY +IFYSL Sbjct 235 ADLVLVHVHWGQEYDNEPNDRQKDLAKAIADAGADVIIGAHPHVLEPIEVYNGTVIFYSL 294 Query 300 GNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTSA--LDKNRVYRQL 357 GNFVFDQGW+RT+DSALVQYHL ++G +V PLNI+E +P P+ + L + ++RQL Sbjct 295 GNFVFDQGWSRTRDSALVQYHLMNDGKGRFEVTPLNIREATPTPLGKSDFLKRKAIFRQL 354 Query 358 TKDTSKGALWSKKDDKLEIKLNHKHVIEKMK 388 TK T+ W +++ KL +++H ++ K Sbjct 355 TKGTNLD--WKEENGKLTFEVDHADKLKNNK 383 >ref|NP_391469.1| Gene info hypothetical protein BSU35880 [Bacillus subtilis subsp. subtilis str. 168] sp|P96738|CAPA_BACSU PGA biosynthesis protein capA emb|CAB07469.1| ywtB [Bacillus subtilis] emb|CAB15605.1| Gene info ywtB [Bacillus subtilis subsp. subtilis str. 168] dbj|BAA85265.1| PgsA [Bacillus subtilis] dbj|BAB13486.1| CapA [Bacillus subtilis] gb|ABK59056.1| polyglutamic acid synthase A [Bacillus licheniformis] Length=380 Score = 351 bits (901), Expect = 4e-95, Method: Composition-based stats. Identities = 193/392 (49%), Positives = 266/392 (67%), Gaps = 14/392 (3%) Query 1 MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKL 60 M+++L+F EKLL K+ KKK ++V I +P++ V++ A W + E VK ++ L Sbjct 1 MKKELSFHEKLLKLTKQQKKKTNKHVFIAIPIVFVLMFAFMWAGKAET-PKVKTYSDDVL 59 Query 61 TMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKAD 120 + + VGDIMMGR+V+++ + G D +F++V P + SDYV+GNFE+PV + KNY++AD Sbjct 60 SASFVGDIMMGRYVEKVTEQKGADSIFQYVEPIFRASDYVAGNFENPVTYQ--KNYKQAD 117 Query 121 KNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFK 180 K IHL +E+VK +K+ FTVLN ANNH DYG +G KDT+ F + +LD VGAG + Sbjct 118 KEIHLQTNKESVKVLKDMNFTVLNSANNHAMDYGVQGMKDTLGEFAKQNLDIVGAGYSLS 177 Query 181 DVKN-IVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGN 239 D K I YQ VNGV +ATLGFTD G A K PG L +P++ + IS+AK + Sbjct 178 DAKKKISYQKVNGVTIATLGFTDVSGKGFAAKKNTPGVLPADPEIFIPMISEAKK----H 233 Query 240 ADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSL 299 AD+VVV +HWG+EYDN P+ RQ LA+AM DAGADIIVGHHPHVL+ +VY +IFYSL Sbjct 234 ADIVVVQSHWGQEYDNDPNDRQRQLARAMSDAGADIIVGHHPHVLEPIEVYNGTVIFYSL 293 Query 300 GNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTS-ALDKNRVYRQLT 358 GNFVFDQGWTRT+DSALVQYHL+ NGT +V P++I E +P PV +L + + R+LT Sbjct 294 GNFVFDQGWTRTRDSALVQYHLKKNGTGRFEVTPIDIHEATPAPVKKDSLKQKTIIRELT 353 Query 359 KDTSKGALWSKKDDKLEIKLNHKHVIEKMKKR 390 KD++ W +D KL ++H +K+K + Sbjct 354 KDSNFA--WKVEDGKLTFDIDHS---DKLKSK 380 >dbj|BAB40950.1| ywtB [Bacillus subtilis] Length=380 Score = 350 bits (899), Expect = 6e-95, Method: Composition-based stats. Identities = 193/392 (49%), Positives = 265/392 (67%), Gaps = 14/392 (3%) Query 1 MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKL 60 M+++L+F EKLL K+ KKK ++V I +P++ V++ A W + E VK ++ L Sbjct 1 MKKELSFHEKLLKLTKQQKKKTNKHVFIAIPIVFVLMFAFMWAGKAET-PKVKTYSDDVL 59 Query 61 TMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKAD 120 + + VGDIMMGR+V+++ + G D +F++V P + SDYV+GNFE+PV + KNY++AD Sbjct 60 SASFVGDIMMGRYVEKVTEQKGADSIFQYVEPIFRASDYVAGNFENPVTYQ--KNYKQAD 117 Query 121 KNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFK 180 K IHL +E+VK +K+ FTVLN ANNH DYG +G KDT+ F +LD VGAG + Sbjct 118 KEIHLQTNKESVKVLKDMNFTVLNSANNHAMDYGVQGMKDTLGEFATKNLDIVGAGYSLS 177 Query 181 DVKN-IVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGN 239 D K I YQ VNGV +ATLGFTD G A K PG L +P++ + IS+AK + Sbjct 178 DAKKKISYQKVNGVTIATLGFTDVSGKGFAAKKNTPGVLPADPEIFIPMISEAKK----H 233 Query 240 ADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSL 299 AD+VVV +HWG+EYDN P+ RQ LA+AM DAGADIIVGHHPHVL+ +VY +IFYSL Sbjct 234 ADIVVVQSHWGQEYDNDPNDRQRQLARAMSDAGADIIVGHHPHVLEPIEVYNGTVIFYSL 293 Query 300 GNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTS-ALDKNRVYRQLT 358 GNFVFDQGWTRT+DSALVQYHL+ NGT +V P++I E +P PV +L + + R+LT Sbjct 294 GNFVFDQGWTRTRDSALVQYHLKKNGTGRFEVTPIDIHEATPAPVKKDSLKQKTIIRELT 353 Query 359 KDTSKGALWSKKDDKLEIKLNHKHVIEKMKKR 390 KD++ W +D KL ++H +K+K + Sbjct 354 KDSNFA--WKVEDGKLTFDIDHS---DKLKSK 380 >gb|AAY85942.1| PgaA [Bacillus subtilis] Length=380 Score = 347 bits (891), Expect = 5e-94, Method: Composition-based stats. Identities = 192/392 (48%), Positives = 265/392 (67%), Gaps = 14/392 (3%) Query 1 MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKL 60 M+++L+F EKLL K+ KKK ++V I +P++ V++ A W + E VK ++ L Sbjct 1 MKKELSFHEKLLKLTKQQKKKTNKHVFIAIPIVFVLMFAFMWAGKAET-PKVKTYSDDVL 59 Query 61 TMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKAD 120 + + VGDIMMGR+V+++ + G D +F++V P + SDYV+GNFE+PV + KNY++AD Sbjct 60 SASFVGDIMMGRYVEKVTEQKGADSIFQYVEPIFRASDYVAGNFENPVTYQ--KNYKQAD 117 Query 121 KNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFK 180 K IHL +E+VK +K+ FTVLN ANNH DYG +G KDT+ F + +LD VGAG + Sbjct 118 KEIHLQTNKESVKVLKDMNFTVLNSANNHAMDYGVQGMKDTLGEFAKQNLDIVGAGYSLS 177 Query 181 DVKN-IVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGN 239 D K I YQ VNGV +ATLGFTD A K PG L +P++ + IS+AK + Sbjct 178 DAKKKISYQKVNGVTIATLGFTDVSGKDFAAKKNTPGVLPADPEIFIPMISEAKK----H 233 Query 240 ADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSL 299 AD+VVV +HWG+EYDN P+ RQ LA+AM DAGADIIVGHHPHVL+ +VY +IFYSL Sbjct 234 ADIVVVQSHWGQEYDNDPNDRQRQLARAMSDAGADIIVGHHPHVLEPIEVYNGTVIFYSL 293 Query 300 GNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTS-ALDKNRVYRQLT 358 GNFVFDQGWTRT+DSALVQYHL+ NGT +V P++I E +P PV +L + + R+LT Sbjct 294 GNFVFDQGWTRTRDSALVQYHLKKNGTGRFEVTPIDIHEATPAPVKKDSLKQKTIIRELT 353 Query 359 KDTSKGALWSKKDDKLEIKLNHKHVIEKMKKR 390 KD++ W +D KL ++H +K+K + Sbjct 354 KDSNFA--WKVEDGKLTFDIDHS---DKLKSK 380 >dbj|BAD14938.1| CapA [Bacillus anthracis] Length=107 Score = 214 bits (545), Expect = 8e-54, Method: Composition-based stats. Identities = 106/107 (99%), Positives = 106/107 (99%), Gaps = 0/107 (0%) Query 1 MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKL 60 MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKL Sbjct 1 MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKL 60 Query 61 TMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHP 107 TMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNF HP Sbjct 61 TMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFGHP 107 >ref|NP_951098.1| Gene info capsule biosynthesis protein, putative [Geobacter sulfurreducens PCA] gb|AAR33371.1| Gene info capsule biosynthesis protein, putative [Geobacter sulfurreducens PCA] Length=351 Score = 181 bits (460), Expect = 6e-44, Method: Composition-based stats. Identities = 100/279 (35%), Positives = 148/279 (53%), Gaps = 8/279 (2%) Query 58 EKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQ 117 E+++++ VGD+M+ + + RYG Y F + L+ SD V GN E P L + + ++ Sbjct 24 ERISLSFVGDVMLAGSATDTLQRYGYSYPFSATAAELRRSDLVVGNLEAP-LTDGGREFR 82 Query 118 KADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGE 177 K A A+K AGF+V+ LANNHM D+GA G DTI + + GAG Sbjct 83 A--KRFRFKASPVAAAALKRAGFSVMTLANNHMMDFGADGLSDTIHHLNRNGIAFAGAGP 140 Query 178 NFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKK 237 + D + V G VA L ++ AT+ +PG+ L I + + Sbjct 141 SIADARREASVTVRGQTVAFLAYSLTQPIEFFATEGRPGTAPGYAGHYLADIRRVRS--- 197 Query 238 GNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFY 297 +AD VVV+ HWG+E PSP Q A +DAGADI++GHHPHVLQ ++Y+ IFY Sbjct 198 -SADHVVVSFHWGQERAALPSPYQIETAHRAIDAGADIVIGHHPHVLQGIEIYRGSPIFY 256 Query 298 SLGNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNI 336 SLGNF F + + D +++ G I++V+PLN+ Sbjct 257 SLGNFAFGSR-SPSADRSIIARVTLGEGPPIVEVIPLNV 294 >ref|ZP_01389407.1| capsule biosynthesis protein, putative [Geobacter sp. FRC-32] gb|EAT61314.1| capsule biosynthesis protein, putative [Geobacter sp. FRC-32] Length=351 Score = 174 bits (442), Expect = 6e-42, Method: Composition-based stats. Identities = 97/278 (34%), Positives = 145/278 (52%), Gaps = 8/278 (2%) Query 59 KLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQK 118 ++ + VGDIM+ + R G DY F LK D GN E P+ + Sbjct 24 QVVINAVGDIMLAGKGGAALERMGYDYPFAATVAALKAGDLAMGNLETPI---TSGGLEF 80 Query 119 ADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGEN 178 DK+ A + A+K AGF VL +ANNHM DYG G DTI + + + GAG++ Sbjct 81 KDKSYRFKAVPQAAAALKRAGFRVLTMANNHMLDYGTDGLLDTIYHLDKQGIKHSGAGKS 140 Query 179 FKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKG 238 + + + NG R+A L ++ + A AT + G+ P K IS+ + Sbjct 141 LTEARREAIIDCNGNRIAFLSYSLTYPAEFFATGMRAGTAPGYPSYYEKDISRIR----A 196 Query 239 NADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYS 298 NAD V+V+ HWG+E P Q + A+ V+AGAD+++GHHPHVLQ + Y+ G+IFYS Sbjct 197 NADYVIVSFHWGKEGAATPKRYQVSTARRAVEAGADLVIGHHPHVLQGIESYRNGLIFYS 256 Query 299 LGNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNI 336 LGNF F +R D +++ D G +++P+N+ Sbjct 257 LGNFAFGS-LSRNSDRSIIARITLDRGIKEAELIPINV 293 >ref|YP_386459.1| Gene info capsule biosynthesis protein, putative [Geobacter metallireducens GS-15] gb|ABB33734.1| Gene info capsule biosynthesis protein, putative [Geobacter metallireducens GS-15] Length=349 Score = 173 bits (438), Expect = 2e-41, Method: Composition-based stats. Identities = 100/277 (36%), Positives = 141/277 (50%), Gaps = 8/277 (2%) Query 60 LTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKA 119 + +T VGDIM+ ++R G DY F + L+ D GN E P L E Y+ Sbjct 25 IVITCVGDIMLAGSATPTLSRSGYDYPFAKTAQELRRGDIAMGNLEAP-LTERGTEYR-- 81 Query 120 DKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENF 179 DK A+K AGF+VL LANNHM DYG +G +DT+ + + GAG + Sbjct 82 DKTYRFRTNPIAAAALKRAGFSVLTLANNHMMDYGNEGLQDTLATLSRHGIAHTGAGASL 141 Query 180 KDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGN 239 + + +V G R+A L ++ F + A +PG+ + + I +AK Sbjct 142 AEARREAVVSVRGKRIAFLAYSLTFPSEFYAGPNRPGTAPGYAPHVREDIRRAK----AE 197 Query 240 ADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSL 299 AD VVV+ HWG E P Q A+ +DAGAD I+GHHPHVLQ + Y+ I YSL Sbjct 198 ADYVVVSFHWGAERAEFPKQYQTETARLAIDAGADAIIGHHPHVLQGIEFYRGKPILYSL 257 Query 300 GNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNI 336 GNF F T S + + L D T++ ++VPLN+ Sbjct 258 GNFAFGSRSTAADRSVMARLTLSDEETSV-ELVPLNV 293 >ref|ZP_01592720.1| capsule biosynthesis protein, putative [Geobacter lovleyi SZ] gb|EAV88822.1| capsule biosynthesis protein, putative [Geobacter lovleyi SZ] Length=386 Score = 162 bits (409), Expect = 4e-38, Method: Composition-based stats. Identities = 90/278 (32%), Positives = 148/278 (53%), Gaps = 8/278 (2%) Query 59 KLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQK 118 ++ + GD+M+G ++ + + G + F ++P LK D N E P+ + + Sbjct 72 EVVIQAAGDVMLGGRWEQQMAQDGYFHPFAKIAPELKKGDITLINLEAPL---TGRGTEF 128 Query 119 ADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGEN 178 DK + + V A+K+AG T + LANNH DYG++G DT++ +A + +VGAGEN Sbjct 129 VDKKYRFRVRPQAVAALKKAGITTVTLANNHSMDYGSQGLLDTLQQLDKAGIGHVGAGEN 188 Query 179 FKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKG 238 + + ++ G +V LG++ A ++ G+ + ++ I A+ Sbjct 189 LAAARKPLVYDIRGTKVGLLGYSLTLPLEFWAGDKRAGTAPLMEKMVKDDIVAARR---- 244 Query 239 NADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYS 298 A +V+V HWGEE + Q LA+ M+DAGAD ++GHHPH+LQ + YK+GIIFYS Sbjct 245 QASIVIVTVHWGEEGKTQLREYQPRLARMMIDAGADAVIGHHPHILQGIERYKRGIIFYS 304 Query 299 LGNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNI 336 LGNF F ++ D L+ D +++P+NI Sbjct 305 LGNFAFAHK-SKIADRTLLVRLRFDGDKRTTELLPVNI 341 >ref|YP_001229075.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like protein [Geobacter uraniumreducens Rf4] gb|ABQ24502.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like protein [Geobacter uraniumreducens Rf4] Length=348 Score = 160 bits (405), Expect = 1e-37, Method: Composition-based stats. Identities = 93/278 (33%), Positives = 139/278 (50%), Gaps = 9/278 (3%) Query 59 KLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQK 118 K+ + VGDIM+ R G DY F LKN D GN E P+ L + Sbjct 24 KIVVNAVGDIMLAGKASASFARLGYDYPFAATVSALKNGDIAVGNLEAPLAL---NGTEF 80 Query 119 ADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGEN 178 +K A+K AGF++L LANNHM D+G+ G ++TI + + + GAGE Sbjct 81 KNKKFRFKTDPRAATALKRAGFSILTLANNHMLDFGSDGLRETIYNLDQQGIQHSGAGET 140 Query 179 FKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKG 238 + NG ++A L ++ + A ++ G+ + I++A+ Sbjct 141 LATARREALVTCNGGKIAFLAYSLTYPEEFYAGDKRAGTAPGFRPYYQEDIARAR----A 196 Query 239 NADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYS 298 AD VVV+ HWG E Q A A VDAGAD+++GHHPHVLQ + YK +IFYS Sbjct 197 VADYVVVSFHWGTEKAAMTKSYQVAAAHRAVDAGADLVLGHHPHVLQGIERYKGSVIFYS 256 Query 299 LGNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNI 336 LGN+ F G + D +++ D+G ++++PLN+ Sbjct 257 LGNYAF--GSLSSSDRSVIARITLDDGVKEVELIPLNV 292 >ref|YP_074355.1| Gene info hypothetical protein STH526 [Symbiobacterium thermophilum IAM 14863] dbj|BAD39511.1| Gene info conserved hypothetical protein [Symbiobacterium thermophilum IAM 14863] Length=516 Score = 159 bits (403), Expect = 3e-37, Method: Composition-based stats. Identities = 93/293 (31%), Positives = 152/293 (51%), Gaps = 16/293 (5%) Query 58 EKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQ 117 E ++++VGD+M+ R V + GT Y V +L +D N E P+ + K Sbjct 210 EWASLSVVGDMMLARGVARAMRENGTLYPVEKVREHLAAADLAFANLESPIGV---KGRP 266 Query 118 KADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGE 177 K I A+ E V+ ++ AG + +ANNH+ DY + +T+ EA + + G G Sbjct 267 LPGKQIWFRAEPEAVEVLRAAGLDGVTVANNHILDYDEENFLETLDLLAEAGIPWTGGGR 326 Query 178 NFKDVKNIVYQNVNGVRVATLG---FTDAFV-----AGAIATKEQPGSLSMNPDVLLKQI 229 + + + + GVR+A LG F D F AT+++PG ++ D L + I Sbjct 327 DLAEARRPLVLEARGVRIAFLGYSEFADLFFDWDYPRSFAATEDRPGVPAIREDWLAEDI 386 Query 230 SKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDV 289 A++ AD+V V HWG E+ N P+ Q LA+ +VD GAD+++G HPH +Q F++ Sbjct 387 RAAREV----ADVVAVALHWGVEFVNSPTEEQRRLARYIVDQGADLVLGSHPHAIQGFEI 442 Query 290 YKQGIIFYSLGNFVFD-QGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSP 341 Y G I YSLGNF+ D Q ++S ++ + + +G ++V P+ I+ P Sbjct 443 YNGGFIAYSLGNFIMDRQDTDLARESMILDFLIGPDGVKQVEVHPVWIEAEQP 495 >ref|YP_900304.1| Gene info capsule biosynthesis protein, putative [Pelobacter propionicus DSM 2379] gb|ABK98246.1| Gene info capsule biosynthesis protein, putative [Pelobacter propionicus DSM 2379] Length=340 Score = 153 bits (386), Expect = 2e-35, Method: Composition-based stats. Identities = 90/279 (32%), Positives = 139/279 (49%), Gaps = 8/279 (2%) Query 58 EKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQ 117 +++ + VGDIM+ + G D +F ++ L D N E P+ + + Sbjct 24 QEIVVNAVGDIMLAGRWTADLRAAGYDPLFDNLRDELARGDINLANLESPLA---RCGRE 80 Query 118 KADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGE 177 K + A++ AGF ++ LANNH D+G +T K+A + ++GAGE Sbjct 81 FTTKKFRFRGEPAVAPALRRAGFNLVTLANNHSMDFGWPALAETRGHLKDAGIAWIGAGE 140 Query 178 NFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKK 237 N + + + V G RVA LG++ A +PG+ ++ ++ A+ Sbjct 141 NLEQARRMALFTVRGKRVAFLGYSLTQPLEFFAAPRRPGTAPGYAKLVAADVAAAR---- 196 Query 238 GNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFY 297 G AD V+V+ HWG E Q A +DAGAD+I+GHHPHVLQ + Y++GIIFY Sbjct 197 GKADYVIVSFHWGREASTTVQAYQRDTAHRAIDAGADVIIGHHPHVLQGVERYRRGIIFY 256 Query 298 SLGNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNI 336 SLGNF F T SALV+ L D +++PL++ Sbjct 257 SLGNFAFASTSTIADVSALVRLRL-DGRQRQAELLPLDV 294 >ref|YP_001036934.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like protein [Clostridium thermocellum ATCC 27405] gb|ABN51741.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like protein [Clostridium thermocellum ATCC 27405] Length=411 Score = 146 bits (369), Expect = 2e-33, Method: Composition-based stats. Identities = 94/302 (31%), Positives = 148/302 (49%), Gaps = 23/302 (7%) Query 49 VAPVKHRENEKLTMTMVGDIMMGRHVKEIVNRYGTD--YVFRHVSPYLKNSDYVSGNFEH 106 V P E E L + VGDI++GR V + D Y F V L+ D V GN E Sbjct 70 VQPTATPEKE-LKIVAVGDILLGRGVGMRLKNGNKDFTYPFLEVRDILRKGDVVFGNLEE 128 Query 107 PVLLEDKK--NYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKA 164 P+ ++ K + L E ++ +K AGF ++NLANNH+ DY +G DT+ Sbjct 129 PITSSTHSLTGIKEGGKYV-LKNDVEAIEGIKYAGFNLMNLANNHILDYYERGLFDTMDI 187 Query 165 FKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTD------------AFVAGAIATK 212 + + Y GAG N ++ + V ++V L +TD F AG + Sbjct 188 LDKNGIKYAGAGRNLEEARKPAIMEVKSMKVGMLAYTDMAEIVYKGNPNYKFAAG----E 243 Query 213 EQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAG 272 ++PG ++ P I K + + D+++V+ HWG E + P Q A +++D G Sbjct 244 DKPG-VAPRPLKFDDSIKKDIEELRSKVDILIVSLHWGVEESFEVLPEQREFAHSLIDNG 302 Query 273 ADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWTRTKDSALVQYHLRDNGTAILDVV 332 D+I+GHHPH Q ++YK +FYSLGNF+FDQ ++S +V + + ++ V Sbjct 303 VDVILGHHPHQFQGIEIYKGKPVFYSLGNFIFDQNDPENQESFIVTLDYKGSRLTGIEAV 362 Query 333 PL 334 P+ Sbjct 363 PV 364 >ref|ZP_01620324.1| hypothetical protein L8106_16464 [Lyngbya sp. PCC 8106] gb|EAW37608.1| hypothetical protein L8106_16464 [Lyngbya sp. PCC 8106] Length=658 Score = 145 bits (367), Expect = 3e-33, Method: Composition-based stats. Identities = 96/325 (29%), Positives = 161/325 (49%), Gaps = 24/325 (7%) Query 21 KNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKLTMTMVGDIMMGRHVKEIVNR 80 K P V L ++ V VQ+T P + +T+ GD+ + H + +V Sbjct 174 KRPEQVQAALEVVPV-------VQQTTIQKP----HDPTVTLMFGGDVTLSDHFETVVGD 222 Query 81 YGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGF 140 T + F + Y + D N E+P+ + ++ +K + A E V+ + G Sbjct 223 DHT-WAFEKLDEY-REVDVAMVNLENPL---TRSTLRRPNKQFNFKADPEAVQVLTSGGV 277 Query 141 TVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGF 200 ++NLANNH DY A+G +T++ + + + +GAG + K+ + V G R+A G+ Sbjct 278 DLVNLANNHAMDYEAEGLIETLETLENSGIHAIGAGRDLKEARRPEILEVKGQRIAYFGY 337 Query 201 TDA-FVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSP 259 DA F A A ++ PG+ + + I +D D ++VN HWG E N P Sbjct 338 YDADFHA---AGEDSPGTNPRYDERVAADIQAVRD----QVDWIIVNYHWGVELANYPGD 390 Query 260 RQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWTRTKDSALVQY 319 Q LA+ +D GAD++VGHHPHVLQ ++YK I YSLGNF+F D+A+++ Sbjct 391 WQIELARFTIDQGADLVVGHHPHVLQGAEIYKGRPIVYSLGNFIFGGNSRNDYDTAVLKV 450 Query 320 HLRDNGTAILDVVPLNIQEGSPKPV 344 L+ + ++ +P+ +++ K V Sbjct 451 SLKADQKMKVEFLPVEVRQYQAKIV 475 >ref|YP_633062.1| Gene info putative polyglutamate synthase CapA [Myxococcus xanthus DK 1622] gb|ABF89868.1| Gene info putative polyglutamate synthase CapA [Myxococcus xanthus DK 1622] Length=405 Score = 144 bits (364), Expect = 8e-33, Method: Composition-based stats. Identities = 95/275 (34%), Positives = 131/275 (47%), Gaps = 18/275 (6%) Query 85 YVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLN 144 Y F+ V P +D N E P + +K KN + AK E V + G V++ Sbjct 94 YGFQEVKPLTDAADLFVVNLECPF----TERGEKLPKNFNFRAKPELVGILTAGGVDVVS 149 Query 145 LANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGF---- 200 LANNH+ DYGA+G DT+ A + Y GAG N + + V G RVA LG+ Sbjct 150 LANNHLMDYGAQGLLDTLDTLDAAHIPYFGAGRNLAEARRPAIVTVGGQRVALLGYFFLG 209 Query 201 -TDAFVAGAIATKEQPGSLSMNPD--VLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKP 257 + G AT+ PG D V+ + + + + AD+V+ HWG E P Sbjct 210 TRNIEPPGVYATETTPGVAGHFSDEAVMEQMLREDIAAARAQADIVLPYFHWGREGTYTP 269 Query 258 SPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWT-RTKDSAL 316 P Q LA +DAGA ++G HPHVLQ+ ++Y+ + YSLGNFVF W R K AL Sbjct 270 EPYQVRLAHVAIDAGAAGVLGAHPHVLQAMELYQGRPVVYSLGNFVFGGNWNPRDKRGAL 329 Query 317 VQYHL-RDNGTAILDVVPLNIQE-----GSPKPVT 345 + H D G +++PL P PVT Sbjct 330 WKGHFGPDGGYLSSEILPLRTDRFPELPFQPVPVT 364 >gb|AAK64444.1|AF377339_5 polyglutamate synthase CapA [Myxococcus xanthus] Length=405 Score = 144 bits (364), Expect = 8e-33, Method: Composition-based stats. Identities = 95/275 (34%), Positives = 131/275 (47%), Gaps = 18/275 (6%) Query 85 YVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLN 144 Y F+ V P +D N E P + +K KN + AK E V + G V++ Sbjct 94 YGFQEVKPLTDAADLFVVNLECPF----TERGEKLPKNFNFRAKPELVGILTAGGVDVVS 149 Query 145 LANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGF---- 200 LANNH+ DYGA+G DT+ A + Y GAG N + + V G RVA LG+ Sbjct 150 LANNHLMDYGAQGLLDTLDTLDAAHIPYFGAGRNLAEARRPAIVTVGGQRVALLGYFFLG 209 Query 201 -TDAFVAGAIATKEQPGSLSMNPD--VLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKP 257 + G AT+ PG D V+ + + + + AD+V+ HWG E P Sbjct 210 TRNIEPPGVYATETTPGVAGHFSDEAVMEQMLREDIAAARAQADIVLPYFHWGREGTYTP 269 Query 258 SPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWT-RTKDSAL 316 P Q LA +DAGA ++G HPHVLQ+ ++Y+ + YSLGNFVF W R K AL Sbjct 270 EPYQVRLAHVAIDAGAAGVLGAHPHVLQAMELYQGRPVVYSLGNFVFGGNWNPRDKRGAL 329 Query 317 VQYHL-RDNGTAILDVVPLNIQE-----GSPKPVT 345 + H D G +++PL P PVT Sbjct 330 WKGHFGPDGGYLSSEILPLRTDRFPELPFQPVPVT 364 >ref|YP_447952.1| Gene info putative poly-gamma-glutamate biosynthesis protein [Methanosphaera stadtmanae DSM 3091] gb|ABC57309.1| Gene info putative poly-gamma-glutamate biosynthesis protein [Methanosphaera stadtmanae DSM 3091] Length=404 Score = 144 bits (363), Expect = 1e-32, Method: Composition-based stats. Identities = 109/370 (29%), Positives = 179/370 (48%), Gaps = 21/370 (5%) Query 19 KKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKLTMTMVGDIMMGRHVKEIV 78 KK+ V + L L ++++ + K+ + L++T+ GD+M GR + ++ Sbjct 28 KKRLIILVVLFLILCGLLMVHNPFTSNNSLNIGSKNVDKGNLSITVTGDVMFGRKMPSVL 87 Query 79 NRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEA 138 + + Y R+VS SD + N E+P + N K D + L A E V V Sbjct 88 SSGESPY--RYVSNITGQSDILLVNTENP--FTNSGNALKPD--VPLKADPEYVSLVNGT 141 Query 139 GFTVLNL-ANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVAT 197 +TV++ ANNH+ DYG +G +D+IK A + ++GAGEN ++ NG +V Sbjct 142 NYTVVSANANNHVFDYGIEGMRDSIKNLNNAGIIHIGAGENKQEATQPAVIEKNGHKVTI 201 Query 198 LGFTDA-------FVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWG 250 + D+ +A PG + + KQIS AK+ +D ++V H+G Sbjct 202 FNYMDSDNFKEYSSDVMPVAGDSSPGYSAWDDVESAKQISAAKE---NGSDFIIVYMHYG 258 Query 251 EEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWTR 310 EY P+ QE ++ +DAGAD +VG H HV + ++Y IFY+LGNF+FDQ T Sbjct 259 NEYSRSPNQMQEKISHKAIDAGADTVVGSHTHVTEGIEMYNGKPIFYNLGNFIFDQSNTA 318 Query 311 TKDSALVQYHLR-DNGTAILDVVPLNIQEGSPKPVTSALDKNRVYRQLTKDTSKGALWSK 369 T + V + + DN T++ V P++I P ++S+ D + QL + + Sbjct 319 THRAYFVNFQITGDNVTSV--VYPVDINGYLPHFMSSS-DGRSLLEQLNPQCPQMKITDD 375 Query 370 KDDKLEIKLN 379 +L LN Sbjct 376 GTGELSFSLN 385 >ref|ZP_00236620.1| capA protein, putative [Bacillus cereus G9241] gb|EAL15896.1| capA protein, putative [Bacillus cereus G9241] Length=367 Score = 142 bits (358), Expect = 3e-32, Method: Composition-based stats. Identities = 86/253 (33%), Positives = 129/253 (50%), Gaps = 7/253 (2%) Query 53 KHRENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLED 112 K EN ++T+T GD M ++ ++ + G DY F+HV +K +D N E + Sbjct 49 KKIENPEITLTFSGDTMFDWQLRPVIEKNGADYPFQHVKEEIKKADISFVNLESAFTTRE 108 Query 113 KKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDY 172 KK + + + T++A+K G+ ++N+ NNH DYG +G DTI ++ Y Sbjct 109 KK---APGQLFWIKSDPSTLQAIKNTGYDIVNIGNNHTLDYGQEGLLDTISHVEKLKFPY 165 Query 173 VGAGENFKDVKNIVYQNVNGVRVATLGFTDAFV-AGAIATKEQPGSLSMNPDVLLKQISK 231 +GAG+N KD V G + L F +A +PG + L ++K Sbjct 166 IGAGKNAKDAYTAREMTVKGKKFKFLSFVRFMPDTNWVAGDNKPGVAN---GYDLNLVTK 222 Query 232 AKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYK 291 +K +AD ++V HWG E N+P Q+ MV+AGAD IVG HPH LQ F+ Y Sbjct 223 TIKEQKKDADYLIVYMHWGVEKSNRPVEYQKQYVPKMVEAGADAIVGSHPHWLQGFEYYN 282 Query 292 QGIIFYSLGNFVF 304 + I YSLGNF+F Sbjct 283 KVPIAYSLGNFLF 295 >ref|NP_831556.1| Gene info Capsule biosynthesis protein capA [Bacillus cereus ATCC 14579] gb|AAP08757.1| Gene info Capsule biosynthesis protein capA [Bacillus cereus ATCC 14579] Length=367 Score = 140 bits (354), Expect = 1e-31, Method: Composition-based stats. Identities = 85/253 (33%), Positives = 132/253 (52%), Gaps = 7/253 (2%) Query 53 KHRENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLED 112 K E++++T+T GD M ++ I+ + G DY F+HV +K +D N E ++ Sbjct 49 KKIEDQEITLTFSGDTMFDWQLRPIIEKNGADYPFQHVKEEIKKADISFVNLESAFTTKE 108 Query 113 KKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDY 172 KK + + + T++A+K G+ ++N+ NNH DYG G DTI ++ Y Sbjct 109 KK---APGQLFWIKSDPSTLQAIKNTGYDIVNIGNNHTLDYGQDGLLDTISHVEKLKFPY 165 Query 173 VGAGENFKDVKNIVYQNVNGVRVATLGFTDAFV-AGAIATKEQPGSLSMNPDVLLKQISK 231 +GAG+N KD V G + L F + +A + +PG + L ++K Sbjct 166 IGAGKNAKDAYTAREMTVKGKKFKFLSFVRFMPDSNWVAGENKPGVAN---GYDLNLVTK 222 Query 232 AKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYK 291 +K +AD ++V HWG E N+P Q+ MV+AGA+ IVG HPH LQ F+ Y Sbjct 223 TIKEQKKDADYLIVYMHWGVEKSNRPVEYQKQYVPKMVEAGANAIVGSHPHWLQGFEYYN 282 Query 292 QGIIFYSLGNFVF 304 + I YSLGNF+F Sbjct 283 KVPIAYSLGNFLF 295 >ref|ZP_01463066.1| polyglutamate synthase CapA [Stigmatella aurantiaca DW4/3-1] gb|EAU66185.1| polyglutamate synthase CapA [Stigmatella aurantiaca DW4/3-1] Length=421 Score = 140 bits (353), Expect = 1e-31, Method: Composition-based stats. Identities = 94/305 (30%), Positives = 142/305 (46%), Gaps = 27/305 (8%) Query 60 LTMTMVGDIMMGRHVK-----EIVNRYGTDYVFRH----VSPYLKNSDYVSGNFEHPVLL 110 +T+ + GD+ +G H + ++ + +F H V + +D N E P Sbjct 83 VTLLVGGDVTVGHHHQTYFDEQVAKGRSREEMFAHGFKGVKAAAEAADLFLVNLECPF-- 140 Query 111 EDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADL 170 + +K KN + A+ E V + V++LANNHM DYG +G DT+ ++A + Sbjct 141 --TEGGEKLPKNFNFRARPEFVNTLLAGSVDVVSLANNHMMDYGPQGLLDTLATLEQARI 198 Query 171 DYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGA--------IATKEQPGSLSMNP 222 Y GAG + + V GVR A LG+ F G AT+ PG Sbjct 199 PYFGAGRTLAEARRPALVTVGGVRFAFLGY---FFLGTRNIEPPQVYATETTPGVAGHFS 255 Query 223 DVLLKQISKAKD--PKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHH 280 D+ + + +D K AD+V+ HWG E +P P Q LA+ ++AGA ++G H Sbjct 256 DIQVMEQMLREDILAAKAQADVVLPYFHWGREGTFEPEPYQIQLARVAIEAGAAGVLGSH 315 Query 281 PHVLQSFDVYKQGIIFYSLGNFVFDQGWT-RTKDSALVQYHLRDNGTAILDVVPLNIQEG 339 PHVLQ ++Y+ + YSLGNFVF W R K SAL Q G +++PL Sbjct 316 PHVLQGMELYQGAPVVYSLGNFVFGGNWNPREKRSALFQARFSPAGYLSSEIIPLRTDRY 375 Query 340 SPKPV 344 P+ Sbjct 376 PEVPI 380 >ref|NP_978256.1| Gene info hypothetical protein BCE_1940 [Bacillus cereus ATCC 10987] emb|CAB40617.1| Gene info capA [Bacillus cereus ATCC 10987] gb|AAS40864.1| Gene info conserved hypothetical protein [Bacillus cereus ATCC 10987] Length=367 Score = 140 bits (352), Expect = 2e-31, Method: Composition-based stats. Identities = 85/253 (33%), Positives = 127/253 (50%), Gaps = 7/253 (2%) Query 53 KHRENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLED 112 K EN ++T+T GD M ++ ++ + G DY F+HV + +D N E + Sbjct 49 KKIENPEITLTFSGDTMFDWQLRPVIEKNGADYPFQHVKEEITKADISFVNLESAFTTRE 108 Query 113 KKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDY 172 KK + + + T++A+K G+ ++N+ NNH DYG G DTI ++ Y Sbjct 109 KK---APGQLFWIKSDPSTLQAIKNTGYDIVNIGNNHTLDYGQDGLLDTISHVEKLKFPY 165 Query 173 VGAGENFKDVKNIVYQNVNGVRVATLGFTDAFV-AGAIATKEQPGSLSMNPDVLLKQISK 231 +GAG+N KD V G + L F +A +PG + L ++K Sbjct 166 IGAGKNAKDAYTAREMTVKGKKFKFLSFVRFMPDTNWVAGDNKPGVAN---GYDLNLVTK 222 Query 232 AKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYK 291 +K +AD ++V HWG E N+P Q+ MV+AGAD IVG HPH LQ F+ Y Sbjct 223 TIKEQKKDADYLIVYMHWGVEKSNRPVEYQKQYVPKMVEAGADAIVGSHPHWLQGFEYYN 282 Query 292 QGIIFYSLGNFVF 304 + I YSLGNF+F Sbjct 283 KVPIAYSLGNFLF 295 >ref|ZP_00742485.1| Capsule biosynthesis protein capA [Bacillus thuringiensis serovar israelensis ATCC 35646] gb|EAO53244.1| Capsule biosynthesis protein capA [Bacillus thuringiensis serovar israelensis ATCC 35646] Length=367 Score = 138 bits (348), Expect = 6e-31, Method: Composition-based stats. Identities = 85/253 (33%), Positives = 129/253 (50%), Gaps = 7/253 (2%) Query 53 KHRENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLED 112 K E+ ++T+T GD M ++ ++ + G DY F+HV + +D N E + Sbjct 49 KKIEDPEITLTFSGDTMFDWQLRPVIEKNGADYPFQHVKEEITKADISFVNLESAFTTRE 108 Query 113 KKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDY 172 KK + + + T++A+K G+ ++N+ NNH DYG G DTI ++ Y Sbjct 109 KK---APGQLFWIKSDPSTLQAIKNTGYDIVNIGNNHTLDYGQDGLLDTISHVEKLKFPY 165 Query 173 VGAGENFKDVKNIVYQNVNGVRVATLGFTDAFV-AGAIATKEQPGSLSMNPDVLLKQISK 231 +GAG+N KD V G + L F +A +PG ++ D L ++K Sbjct 166 IGAGKNAKDAYTAREMTVKGKKFKFLSFVRFMPDTNWVAGNNKPG-VANGYD--LNLVTK 222 Query 232 AKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYK 291 +K +AD ++V HWG E N+P Q+ MV+AGAD IVG HPH LQ F+ Y Sbjct 223 TIKEQKQDADYLIVYMHWGVEKSNRPVEYQKQYVPKMVEAGADAIVGSHPHWLQGFEYYN 282 Query 292 QGIIFYSLGNFVF 304 + I YSLGNF+F Sbjct 283 KVPIAYSLGNFLF 295 >ref|YP_036028.1| Gene info conserved hypothetical protein, possible capsule biosynthesis protein [Bacillus thuringiensis serovar konkukian str. 97-27] gb|AAT62747.1| Gene info conserved hypothetical protein, possible capsule biosynthesis protein [Bacillus thuringiensis serovar konkukian str. 97-27] Length=367 Score = 137 bits (346), Expect = 9e-31, Method: Composition-based stats. Identities = 84/253 (33%), Positives = 127/253 (50%), Gaps = 7/253 (2%) Query 53 KHRENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLED 112 K E+ ++T+T GD M ++ ++ + G DY F+HV + +D N E + Sbjct 49 KKIEDPEITLTFSGDTMFDWQLRPVIEKNGADYPFQHVKEEITKADISFVNLESAFTTRE 108 Query 113 KKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDY 172 KK + + + T++A+K G+ ++N+ NNH DYG +G DTI ++ Y Sbjct 109 KK---APGQLFWIKSDPSTLQAIKNTGYDIVNIGNNHTLDYGQEGLLDTISHVEKLKFPY 165 Query 173 VGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGA-IATKEQPGSLSMNPDVLLKQISK 231 +GAG+N KD V G + L F +A +PG + L ++K Sbjct 166 IGAGKNEKDAYTAREMTVKGKKFKFLSFVRFMPDFTWVADDNKPGVAN---GYDLNLVTK 222 Query 232 AKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYK 291 +K +AD ++V HWG E N+P Q+ MV+AGAD IVG HPH LQ F+ Y Sbjct 223 TIKEQKKDADYLIVYMHWGVEKSNRPVEYQKQYVNKMVEAGADAIVGSHPHWLQGFEYYN 282 Query 292 QGIIFYSLGNFVF 304 I YSLGNF+F Sbjct 283 NVPIAYSLGNFLF 295 >ref|ZP_01183700.1| capsule biosynthesis protein capA [Bacillus weihenstephanensis KBAB4] gb|EAR76867.1| capsule biosynthesis protein capA [Bacillus weihenstephanensis KBAB4] Length=367 Score = 137 bits (344), Expect = 1e-30, Method: Composition-based stats. Identities = 85/254 (33%), Positives = 130/254 (51%), Gaps = 9/254 (3%) Query 53 KHRENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLED 112 K E+ ++T+T GD M ++ ++ + G DY F+HV + +D N E + Sbjct 49 KKTEDPEITLTFSGDTMFDWQLRPVIEKNGADYPFQHVKEEITKADISFVNLESAFTTRE 108 Query 113 KKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDY 172 K+ + + + T++A+K G+ ++N+ NNH DYG G DTI ++ L Y Sbjct 109 KR---VPGQQFWIKSDPSTLQAIKNTGYDIVNIGNNHTLDYGQDGLLDTISHVEKLKLPY 165 Query 173 VGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVA-GAIATKEQPGSLS-MNPDVLLKQIS 230 GAG+N +D V G + L F +A +PG + + D++ K I Sbjct 166 TGAGKNAEDAYTARELTVKGKKFKFLSFVRFMPNFNWVAGDNKPGVANGYDLDLVTKTIQ 225 Query 231 KAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVY 290 + +K +AD V+V HWG E N+P Q+ MV+AGAD IVG HPH LQ F+ Y Sbjct 226 E----QKKDADYVIVYMHWGVEKSNRPIEYQKQYVPKMVEAGADAIVGSHPHWLQGFEYY 281 Query 291 KQGIIFYSLGNFVF 304 + I YSLGNF+F Sbjct 282 NKVPIAYSLGNFLF 295 >ref|YP_083266.1| Gene info conserved hypothetical protein; possible capsule biosynthesis protein [Bacillus cereus E33L] gb|AAU18582.1| Gene info conserved hypothetical protein; possible capsule biosynthesis protein [Bacillus cereus E33L] Length=367 Score = 137 bits (344), Expect = 2e-30, Method: Composition-based stats. Identities = 84/253 (33%), Positives = 126/253 (49%), Gaps = 7/253 (2%) Query 53 KHRENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLED 112 K E+ ++T+T GD M ++ ++ + G DY F+HV + +D N E ++ Sbjct 49 KKIEDPEITLTFSGDTMFDWQLRPVIEKNGADYPFQHVKEEITKADISFVNLESAFTTKE 108 Query 113 KKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDY 172 KK + + + T++A+K G+ ++N+ NNH DYG G DTI ++ Y Sbjct 109 KK---APGQLFWIKSDPSTLQAIKNTGYDIVNIGNNHTLDYGQNGLLDTISHVEKLKFPY 165 Query 173 VGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGA-IATKEQPGSLSMNPDVLLKQISK 231 +GAG+N KD V G + L F +A +PG + L ++K Sbjct 166 IGAGKNAKDAYTAREMTVKGKKFKFLSFVRFMPDFTWVADDNKPGVAN---GYDLNLVTK 222 Query 232 AKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYK 291 +K +AD ++V HWG E N+P Q+ MV AGAD IVG HPH LQ F+ Y Sbjct 223 TIKEQKKDADYLIVYMHWGVEKSNRPVDYQKQYVNKMVTAGADAIVGSHPHWLQGFEYYN 282 Query 292 QGIIFYSLGNFVF 304 I YSLGNF+F Sbjct 283 NVPIAYSLGNFLF 295 >ref|YP_894465.1| Gene info possible capsule biosynthesis protein [Bacillus thuringiensis str. Al Hakam] gb|ABK84958.1| Gene info conserved hypothetical protein [Bacillus thuringiensis str. Al Hakam] Length=367 Score = 136 bits (343), Expect = 2e-30, Method: Composition-based stats. Identities = 83/253 (32%), Positives = 128/253 (50%), Gaps = 7/253 (2%) Query 53 KHRENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLED 112 K E+ ++T+T GD M ++ ++ + G DY F++V + +D N E ++ Sbjct 49 KKIEDPEITLTFSGDTMFDWQLRPVIEKNGADYPFQYVKEEITKADISFVNLESAFTTKE 108 Query 113 KKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDY 172 KK + + + T+KA+K G+ ++N+ NNH DYG +G DTI ++ Y Sbjct 109 KK---APGQLFWIKSDPSTLKAIKNTGYDIVNIGNNHTLDYGQEGLLDTISHVEKLKFPY 165 Query 173 VGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGA-IATKEQPGSLSMNPDVLLKQISK 231 +GAG+N KD V G + L F +A +PG + L ++K Sbjct 166 IGAGKNEKDAYTAREMTVKGKKFKFLSFVRFMPDFTWVADDNKPGVAN---GYDLNLVTK 222 Query 232 AKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYK 291 +K +AD +++ HWG E N+P Q+ A MV AGAD I+G HPH LQ F+ Y Sbjct 223 TIKEQKKDADYLIIYMHWGVEKSNRPVEYQKQYASKMVTAGADAIIGSHPHWLQGFEYYN 282 Query 292 QGIIFYSLGNFVF 304 I YSLGNF+F Sbjct 283 NVPIAYSLGNFLF 295 >ref|NP_844272.1| Gene info hypothetical protein BA1855 [Bacillus anthracis str. Ames] ref|YP_018495.1| Gene info hypothetical protein GBAA1855 [Bacillus anthracis str. 'Ames Ancestor'] ref|YP_027984.1| Gene info hypothetical protein BAS1719 [Bacillus anthracis str. Sterne] gb|AAP25758.1| Gene info conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAT30970.1| Gene info conserved hypothetical protein [Bacillus anthracis str. 'Ames Ancestor'] gb|AAT54035.1| Gene info conserved hypothetical protein [Bacillus anthracis str. Sterne] Length=367 Score = 136 bits (342), Expect = 2e-30, Method: Composition-based stats. Identities = 83/253 (32%), Positives = 126/253 (49%), Gaps = 7/253 (2%) Query 53 KHRENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLED 112 K E+ ++T+T GD M ++ ++ + G DY F+HV + +D N E ++ Sbjct 49 KKIEDPEITLTFSGDTMFDWQLRPVIEKNGADYPFQHVKEEITKADISFVNLESAFTTKE 108 Query 113 KKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDY 172 KK + + + T++A+K G+ ++N+ NNH DYG G DTI ++ Y Sbjct 109 KK---APGQLFWIKSDPSTLQAIKNTGYDIVNIGNNHTLDYGQNGLLDTISHVEKLKFPY 165 Query 173 VGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGA-IATKEQPGSLSMNPDVLLKQISK 231 +GAG+N KD V G + L F +A +PG + L ++K Sbjct 166 IGAGKNAKDAYTAREMTVKGKKFKFLSFVRFMPDFTWVADDNKPGVAN---GYDLNLVTK 222 Query 232 AKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYK 291 +K +AD ++V HWG E N+P Q+ MV AGAD IVG HPH LQ F+ Y Sbjct 223 TIKEQKKDADYLIVYMHWGVEKSNRPVDYQKQYVNKMVTAGADAIVGSHPHWLQGFEYYN 282 Query 292 QGIIFYSLGNFVF 304 + YSLGNF+F Sbjct 283 NVPVAYSLGNFLF 295 >ref|YP_001048222.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like protein [Methanoculleus marisnigri JR1] gb|ABN58240.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like protein [Methanoculleus marisnigri JR1] Length=369 Score = 131 bits (329), Expect = 7e-29, Method: Composition-based stats. Identities = 97/343 (28%), Positives = 172/343 (50%), Gaps = 31/343 (9%) Query 58 EKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQ 117 ++L + VGDI V Y F V L+ D + GN E L D + Sbjct 2 QELRLIAVGDIW--------VRTANYQYPFGEVGHLLEGKDVLFGNLE--TTLSDTG--E 49 Query 118 KADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGE 177 A+K+ + ++ + +KEAGF V+++ANNH D GA+G K+T+ A + + +G G Sbjct 50 PAEKHHVIFTCPDSARHLKEAGFDVMSVANNHSGDLGAEGFKNTLNALESRGILAIG-GS 108 Query 178 NFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKK 237 +D + V NG+ + G+T G +A + LS+N ++ + + K + K Sbjct 109 ATEDRQEPVILEKNGISIGFAGYT----IGKLAISRE---LSVN-RLVEEDVLKDIESLK 160 Query 238 GNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFY 297 G D + V+ HWG E PSP Q LA ++DAGA +I+GHHPH +Q+ + Y G+I Y Sbjct 161 GRCDHIAVSLHWGTEMAYYPSPEQIDLAHRLIDAGATLILGHHPHTMQAIERYHGGLIAY 220 Query 298 SLGNFVFDQGWTR--TKDSALVQYHLRDNG-TAILDVVPLNIQEG-SPKPVTSALDK--N 351 SLG F F+ W ++++ ++ L+ NG + PL I + P+P + + Sbjct 221 SLGMFQFEPRWPHNISREAIMLSVDLQKNGVVGAHETAPLIIDDDFIPRPAEGPMAEEIQ 280 Query 352 RVYRQLTKDTSKGAL----WSKKDDKLEIKLNHKHVIEKMKKR 390 ++++ ++G L W ++ + +K+N + +++++ Sbjct 281 NFLSEISRPVAEGRLTRSRWFEEIAPVYMKMNLESYRYRIRRK 323 >ref|YP_293341.1| Gene info putative poly-gamma-glutamate biosynthesis enzyme [Ralstonia eutropha JMP134] gb|AAZ65484.1| Gene info putative poly-gamma-glutamate biosynthesis enzyme [Ralstonia eutropha JMP134] Length=337 Score = 131 bits (329), Expect = 8e-29, Method: Composition-based stats. Identities = 101/324 (31%), Positives = 153/324 (47%), Gaps = 28/324 (8%) Query 33 IAVILIAA--------TWVQRTEAVAPVKHRENEKLTMTMVGDIMMGRHVKEIVNRYGTD 84 IA IL AA V +A AP+ +++ VGDIM+ +++ + G D Sbjct 10 IARILFAAFLCIGVLDEGVAGEKAAAPI-------VSLAFVGDIMLDGIPGDVI-KAGRD 61 Query 85 YVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLN 144 F H + L +D GN E V + K A TV+ +K FT L+ Sbjct 62 -PFMHFARILDAADIRIGNLECVV----ASGGRPERKPFTFRADPRTVQVLK-GHFTALS 115 Query 145 LANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAF 204 +ANNH D+G + + ++ + G G N + NG+R+A LG+ + F Sbjct 116 IANNHTGDFGRAAFSEMLDLLAAHEVSFFGGGRNMVAAHTPLLIQRNGLRIALLGYNEIF 175 Query 205 VAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEAL 264 A + PG + ++ I A+ +ADLV+ HWG E+++ S RQ L Sbjct 176 PRSFEADGDTPGLAWSEDEQVIADIENARSVH--HADLVIPFMHWGIEHEHHASARQRRL 233 Query 265 AKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWTRTKDSA--LVQYHLR 322 A AM+DAGA+ ++G HPHV Q + YK IFYSLGNFVFD G+ ++ L++ Sbjct 234 AHAMIDAGANAVIGGHPHVTQDIEQYKGRPIFYSLGNFVFD-GFKDADNTTGWLLRLEAS 292 Query 323 DNGTAILDV-VPLNIQEGSPKPVT 345 NG + + EG P+PV+ Sbjct 293 RNGVRGWQLYLTRTDSEGIPRPVS 316 >ref|YP_284418.1| Gene info putative poly-gamma-glutamate biosynthesis enzyme [Dechloromonas aromatica RCB] gb|AAZ45948.1| Gene info putative poly-gamma-glutamate biosynthesis enzyme [Dechloromonas aromatica RCB] Length=314 Score = 130 bits (327), Expect = 1e-28, Method: Composition-based stats. Identities = 96/305 (31%), Positives = 144/305 (47%), Gaps = 39/305 (12%) Query 60 LTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPY---LKNSDYVSGNFEHPVLLEDKKNY 116 LT+ GDIM+ + + G ++P+ L +DY GN E PV + + + Sbjct 16 LTLIFAGDIMLDDGPGQTIAAGGDP-----LAPFAALLSAADYRIGNLECPVAVGGQPH- 69 Query 117 QKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAG 176 A K AK T+ ++ F ++LANNH DYG +T++ + Y G G Sbjct 70 --ARKVAIFRAKPNTLDVLR-GRFDAVSLANNHSGDYGHAAFLETMQHLDAQGIAYFGGG 126 Query 177 ENFKDVKNIVYQNVNGVRVATLGFTD----AFVAGAIATKEQPGSLSMNPDVLLKQISKA 232 +N ++ NG+ +A LG+ + +F AGA PG + ++ I A Sbjct 127 KNLTAAHKPLWIEKNGLSIAVLGYNEFKPRSFEAGA----HWPGVAWSEDEHVIADIGAA 182 Query 233 KDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQ 292 K ADLV+ HWG E +++P RQ LA+ M+DAGA ++VG HPHV Q ++Y Sbjct 183 K---AAGADLVIPFMHWGWEKESRPDERQRTLARKMIDAGAALVVGGHPHVTQGAEIYNG 239 Query 293 GIIFYSLGNFVFD--------QGWTRTKDSALVQYHLRDNGTAILDVVPLNIQE-GSPKP 343 I YSLGNFVFD +GW L++ L G D + + + G+P Sbjct 240 KPIVYSLGNFVFDGFDYPGAQRGW-------LLRLKLDKTGVLEWDTLAAQMDDNGTPHL 292 Query 344 VTSAL 348 V AL Sbjct 293 VPGAL 297 >ref|YP_012632.1| Gene info hypothetical protein LMOf2365_0020 [Listeria monocytogenes str. 4b F2365] gb|AAT02809.1| Gene info conserved hypothetical protein [Listeria monocytogenes str. 4b F2365] Length=372 Score = 129 bits (324), Expect = 3e-28, Method: Composition-based stats. Identities = 86/248 (34%), Positives = 127/248 (51%), Gaps = 7/248 (2%) Query 60 LTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKK-NYQK 118 + GDIM ++ ++ G DY F +V LK+SDY + E + KK YQ+ Sbjct 59 FNIDFTGDIMFDWDLRPVLAEKGMDYPFNNVREELKSSDYTFVDLETAITTRTKKVPYQE 118 Query 119 ADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGEN 178 + + ++ A+K AG ++N++NNH+ DY G DT A + +L YVGAG+N Sbjct 119 ----FWIKSDPSSLTALKNAGVDMVNISNNHILDYYEDGLLDTTAALRANNLAYVGAGKN 174 Query 179 FKDVKNIVYQNVNGVRVATLGFTDAFV-AGAIATKEQPGSLSMNPDVLLKQISKAKDPKK 237 + + ++ G +V + F F G IA ++ PG + L+++ K + K Sbjct 175 EDEAYQLKVADIKGNKVGFMSFCHFFPNTGWIADEDTPGVTNGYDINLVEEKIKEERAKN 234 Query 238 GNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAG-ADIIVGHHPHVLQSFDVYKQGIIF 296 + D +VV HWG E N P Q K +VD D IV HPH LQSF+VYK I Sbjct 235 KDIDYMVVYFHWGVEKTNTPVDYQTQYVKKLVDDHLVDAIVASHPHWLQSFEVYKDVPIA 294 Query 297 YSLGNFVF 304 YSLGNF+F Sbjct 295 YSLGNFLF 302 >gb|EBA22002.1| hypothetical protein LMRG_02446 [Listeria monocytogenes 10403S] Length=372 Score = 129 bits (324), Expect = 3e-28, Method: Composition-based stats. Identities = 85/248 (34%), Positives = 126/248 (50%), Gaps = 7/248 (2%) Query 60 LTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKK-NYQK 118 + GDIM ++ ++ G DY F +V LK+SDY + E + KK YQ+ Sbjct 59 FNIDFTGDIMFDWDLRPVLAEKGMDYPFNNVREELKSSDYTFVDLETAITTRTKKVPYQE 118 Query 119 ADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGEN 178 + + ++ A+K AG ++N++NNH+ DY G DT A + +L YVGAG+N Sbjct 119 ----FWIKSDPSSLTALKNAGVDMVNISNNHILDYYEDGLLDTTAALRANNLAYVGAGKN 174 Query 179 FKDVKNIVYQNVNGVRVATLGFTDAFV-AGAIATKEQPGSLSMNPDVLLKQISKAKDPKK 237 + + ++ G +V + F F G IA ++ PG + L+++ K + K Sbjct 175 EDEAYQLKVADIKGNKVGFMSFCHFFPNTGWIADEDTPGVTNGYDINLVEEKIKEERAKN 234 Query 238 GNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAG-ADIIVGHHPHVLQSFDVYKQGIIF 296 + D +VV HWG E N P Q K +VD D IV HPH LQ F+VYK I Sbjct 235 KDIDYMVVYFHWGVEKTNTPVDYQTQYVKKLVDDNLVDAIVASHPHWLQGFEVYKDVPIA 294 Query 297 YSLGNFVF 304 YSLGNF+F Sbjct 295 YSLGNFLF 302 >gb|EBA30238.1| hypothetical protein LMHG_01613 [Listeria monocytogenes FSL N1-017] Length=349 Score = 129 bits (324), Expect = 3e-28, Method: Composition-based stats. Identities = 86/248 (34%), Positives = 127/248 (51%), Gaps = 7/248 (2%) Query 60 LTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKK-NYQK 118 + GDIM ++ ++ G DY F +V LK+SDY + E + KK YQ+ Sbjct 36 FNIDFTGDIMFDWDLRPVLAEKGMDYPFNNVREELKSSDYTFVDLETAITTRTKKVPYQE 95 Query 119 ADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGEN 178 + + ++ A+K AG ++N++NNH+ DY G DT A + +L YVGAG+N Sbjct 96 ----FWIKSDPSSLTALKNAGVDMVNISNNHILDYYEDGLLDTTAALRANNLAYVGAGKN 151 Query 179 FKDVKNIVYQNVNGVRVATLGFTDAFV-AGAIATKEQPGSLSMNPDVLLKQISKAKDPKK 237 + + ++ G +V + F F G IA ++ PG + L+++ K + K Sbjct 152 EDEAYQLKVADIKGNKVGFMSFCHFFPNTGWIADEDTPGVTNGYDINLVEEKIKEERAKN 211 Query 238 GNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAG-ADIIVGHHPHVLQSFDVYKQGIIF 296 + D +VV HWG E N P Q K +VD D IV HPH LQSF+VYK I Sbjct 212 KDIDYMVVYFHWGVEKTNTPVDYQTQYVKKLVDDHLVDAIVASHPHWLQSFEVYKDVPIA 271 Query 297 YSLGNFVF 304 YSLGNF+F Sbjct 272 YSLGNFLF 279 >ref|ZP_00232690.1| conserved hypothetical protein [Listeria monocytogenes str. 1/2a F6854] gb|EAL07344.1| conserved hypothetical protein [Listeria monocytogenes str. 1/2a F6854] gb|EBA20607.1| hypothetical protein LMOG_01028 [Listeria monocytogenes J0161] Length=372 Score = 129 bits (324), Expect = 3e-28, Method: Composition-based stats. Identities = 85/248 (34%), Positives = 126/248 (50%), Gaps = 7/248 (2%) Query 60 LTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKK-NYQK 118 + GDIM ++ ++ G DY F +V LK+SDY + E + KK YQ+ Sbjct 59 FNIDFTGDIMFDWDLRPVLAEKGMDYPFNNVREELKSSDYTFVDLETAITTRTKKVPYQE 118 Query 119 ADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGEN 178 + + ++ A+K AG ++N++NNH+ DY G DT A + +L YVGAG+N Sbjct 119 ----FWIKSDPSSLTALKNAGVDMVNISNNHILDYYEDGLLDTTAALRANNLAYVGAGKN 174 Query 179 FKDVKNIVYQNVNGVRVATLGFTDAFV-AGAIATKEQPGSLSMNPDVLLKQISKAKDPKK 237 + + ++ G +V + F F G IA ++ PG + L+++ K + K Sbjct 175 EDEAYQLKVADIKGNKVGFMSFCHFFPNTGWIADEDTPGVTNGYDINLVEEKIKEERAKN 234 Query 238 GNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAG-ADIIVGHHPHVLQSFDVYKQGIIF 296 + D +VV HWG E N P Q K +VD D IV HPH LQ F+VYK I Sbjct 235 KDIDYMVVYFHWGVEKTNTPVDYQTQYVKKLVDDNLVDAIVASHPHWLQGFEVYKDVPIA 294 Query 297 YSLGNFVF 304 YSLGNF+F Sbjct 295 YSLGNFLF 302 >ref|ZP_00230811.1| conserved hypothetical protein [Listeria monocytogenes str. 4b H7858] gb|EAL09354.1| conserved hypothetical protein [Listeria monocytogenes str. 4b H7858] Length=372 Score = 129 bits (324), Expect = 3e-28, Method: Composition-based stats. Identities = 86/248 (34%), Positives = 127/248 (51%), Gaps = 7/248 (2%) Query 60 LTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKK-NYQK 118 + GDIM ++ ++ G DY F +V LK+SDY + E + KK YQ+ Sbjct 59 FNIDFTGDIMFDWDLRPVLAEKGMDYPFNNVREELKSSDYTFVDLETAITTRTKKVPYQE 118 Query 119 ADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGEN 178 + + ++ A+K AG ++N++NNH+ DY G DT A + +L YVGAG+N Sbjct 119 ----FWIKSDPSSLTALKNAGVDMVNISNNHILDYYEDGLLDTTAALRANNLAYVGAGKN 174 Query 179 FKDVKNIVYQNVNGVRVATLGFTDAFV-AGAIATKEQPGSLSMNPDVLLKQISKAKDPKK 237 + + ++ G +V + F F G IA ++ PG + L+++ K + K Sbjct 175 EDEAYQLKVADIKGNKVGFMSFCHFFPNTGWIADEDTPGVTNGYDINLVEEKIKEERAKN 234 Query 238 GNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAG-ADIIVGHHPHVLQSFDVYKQGIIF 296 + D +VV HWG E N P Q K +VD D IV HPH LQSF+VYK I Sbjct 235 KDIDYMVVYFHWGVEKTNTPVDYQTQYVKKLVDDHLVDAIVASHPHWLQSFEVYKDVPIA 294 Query 297 YSLGNFVF 304 YSLGNF+F Sbjct 295 YSLGNFLF 302 >ref|NP_463550.1| Gene info hypothetical protein lmo0017 [Listeria monocytogenes EGD-e] emb|CAC98232.1| Gene info lmo0017 [Listeria monocytogenes] Length=372 Score = 129 bits (324), Expect = 3e-28, Method: Composition-based stats. Identities = 85/248 (34%), Positives = 126/248 (50%), Gaps = 7/248 (2%) Query 60 LTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKK-NYQK 118 + GDIM ++ ++ G DY F +V LK+SDY + E + KK YQ+ Sbjct 59 FNIDFTGDIMFDWDLRPVLAEKGMDYPFNNVREELKSSDYTFVDLETAITTRTKKVPYQE 118 Query 119 ADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGEN 178 + + ++ A+K AG ++N++NNH+ DY G DT A + +L YVGAG+N Sbjct 119 ----FWIKSDPSSLTALKNAGVDMVNISNNHILDYYEDGLLDTTAALRANNLAYVGAGKN 174 Query 179 FKDVKNIVYQNVNGVRVATLGFTDAFV-AGAIATKEQPGSLSMNPDVLLKQISKAKDPKK 237 + + ++ G +V + F F G IA ++ PG + L+++ K + K Sbjct 175 EDEAYQLKVADIKGNKVGFMSFCHFFPNTGWIADEDTPGVTNGYDLNLVEEKIKEERAKN 234 Query 238 GNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAG-ADIIVGHHPHVLQSFDVYKQGIIF 296 + D +VV HWG E N P Q K +VD D IV HPH LQ F+VYK I Sbjct 235 KDIDYMVVYFHWGVEKTNTPVDYQTQYVKKLVDDNLVDAIVASHPHWLQGFEVYKDVPIA 294 Query 297 YSLGNFVF 304 YSLGNF+F Sbjct 295 YSLGNFLF 302 >ref|YP_002048.1| Gene info putative lipoprotein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] gb|AAS70685.1| Gene info putative lipoprotein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] Length=409 Score = 129 bits (323), Expect = 4e-28, Method: Composition-based stats. Identities = 72/270 (26%), Positives = 135/270 (50%), Gaps = 4/270 (1%) Query 66 GDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHL 125 GD+M +++ + ++G + P +D+ N E P++ + +KA Sbjct 81 GDVMFNWGIRDTIRKHGEIAPVEGLRPLFNEADFRMINLETPIVASKTEESKKA---YIF 137 Query 126 SAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNI 185 +A E+ + ++K G ++ L NNH D+G +G +T+ + ++ +VGAG+ +V Sbjct 138 TAHEKDLNSLKYLGVDMVFLGNNHSFDHGQQGMNETLDILNKNNILFVGAGKKLPEVLEP 197 Query 186 VYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLS-MNPDVLLKQISKAKDPKKGNADLVV 244 + N+ G + T AT + G + P + K PK + + + Sbjct 198 LNLNLKGSDLRIHSVTAIAEQTHYATATRSGVAPFLFPSLRATFFEKNILPKNHSTPVRI 257 Query 245 VNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVF 304 V+ HWG EY P+ Q +A++++D+G I++GHHPH+ Q +VYK G+I YSLGN +F Sbjct 258 VSLHWGVEYSPFPTSDQRKIARSLIDSGVKIVIGHHPHIPQGVEVYKGGVILYSLGNLIF 317 Query 305 DQGWTRTKDSALVQYHLRDNGTAILDVVPL 334 + + + H+R+N +++VP+ Sbjct 318 GSRNSYLNHNLIAILHIRNNHLERVELVPI 347 >ref|NP_711855.1| Gene info Capsule biosynthesis protein capA [Leptospira interrogans serovar Lai str. 56601] gb|AAN48873.1|AE011345_7 Gene info Capsule biosynthesis protein capA [Leptospira interrogans serovar Lai str. 56601] Length=409 Score = 129 bits (323), Expect = 5e-28, Method: Composition-based stats. Identities = 72/270 (26%), Positives = 135/270 (50%), Gaps = 4/270 (1%) Query 66 GDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHL 125 GD+M +++ + ++G + P +D+ N E P++ + +KA Sbjct 81 GDVMFNWGIRDTIRKHGEIAPVEGLRPLFNEADFRMINLETPIVASKTEESKKA---YIF 137 Query 126 SAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNI 185 +A E+ + ++K G ++ L NNH D+G +G +T+ + ++ +VGAG+ +V Sbjct 138 TAHEKDLNSLKYLGVDMVFLGNNHSFDHGQQGMNETLDILNKNNILFVGAGKKLPEVLEP 197 Query 186 VYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLS-MNPDVLLKQISKAKDPKKGNADLVV 244 + N+ G + T AT + G + P + K PK + + + Sbjct 198 LNLNLKGSDLRIHSVTAIAEQTHYATATRSGVAPFLFPSLRATFFEKNILPKDHSTPVRI 257 Query 245 VNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVF 304 V+ HWG EY P+ Q +A++++D+G I++GHHPH+ Q +VYK G+I YSLGN +F Sbjct 258 VSLHWGVEYSPFPTSDQRKIARSLIDSGVKIVIGHHPHIPQGVEVYKGGVILYSLGNLIF 317 Query 305 DQGWTRTKDSALVQYHLRDNGTAILDVVPL 334 + + + H+R+N +++VP+ Sbjct 318 GSRNSYLNHNLIAILHIRNNHLERVELVPI 347 >gb|EBA30591.1| hypothetical protein LMIG_00292 [Listeria monocytogenes FSL N3-165] Length=372 Score = 128 bits (322), Expect = 5e-28, Method: Composition-based stats. Identities = 85/248 (34%), Positives = 126/248 (50%), Gaps = 7/248 (2%) Query 60 LTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKK-NYQK 118 + GDIM ++ ++ G DY F +V LK+SDY + E + KK YQ+ Sbjct 59 FNIDFTGDIMFDWDLRPVLAEKGMDYPFNNVREELKSSDYTFVDLETAITTRTKKVPYQE 118 Query 119 ADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGEN 178 + + ++ A+K AG ++N++NNH+ DY G DT A + +L YVGAG+N Sbjct 119 ----FWIKSDPSSLTALKNAGVDMVNISNNHILDYYEDGLLDTTAALRANNLAYVGAGKN 174 Query 179 FKDVKNIVYQNVNGVRVATLGFTDAFV-AGAIATKEQPGSLSMNPDVLLKQISKAKDPKK 237 + + ++ G +V + F F G IA ++ PG + L+++ K + K Sbjct 175 EDEAYQLKVADIKGNKVGFMSFCHFFPNTGWIADEDTPGVTNGYDINLVEEKIKEERAKN 234 Query 238 GNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAG-ADIIVGHHPHVLQSFDVYKQGIIF 296 + D +VV HWG E N P Q K +VD D IV HPH LQ F+VYK I Sbjct 235 KDIDYMVVYFHWGVEKTNTPVDYQTQYVKKLVDDHLVDAIVASHPHWLQGFEVYKDVPIA 294 Query 297 YSLGNFVF 304 YSLGNF+F Sbjct 295 YSLGNFLF 302 >ref|YP_359604.1| Gene info capA domain protein [Carboxydothermus hydrogenoformans Z-2901] gb|ABB15149.1| Gene info capA domain protein [Carboxydothermus hydrogenoformans Z-2901] Length=307 Score = 126 bits (317), Expect = 2e-27, Method: Composition-based stats. Identities = 92/277 (33%), Positives = 149/277 (53%), Gaps = 26/277 (9%) Query 32 LIAVILIAATWVQRTEAVAPVKHRENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVS 91 L+A+ L A A +P K ++ + +GD++ G ++ +YG DY ++ V Sbjct 12 LLAITLTKAF----ASAASPAK-----EIKLVFLGDVLAGGNLNYYYQKYGYDYPWQKVK 62 Query 92 PYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMT 151 Y + V N E + L K +K + E +KA+K+AG T +++ANNH Sbjct 63 KYFQGK-LVFANLESCISLRGKPERKKYT----FRGRPEFLKAMKKAGVTAVSVANNHSA 117 Query 152 DYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGA-IA 210 DYG DT+ ++ + Y GAG + + I +Q G ++ L F+ + A +A Sbjct 118 DYGLISLYDTLGYLRQEGIYYSGAGRDVY-ITEIPWQ---GYKIGFLAFSRVIPSTAWVA 173 Query 211 TKEQPGSLSM-NPDV--LLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKA 267 + ++ G S+ P+V +LK I + DL+VV+ HWG E D P+P + LA Sbjct 174 SPKKTGIWSIYEPNVGKILKLICE----NDAKYDLLVVSVHWGVERDLTPNPPEIKLAHK 229 Query 268 MVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVF 304 +V+AGAD+++GHHPHV+Q +++YK IFYSLGNF+F Sbjct 230 LVEAGADVVMGHHPHVVQRYEIYKGRPIFYSLGNFIF 266 >ref|ZP_01425218.1| Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Herpetosiphon aurantiacus ATCC 23779] gb|EAU18038.1| Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Herpetosiphon aurantiacus ATCC 23779] Length=374 Score = 125 bits (315), Expect = 4e-27, Method: Composition-based stats. Identities = 94/301 (31%), Positives = 149/301 (49%), Gaps = 19/301 (6%) Query 59 KLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQK 118 K+ + +VGDIM+ R + E + + F V L N+D GN E + + Sbjct 70 KIELAVVGDIMLARSIGERILSDSPEQPFAGVRDELVNADLTIGNLETAI----ADAGEP 125 Query 119 ADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGEN 178 A K A E+V ++ +AGF +++LANNH D+G +TI EA++ VGAG N Sbjct 126 APKAYRFLAPPESVDSLSDAGFDLVSLANNHSLDWGESALSETIGLLNEAEIANVGAGMN 185 Query 179 FKDVKNIVYQNVNGVRVATLGFTD------AFVAGA-IATKEQPGSLSMNPDVLLKQISK 231 + V +G+R+A L + + FV + AT EQ G P V+ ++ Sbjct 186 AEQAYRPVIIEKHGLRLAFLAYVNVPVERGGFVTESWTATAEQAGLAWAEPAVIAADVAA 245 Query 232 AKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYK 291 + + D V++ H G E ++P+ Q + A A +DAGA +++G HPHVLQ ++ Sbjct 246 IRP----SVDHVIILLHSGYEGIDQPNEIQRSNAYAALDAGATLVLGAHPHVLQGYEARP 301 Query 292 QG-IIFYSLGNFVFDQGW--TRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTSAL 348 G I +SLGNFVFD G+ T + DSA++ L P+ + +G P+ + Sbjct 302 NGQFIAWSLGNFVFD-GFDGTPSLDSAILHLTLDKTRVIASRWTPVRLIDGYPQALDPTT 360 Query 349 D 349 D Sbjct 361 D 361 >ref|YP_147857.1| Gene info poly-gamma-glutamate biosynthesis (capsule formation) [Geobacillus kaustophilus HTA426] dbj|BAD76289.1| Gene info poly-gamma-glutamate biosynthesis (capsule formation) [Geobacillus kaustophilus HTA426] Length=385 Score = 125 bits (314), Expect = 4e-27, Method: Composition-based stats. Identities = 78/255 (30%), Positives = 121/255 (47%), Gaps = 36/255 (14%) Query 59 KLTMTMVGDIMMGR--------HVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLL 110 ++T++ GD+ +GR E ++G Y +++ P K D+ + N E + Sbjct 76 RITISAAGDVTLGRDENYGYAYSFDEEAKKHGLRYFTKYIEPIFKKDDFTTVNLETTL-- 133 Query 111 EDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADL 170 + +KA K K + G +NLANNH DY +G DTI + K+ ++ Sbjct 134 --TTSTRKASKKFRFRGHPSYAKILTYGGIDAVNLANNHTYDYLQRGYNDTIASLKKENI 191 Query 171 DYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQIS 230 Y G + + V G++V LG+ N L KQI+ Sbjct 192 GYFGRTLR-------LLKTVKGIQVGALGYEGW----------------SNTSTLRKQIA 228 Query 231 K-AKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDV 289 + +K AD+V V+ HWG E P+ Q+AL + +D+GAD++VGHHPHV+Q + Sbjct 229 NDIRTLRKQGADIVFVHFHWGVERSYVPNSTQKALGRFAIDSGADLVVGHHPHVIQGIEE 288 Query 290 YKQGIIFYSLGNFVF 304 YK I YSLGNF+F Sbjct 289 YKGKFIVYSLGNFMF 303 >ref|ZP_01542067.1| conserved hypothetical protein [Shewanella woodyi ATCC 51908] gb|EAV35540.1| conserved hypothetical protein [Shewanella woodyi ATCC 51908] Length=691 Score = 125 bits (314), Expect = 4e-27, Method: Composition-based stats. Identities = 94/370 (25%), Positives = 170/370 (45%), Gaps = 36/370 (9%) Query 43 VQRTEAVAPVKHRENE--KLTMTMVGDIMMGR-------------HVKEIVNRYGTDYVF 87 VQ + +K E ++ + GD+MMGR H K +++ + V Sbjct 89 VQNDGTIPTIKLTEKRSGRVMLAFGGDVMMGRRFFKPYFDDPVQLHDKSLLD--DSRKVV 146 Query 88 RHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLAN 147 + PYL +D + N E + E + +KA K++ ++ + A+ AG + L N Sbjct 147 EQMKPYLSLADLAAVNLETQIATETPE--KKAKKSVVFFSQPALLSALSWAGVDYVTLGN 204 Query 148 NHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTD---AF 204 NH DY G T+K ++ L Y GAG+ D + +NG + LG+ Sbjct 205 NHTYDYLGSGLDSTLKYLSQSSLGYSGAGKTSSDALKAHREIINGQPFSMLGYVGWEGGA 264 Query 205 VAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEAL 264 G AT + G+ + + ++ + + + + VV H EY N+P+ E Sbjct 265 KIGQAATADHGGAAYGSLENIVSTVKREMNASRHT----VVQYHGSLEYKNEPTGVTEQR 320 Query 265 AKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWTRTKDSALVQYHLRDN 324 K+ +DAGA + + HHPHV Q ++Y+ +I YS+GNF+FDQ + T+ S ++ L + Sbjct 321 LKSAIDAGASLAIAHHPHVAQGLELYQNHLIAYSMGNFIFDQNFNSTQLSFILYVWLDEG 380 Query 325 GTAILDVVPLNIQEGSPKPVTSALDKNRVYRQLTKDTSKGALWSK---------KDDKLE 375 ++VP+ ++ P P L + V ++L++ ++K + K D+K E Sbjct 381 EFHRAEIVPIYLKGYKPTPAI-GLQRYYVMKRLSELSAKRNTYIKGSGGHGVIESDNKRE 439 Query 376 IKLNHKHVIE 385 +K + ++ Sbjct 440 LKAQYSKTVQ 449 >ref|NP_682591.1| Gene info poly-gamma-glutamic synthesis PgsA protein homolog [Thermosynechococcus elongatus BP-1] dbj|BAC09353.1| Gene info tll1801 [Thermosynechococcus elongatus BP-1] Length=507 Score = 124 bits (312), Expect = 7e-27, Method: Composition-based stats. Identities = 81/272 (29%), Positives = 133/272 (48%), Gaps = 40/272 (14%) Query 49 VAPVKHRENEKLTMTMVGDIMMGRHVKEIVNRYGTD--YVFRHVSPYLKNSDYVSGNFEH 106 V+P + +L + VGDI++G + NR D +F V PYL+ +D++ GN+E Sbjct 176 VSPPPAPSDRRLRIKAVGDIVLGTNFPR--NRLPADPQKLFDQVKPYLQGADFLFGNYE- 232 Query 107 PVLLEDKKNYQK--ADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKA 164 L + Y+K D+ + + +++AGF +LN+ANNH D+ +G +DTI+ Sbjct 233 STLTDHPHPYKKTQGDRAFAFRSPPSYAQVLRQAGFDILNIANNHSYDFNEQGFRDTIRY 292 Query 165 FKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDV 224 A + +G D+ I Y G++ A +GF + + +L Sbjct 293 INAAGMTAIG------DLNQITYLEAKGLKTAFIGFATYYGQNRLQDHRAGAAL------ 340 Query 225 LLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEA-------------LAKAMVDA 271 + +AK NAD+VVV+ H G E ++ R A+ M+D Sbjct 341 ----VQEAKK----NADIVVVSFHGGAEGSDQIHTRDRTEYFYGEDRGNVVQFARTMIDN 392 Query 272 GADIIVGHHPHVLQSFDVYKQGIIFYSLGNFV 303 GAD+++GH PHV ++ ++YK +I YSLGNFV Sbjct 393 GADLVLGHGPHVPRALELYKGRLIAYSLGNFV 424 >ref|YP_378984.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Chlorobium chlorochromatii CaD3] gb|ABB27941.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Chlorobium chlorochromatii CaD3] Length=377 Score = 124 bits (312), Expect = 9e-27, Method: Composition-based stats. Identities = 93/308 (30%), Positives = 154/308 (50%), Gaps = 25/308 (8%) Query 84 DYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVL 143 D+V ++ ++NSD NFE P+ +D + +KA +++ S +E+V+ +K GF + Sbjct 19 DFVDNKLTQIIQNSDIAICNFEAPIFHQDMRPIKKAGPHVYQS--KESVQYLKNVGFNFV 76 Query 144 NLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATL-GFTD 202 +LANNH+ DY KG DTI+ K+ DL+++G G F++ NG+ + L G + Sbjct 77 SLANNHIYDYRQKGIFDTIQELKKFDLEFIGGGTTFEEAYKTTIIEKNGITIGLLAGCEN 136 Query 203 AFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQE 262 F G + ++ G + + +I K D +V +H G E P Sbjct 137 EF--GCLYEEQNRGGYAW---LFHHKIEDNIRELKAKCDFIVFISHAGVEDIELPIKEWR 191 Query 263 ALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWTRTKD----SALVQ 318 + + D G D+I+GHHPHV Q ++ + + +IFYSLGNF FD + K S L++ Sbjct 192 DRYQRLCDVGVDVIIGHHPHVPQGYEKHNKSLIFYSLGNFYFDTTSFKNKSDDSFSLLIE 251 Query 319 YHLRDN-GTAILDVVPLNIQEGSPKPVTSALDKNRVYRQLTKDTSKGAL---WSKKDDKL 374 + N G I+ +N Q T +DK V L D G L + K++D++ Sbjct 252 FEKNKNIGFEIIYHKKINGQ-------TVLVDKKDVSFDL--DYLCGILEDGYLKRNDEI 302 Query 375 EIKLNHKH 382 I+L +K+ Sbjct 303 SIELFNKY 310 >ref|YP_001203514.1| Gene info hypothetical protein; putative metallo-dependent phosphatase [Bradyrhizobium sp. ORS278] emb|CAL75277.1| Gene info hypothetical protein; putative metallo-dependent phosphatase [Bradyrhizobium sp. ORS278] Length=493 Score = 124 bits (311), Expect = 9e-27, Method: Composition-based stats. Identities = 93/287 (32%), Positives = 135/287 (47%), Gaps = 23/287 (8%) Query 62 MTMVGDIMMGRHV-KEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKAD 120 + GDIM+ R V +EI R G + +S + +D V GNFE V + + A Sbjct 46 LLFTGDIMLSRQVAREIAARGGLS-PWHGMSDMFRRADLVVGNFEGTVGTAEACD---AP 101 Query 121 KNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFK 180 + + + V +K AGFT L +ANNH D GA G K T +A A L +G+ E+ Sbjct 102 RELCFAVDPRLVGLLKHAGFTALGIANNHSGDLGATGRKATREALHAAGLGAIGSAESPA 161 Query 181 DVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNA 240 +K VR TL I+ PG V +++ + A Sbjct 162 FLK---------VRGRTLAL--------ISLNLVPGRDGQIDQVPSWPVAQKLRLARALA 204 Query 241 DLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLG 300 D V+V+ HWG+E + P QE+ A+ +V GAD+I+G HPHV+Q +FYSLG Sbjct 205 DWVLVSVHWGKELADWVVPEQESAARWLVAQGADLIIGAHPHVVQPPACVDGKPVFYSLG 264 Query 301 NFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTSA 347 N VFDQ + TK + + D+ + +P +GS PV SA Sbjct 265 NHVFDQKYPLTKRGLIADCEIEDD-RLVCSGLPTGTPDGSAYPVLSA 310 >ref|YP_076491.1| Gene info putative poly-gamma-glutamate biosynthesis enzyme [Symbiobacterium thermophilum IAM 14863] dbj|BAD41647.1| Gene info putative poly-gamma-glutamate biosynthesis enzyme [Symbiobacterium thermophilum IAM 14863] Length=388 Score = 124 bits (310), Expect = 1e-26, Method: Composition-based stats. Identities = 80/246 (32%), Positives = 122/246 (49%), Gaps = 11/246 (4%) Query 60 LTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKA 119 +T+T VGDIM+ R + + R G D F V+ L +D GN E V + Sbjct 87 VTITFVGDIMLDRLPGDYLAR-GED-PFAGVADALTGADLTVGNLECVV----STVGEPV 140 Query 120 DKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENF 179 K + V + F +++ANNH DYG + + ++ E + Y G G N Sbjct 141 PKWFNFRCHPRVVPVLARY-FDAVSVANNHSGDYGKEAFAEQLRLLTEGGVPYFGGGMND 199 Query 180 KDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGN 239 ++ + NG+R+A LG+ + + A + PG + D L + A+ Sbjct 200 EEAHRPLILERNGLRIALLGYNNVELRSYAAGPDTPGLAWIELDRLAADVRAAR----AE 255 Query 240 ADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSL 299 AD+VVV HWG +Y + Q +A+ +D GAD++VG+HPHV Q ++YK +I YSL Sbjct 256 ADIVVVYPHWGYDYMFWHAEDQAEIARVAIDNGADLVVGNHPHVTQPVEIYKDRLIAYSL 315 Query 300 GNFVFD 305 GNFVFD Sbjct 316 GNFVFD 321 >ref|ZP_00615511.1| similar to Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation) [Kineococcus radiotolerans SRS30216] gb|EAM76586.1| similar to Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation) [Kineococcus radiotolerans SRS30216] Length=383 Score = 123 bits (309), Expect = 2e-26, Method: Composition-based stats. Identities = 90/275 (32%), Positives = 130/275 (47%), Gaps = 16/275 (5%) Query 87 FRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLA 146 R V+P L +D N E V + Q A K A + A++ AG V+ +A Sbjct 98 LRPVAPVLSAADLSLVNLETAV----TERGQPAAKQYTFRAPAAALTALRGAGVDVIGMA 153 Query 147 NNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFT----D 202 NNH DYG+ G DT+ A + A L +G G++ + N+ G RVA L T Sbjct 154 NNHSLDYGSVGLSDTLAAGRAAKLPLIGIGQDAEQAFRPYTVNIRGHRVAVLAATQVLDS 213 Query 203 AFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQE 262 + V ATKE PG ++ K + A + AD V+V HWG+E + P PRQE Sbjct 214 SLVQQWTATKEHPGVAAVQNATGQKLLLAAVKTAEEQADSVIVLMHWGQERNTCPLPRQE 273 Query 263 ALAKAMVDAGADIIVGHHPHVLQSFDVY-----KQGIIFYSLGNFVFDQGWTRTKDSALV 317 +LA ++ AGAD +VG H HV Q + + ++G + Y LGNFVF S ++ Sbjct 274 SLAGDLISAGADAVVGSHAHV-QLGNGWLTKDGRKGFVDYGLGNFVFYARGGAAAQSGVL 332 Query 318 QYHLRDNGTAILDVVPLNIQEGSPKPVTSALDKNR 352 G + P I G P+P++ A D +R Sbjct 333 TLPAA-GGVSSAAWQPARISGGVPQPLSGA-DSDR 365 >ref|YP_001231695.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like protein [Geobacter uraniumreducens Rf4] gb|ABQ27122.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like protein [Geobacter uraniumreducens Rf4] Length=331 Score = 123 bits (308), Expect = 3e-26, Method: Composition-based stats. Identities = 83/329 (25%), Positives = 147/329 (44%), Gaps = 18/329 (5%) Query 60 LTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKA 119 + + GD+M+GR V + R +Y + P +D+ N E V+ ++ + Sbjct 6 VKLLFAGDVMLGRLVNRALQRLPPEYPWGDTLPLFATADWRMCNLE-CVISDNGTPWSLT 64 Query 120 DKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENF 179 K H + V ++ A ++LANNH DY + D ++ +A + + GAG + Sbjct 65 PKIFHFRSDAGNVAVLQAAHIDAVSLANNHSLDYEYEAMFDMLRILNKAKIAHAGAGADL 124 Query 180 KDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDV-------LLKQISKA 232 + V G+R+ + FTD A AT EQ G + D+ L+ +I + Sbjct 125 AEASRPAVSQVQGLRIGVIAFTDNEPAWEAAT-EQAGVWFVPIDLQNARAAGLMAKIHRV 183 Query 233 KDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQ 292 + DL+VV+ HWG + ++P P +A++DAGAD + GH HV + ++Y+Q Sbjct 184 R----AEVDLLVVSVHWGPNWGHEPPPEHIDFGRALIDAGADAVFGHSGHVFRGIEIYRQ 239 Query 293 GIIFYSLGNFVFDQG---WTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTSALD 349 I Y G+F+ D R S + + + + P I++ + + Sbjct 240 RPIIYCAGDFIDDYAVDEVERNDRSMIFILEYDQCSLSKIRLYPTVIRDFQARLAQGSEA 299 Query 350 K--NRVYRQLTKDTSKGALWSKKDDKLEI 376 + R +QL D + +LW + + LEI Sbjct 300 EWIGRKMQQLCADLATSSLWLRDEQCLEI 328 >ref|YP_797675.1| Gene info Poly-gamma-glutamate biosynthesis [Leptospira borgpetersenii serovar Hardjo-bovis L550] ref|YP_800554.1| Gene info Poly-gamma-glutamate biosynthesis [Leptospira borgpetersenii serovar Hardjo-bovis JB197] gb|ABJ78742.1| Gene info Poly-gamma-glutamate biosynthesis [Leptospira borgpetersenii serovar Hardjo-bovis L550] gb|ABJ75796.1| Gene info Poly-gamma-glutamate biosynthesis [Leptospira borgpetersenii serovar Hardjo-bovis JB197] Length=399 Score = 122 bits (306), Expect = 4e-26, Method: Composition-based stats. Identities = 74/290 (25%), Positives = 142/290 (48%), Gaps = 13/290 (4%) Query 51 PVKHRENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLL 110 P + + E L + GD+M +++ + ++G + + + +D+ N E PV+ Sbjct 55 PEHNHDPELLKVLAGGDVMFNWGIRDTIQKHGEIAPVKGLKSLFREADFRMVNLETPVVA 114 Query 111 EDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADL 170 + +KA +A E+ + ++K G ++ L NNH D+G +G +T+ + ++ Sbjct 115 SKTEESKKA---YIFTAHEKDLDSLKFLGVDMVFLGNNHSFDHGQRGMDETLSILNKNNI 171 Query 171 DYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQIS 230 VGAG+ V N + ++ G + T AT + G +L + Sbjct 172 LNVGAGKKLPQVLNPLNLSLKGTDLRIHSVTAVAERSHYATPTKSGVAPF----MLSSLQ 227 Query 231 KA---KDP---KKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVL 284 A K P K ++ + +V+ HWG EY P+ Q +A+ ++D+G I++GHHPH+ Sbjct 228 AAFFEKHPSRFKNHSSPIRIVSLHWGIEYSPFPTSDQRKIARTLIDSGVKIVIGHHPHIP 287 Query 285 QSFDVYKQGIIFYSLGNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPL 334 Q ++Y+ G+I YSLGN +F + + + +H+R N +++VP+ Sbjct 288 QGVEIYRGGVILYSLGNLIFGSRNSYLNHNLVAIFHIRRNRLERVELVPI 337 >ref|YP_877614.1| Gene info capsule biosynthesis protein capA [Clostridium novyi NT] gb|ABK60861.1| Gene info capsule biosynthesis protein capA [Clostridium novyi NT] Length=357 Score = 122 bits (305), Expect = 6e-26, Method: Composition-based stats. Identities = 83/282 (29%), Positives = 143/282 (50%), Gaps = 17/282 (6%) Query 79 NRYGTDYVFRHVSPYLKNSDYVSGNFEHPVL-LEDKKNYQKADKNIHLSAKEETVKAVKE 137 N++ F+ + L +D+++ N E V LE KK +K + + + A+K Sbjct 10 NKFIDSLNFKDICKILNTNDFITFNLETTVSGLEGKKR----NKAFNFKTDYDNLYALKN 65 Query 138 A--GFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRV 195 + + N+ANNH+ DYG + DTI+ ++++ Y G N + I N+N +++ Sbjct 66 SINCPIICNIANNHIFDYGEECFIDTIENLNKSNIYYTGYSSNLDIEQGITCVNINNIKI 125 Query 196 ATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDN 255 A +G A+ ++ ++ + P +K I K ADLV+++ HWGEE Sbjct 126 AFIG---AYNGDNVSVN----NIGLTP---IKNIYDKVIYAKKIADLVILHLHWGEELSL 175 Query 256 KPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWTRTKDSA 315 SPRQ +A +VD GADII+GHHPHV+Q+ + YK +I YSLGNF K S Sbjct 176 CQSPRQVNIAHKLVDLGADIIIGHHPHVIQAIEEYKGSLIIYSLGNFQIITSDIDDKYSH 235 Query 316 LVQYHLRDNGTAILDVVPLNIQEGSPKPVTSALDKNRVYRQL 357 ++Q + + ++P+ I+ P + D++ Y+++ Sbjct 236 IIQVFVDKSRKINYKLIPVIIKNTIPNVLKKINDEHNNYKKI 277 >ref|NP_624217.1| Gene info putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation) [Thermoanaerobacter tengcongensis MB4] gb|AAM25821.1| Gene info putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation) [Thermoanaerobacter tengcongensis MB4] Length=367 Score = 121 bits (304), Expect = 6e-26, Method: Composition-based stats. Identities = 90/299 (30%), Positives = 135/299 (45%), Gaps = 52/299 (17%) Query 43 VQRTEAVAPVKHRENEK----------LTMTMVGDIMMGRHVKEIVNRYGT--------- 83 V++ E++ PVK ++ K + + VGD +G E ++YGT Sbjct 37 VEKEESLLPVKEGQDTKDAEKVLDYTEIVVNAVGDCTLGS--DEKYSKYGTFDEELKKQN 94 Query 84 ---DYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGF 140 Y FR+V K D N E P+ K+ A+K K +KE G Sbjct 95 YDYSYFFRNVKDTFKKGDLTIANLEGPLTTSTKR----AEKEYAFKGHPSYAKILKEGGV 150 Query 141 TVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGF 200 +NLANNH DYG +G +T+ A K+ + Y G G + V GV++ LG+ Sbjct 151 DAVNLANNHSFDYGKEGFYETVNALKKEGIGYFGYGYRY-------ITEVKGVKIGVLGY 203 Query 201 TDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPR 260 T + + ++I K + + ++++V+ HWGEE P+ Sbjct 204 TG----------------YDDTEWTKQEIKKDIEKLRPEVNILIVSFHWGEESKYYPNKI 247 Query 261 QEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWT-RTKDSALVQ 318 Q L +D GAD+++GHHPHVLQ + YK I YSLGNFVF + KDS + Q Sbjct 248 QRNLGHFAIDEGADLVIGHHPHVLQGIEKYKARYIAYSLGNFVFGGNRNPKDKDSMIFQ 306 >ref|YP_982634.1| Gene info putative poly-gamma-glutamate biosynthesis enzyme [Polaromonas naphthalenivorans CJ2] gb|ABM37713.1| Gene info putative poly-gamma-glutamate biosynthesis enzyme [Polaromonas naphthalenivorans CJ2] Length=328 Score = 119 bits (299), Expect = 3e-25, Method: Composition-based stats. Identities = 86/295 (29%), Positives = 134/295 (45%), Gaps = 25/295 (8%) Query 58 EKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQ 117 + +++ GDI++ E++ R G D F ++ +D GN E + Sbjct 27 DPVSLVFAGDIVLDDSAGEMIER-GQD-PFAGLAAVFGGADIRIGNLECVI----ATTGS 80 Query 118 KADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGE 177 DKN A T+ +K F L LANNH D+G + + K++ L G G Sbjct 81 AGDKNYTFRAHPRTLPVLKRH-FDALALANNHSGDFGREAFAQMLGLLKQSGLAQFGGGI 139 Query 178 NFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKK 237 + + G+R+A LG+++ A PG + ++ I KA+ K Sbjct 140 DLSQAHTPLIIERKGLRIALLGYSEFMPRSFEADYNAPGIAWSEDEQVVADIRKARTVYK 199 Query 238 GNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFY 297 ADLV+ HWG E + + RQ LA+ M+DAGAD+++G HPHV Q + Y+ I Y Sbjct 200 --ADLVIPVMHWGWENEPTSNARQRHLARLMIDAGADVVIGGHPHVTQEIEHYQGKPIIY 257 Query 298 SLGNFVFDQ--------GWTRTKDSALVQYHLRDNGTAILDVVPLNIQ-EGSPKP 343 S+GNFV + GW +++ L G + D V + I EG P+P Sbjct 258 SVGNFVMKETDNANQRRGW-------VLRLQLDKQGVSSFDTVVVQISLEGIPQP 305 >ref|YP_001161126.1| Gene info hypothetical protein Strop_4320 [Salinispora tropica CNB-440] gb|ABP56748.1| Gene info hypothetical protein Strop_4320 [Salinispora tropica CNB-440] Length=384 Score = 119 bits (297), Expect = 4e-25, Method: Composition-based stats. Identities = 87/262 (33%), Positives = 131/262 (50%), Gaps = 37/262 (14%) Query 56 ENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDK-- 113 E +++T GDI++G + + G + F V P L +D GN E P+ ++ Sbjct 61 EAAAVSLTATGDIILGNAPNRLPPKDGEGF-FDEVRPELA-ADLAMGNLEEPLTVDTGTG 118 Query 114 KNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYV 173 K + + A E +++ GF +LNLANNH D+GAKG ++T +A ++ +L + Sbjct 119 KCGENSTNCYQFRAPPEYAAHLRDGGFDLLNLANNHGNDFGAKGLQNTRQALEQYELAHT 178 Query 174 GAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAK 233 GA + I +V GV+VA GF+ A + + P + + ++KA Sbjct 179 GAPDQ------ITVVDVRGVQVAVAGFSS--YAWSNPLTDIPAAKQV--------VTKAA 222 Query 234 DPKKGNADLVVVNTHWGEEYDNKP--SPRQE-----------ALAKAMVDAGADIIVGHH 280 + ADLVVV H G E +K P E AKAM+DAGAD+IVGH Sbjct 223 E----MADLVVVQVHMGAEGADKTRVKPGTELYLGENRGDPVRFAKAMIDAGADLIVGHG 278 Query 281 PHVLQSFDVYKQGIIFYSLGNF 302 PHVL+ + Y+ +I YSLGNF Sbjct 279 PHVLRGMEFYQGRLIAYSLGNF 300 >ref|YP_001046594.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like protein [Methanoculleus marisnigri JR1] gb|ABN56612.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like protein [Methanoculleus marisnigri JR1] Length=360 Score = 119 bits (297), Expect = 5e-25, Method: Composition-based stats. Identities = 77/219 (35%), Positives = 110/219 (50%), Gaps = 13/219 (5%) Query 87 FRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLA 146 F V L+ D + GN E VL E +K N + E + +KEAGF +L++A Sbjct 23 FALVQHELRQKDLLFGNLE-TVLSESGSESRKRWVN---TTPPEAGEFLKEAGFDILSVA 78 Query 147 NNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVA 206 NNH D G +G ++T++ + + YVG G + +V ++ NG R L +T + Sbjct 79 NNHTLDRGREGFENTLEGLESRGIAYVGGGRGDNPPEGLVVEH-NGTRFGFLAYT----S 133 Query 207 GAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAK 266 G + + ++ I KD D VVV+ HWG E PSP Q LA Sbjct 134 GRFRSPPGVTVAKLKKKAVIDDIRALKD----RCDHVVVSLHWGIENTYYPSPDQVRLAH 189 Query 267 AMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFD 305 A +D GA +I+GHH H +Q + YK G+I YSLGNF FD Sbjct 190 AFIDNGATLILGHHSHTIQGLERYKGGLIAYSLGNFQFD 228 >ref|ZP_01649625.1| Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Salinispora arenicola CNS205] gb|EAX26271.1| Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Salinispora arenicola CNS205] Length=373 Score = 118 bits (295), Expect = 7e-25, Method: Composition-based stats. Identities = 95/385 (24%), Positives = 166/385 (43%), Gaps = 75/385 (19%) Query 55 RENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKK 114 ++N + + GD+++ R +FRHV L +D G E P D+ Sbjct 3 QKNRGIVVAATGDLLIARDRPH--------DMFRHVRDLLTEADITVGQLETP--YSDQG 52 Query 115 NYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVG 174 + + A+ AGF V++LA+NH D+GA D I+ + + VG Sbjct 53 SRSSCGARGAVPNDVANFAAIPHAGFDVISLASNHAGDWGADALLDCIERCRRHGITVVG 112 Query 175 AGENFKDVKNIVYQNVNGVRVATLGFT----DAFVAG----AIATK-----------EQP 215 AG + + + +G RV L + D + AG +A +QP Sbjct 113 AGADIAEARRPGIIERDGTRVGFLAYCSVAPDGYYAGPGNHGVAPMRARTLYEPFQFDQP 172 Query 216 G---SLSMNPD-----VLLKQISKAKDPKKGNADLVVVNTHWGEEYD-NKPSPRQEALAK 266 G S+ PD L+ I + +D D+++V+ HWG + ++ + Q +A Sbjct 173 GAPPSVRTLPDEYDLAALVANIGELRD----QVDVLIVSLHWGLLFQRSRLADYQPVVAH 228 Query 267 AMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFD--QGWTRT------------- 311 A +DAGAD+++GHHPH+L+ +VY+ +IFYSLG+F + + W R+ Sbjct 229 AAIDAGADVVIGHHPHILKPVEVYRGKVIFYSLGDFALEINERWWRSFSREWFERAVQFY 288 Query 312 -------------KDSALVQYHLRDNGTAILDVVPLNIQEG-SPKPVTSALDKNRVYR-- 355 ++S +VQ H+ D + VP+ I + P P + + R R Sbjct 289 QALAPGQDMHEEGRNSMIVQLHIVDGRIDRVGFVPVTINDAREPVPYRADTEDGRAVRAY 348 Query 356 --QLTKDTSKGALWSKKDDKLEIKL 378 Q+T + + DD++ +++ Sbjct 349 LAQITAEAGIDTTFDVVDDEVLVRI 373 >ref|YP_269402.1| Gene info hypothetical protein CPS_2688 [Colwellia psychrerythraea 34H] gb|AAZ25507.1| Gene info hypothetical protein CPS_2688 [Colwellia psychrerythraea 34H] Length=712 Score = 118 bits (295), Expect = 8e-25, Method: Composition-based stats. Identities = 78/319 (24%), Positives = 150/319 (47%), Gaps = 21/319 (6%) Query 55 RENEKLTMTMVGDIMMGRH-----------VKEIVNRYGTDYVFRHVSPYLKNSDYVSGN 103 ++ +++ + GD+MM R + + + ++ PY+ +DY + N Sbjct 111 KQAKRVMLAFGGDVMMDRRYYKPYFGDSILIHPETKLSDSKAIVENIKPYMSIADYAAVN 170 Query 104 FEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIK 163 E + +K +A K++ ++ E + A+ AG ++L NNH DY G + T+ Sbjct 171 LETQI--ANKTPGDRAPKSVTFYSRPEILDALVWAGVDYVSLGNNHTYDYLEPGMESTLA 228 Query 164 AFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTD---AFVAGAIATKEQPGSLSM 220 +++ L + GAG N K + +N + LG+ + A E G+ Sbjct 229 FLQQSPLGFSGAGMNAKQALKAHHDTINNTEFSMLGYVGWEGSSEPTQTANHEHGGAAYG 288 Query 221 NPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHH 280 + ++ + + + G + +V H +EY N P+ E K+ +D GA + + HH Sbjct 289 SMTNIINSVQQ----EVGQNRVTIVQYHGSQEYANSPTGVTEQRLKSALDNGAALAIAHH 344 Query 281 PHVLQSFDVYKQGIIFYSLGNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGS 340 PHV Q ++Y +I YS+GNF+FDQ ++ T+ S ++ L + ++VPL ++ Sbjct 345 PHVTQGLELYDNKLIAYSMGNFIFDQNFSATQHSFILYVWLDEGEFHRAEIVPLYVKGYK 404 Query 341 PKPVTSALDKNRVYRQLTK 359 P P T ++ V ++LT+ Sbjct 405 PTPATGT-NRYTVMKRLTE 422 >ref|ZP_01672783.1| Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Candidatus Desulfococcus oleovorans Hxd3] gb|EAX55909.1| Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Candidatus Desulfococcus oleovorans Hxd3] Length=350 Score = 117 bits (293), Expect = 1e-24, Method: Composition-based stats. Identities = 70/206 (33%), Positives = 107/206 (51%), Gaps = 14/206 (6%) Query 103 NFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTI 162 N E P+ DK K I L + + +K + T + LANNH+ DYG KG +DTI Sbjct 31 NLEAPLTEHDKPLPDK----IVLKSSGDFLKKTFDPLPTAVCLANNHIMDYGVKGFEDTI 86 Query 163 KAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFT-DAF---VAGAIATKEQPGSL 218 + + Y GAG + N + ++ G R A LG+ +A+ V K P L Sbjct 87 NFLENNRIGYFGAGTPKNNHNNPLVLDIAGHRTALLGYCYNAYFGQVDSGFKMKYTPAPL 146 Query 219 SMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVG 278 + +I + +G+ D ++VN HWG Y N P + LA+ ++DAGA++++G Sbjct 147 DAD------RIKRDIAAIRGSCDRIIVNLHWGRLYSNYPRKAEVELARTVIDAGANVLIG 200 Query 279 HHPHVLQSFDVYKQGIIFYSLGNFVF 304 HH H LQ + YK G+I Y++GNF+F Sbjct 201 HHAHTLQPVETYKNGLIAYNIGNFIF 226 >ref|YP_658558.1| Gene info poly-gamma-glutamate biosynthesis/capsule biosynthesis protein [Haloquadratum walsbyi DSM 16790] emb|CAJ52956.1| Gene info poly-gamma-glutamate biosynthesis/capsule biosynthesis protein [Haloquadratum walsbyi DSM 16790] Length=718 Score = 117 bits (293), Expect = 1e-24, Method: Composition-based stats. Identities = 99/379 (26%), Positives = 162/379 (42%), Gaps = 52/379 (13%) Query 42 WVQRTEAVAP-------VKHRENEKLTMTMVGDIMMGRHVKEIVNRYGTDY--------- 85 ++ RT AVAP + RE + ++ GD+M GR E + + Sbjct 109 FIGRTVAVAPGTSSRIRLSPREG-TVALSFGGDVMFGRRFYEDDHPLEPHFQIRPDDRME 167 Query 86 ----VFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFT 141 + +++SP L+++D S N E P+ ++ K H + + A+ EAG Sbjct 168 SHQTILQYISPLLQDADITSVNLETPL---TTTAWRHPSKRYHFVSHPDAAPALAEAGVD 224 Query 142 VLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFT 201 + L NNH D G +T++A A ++ GAG++ + Y G+ + + T Sbjct 225 YVALGNNHTLDALTPGLDETLQALSAAGIERSGAGKSNTEAWEPTYFERRGLTIGLVSCT 284 Query 202 ----DAFVAGAIATKEQPGSLSMNPDVLL---------------------KQISKAKDPK 236 D + A Q + S++ D + +IS+ Sbjct 285 TVTGDQYDIDWAADDNQSETYSVSGDDVTGIPDTEQLTFSGRVGVAAATRDRISRTVSEV 344 Query 237 KGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIF 296 NAD+ VV H G EY +P+ R L + AGAD++V HHPHV ++ + +I Sbjct 345 DANADVTVVQIHGGSEYQQEPTDRIRRLTETAKTAGADVVVNHHPHVAGGVELQDETLIA 404 Query 297 YSLGNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTSALDKNRVYRQ 356 ++LGN VFDQ + T S L+ H+ +G V PL I+ PK V +DK R ++ Sbjct 405 WTLGNLVFDQEFWSTFPSYLLTVHVTADGIPRAYVDPLLIEGYVPKGV---VDKPRTWQL 461 Query 357 LTKDTSKGALWSKKDDKLE 375 +S D+LE Sbjct 462 RETAALSSDEFSLDHDRLE 480 >ref|YP_001126007.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis [Geobacillus thermodenitrificans NG80-2] gb|ABO67262.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis [Geobacillus thermodenitrificans NG80-2] Length=376 Score = 117 bits (293), Expect = 1e-24, Method: Composition-based stats. Identities = 74/264 (28%), Positives = 120/264 (45%), Gaps = 36/264 (13%) Query 50 APVKHRENEKLTMTMVGDIMMGR--------HVKEIVNRYGTDYVFRHVSPYLKNSDYVS 101 A + +T++ GD+ +GR + ++G Y +++ P + D+ + Sbjct 58 AAIARASQVSITLSAAGDVTLGRDENYGYMYSFDDEAKKHGLRYFTKYIEPIFQKDDFTT 117 Query 102 GNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDT 161 N E + +K A+K K + G +NLANNH DY +G DT Sbjct 118 VNLETTLTTATRK----ANKQFRFRGDPSYAKILTYGGIDAVNLANNHTYDYLQQGYNDT 173 Query 162 IKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMN 221 I K+ + Y G + + V G+++ LG+ + Sbjct 174 IANLKKEKIGYFGRTLR-------LMKTVKGIQIGALGYEGW----------------SD 210 Query 222 PDVLLKQISK-AKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHH 280 L KQI+ + ADLV+++ HWG E P+ Q+AL + +D+GAD++VGHH Sbjct 211 TSTLRKQIADDILALRNEGADLVLIHFHWGVERSYVPNSTQKALGRFAIDSGADLVVGHH 270 Query 281 PHVLQSFDVYKQGIIFYSLGNFVF 304 PHV+Q + YK +I YSLGNF+F Sbjct 271 PHVVQGIEEYKGKMIVYSLGNFIF 294 >ref|YP_001158428.1| Gene info hypothetical protein Strop_1584 [Salinispora tropica CNB-440] gb|ABP54050.1| Gene info hypothetical protein Strop_1584 [Salinispora tropica CNB-440] Length=372 Score = 117 bits (292), Expect = 2e-24, Method: Composition-based stats. Identities = 94/382 (24%), Positives = 164/382 (42%), Gaps = 75/382 (19%) Query 58 EKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQ 117 E + VGD++ IV D +FRH L +D G E D+ + Sbjct 5 EGFVVAAVGDLL-------IVRDRPHD-IFRHAREQLAGADITFGQLE--TAYADQGSRG 54 Query 118 KADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGE 177 + + A+ AGF V+++A+NH D+GA D I + + VGAG Sbjct 55 SSGPRGAVPHDVANYAAIPHAGFDVISMASNHTGDWGADALLDCIGRLRRDGITVVGAGA 114 Query 178 NFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKE-------------------QPG-- 216 + + + +G RV L + G A ++ QPG Sbjct 115 DIDEARRPGIIERDGTRVGFLAYCSVAPEGYYAGRDKHGVAPMRAMTHYEPFESDQPGGP 174 Query 217 ----SLSMNPDV--LLKQISKAKDPKKGNADLVVVNTHWGEEYDN-KPSPRQEALAKAMV 269 + + + D+ L IS+ +D D+++V+ HWG + + + Q +A A + Sbjct 175 PLISTFTNDADLAALTADISRLRD----QVDVLLVSLHWGLHFQRARLADYQPVVAHAAI 230 Query 270 DAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFD--QGWTRT---------------- 311 DAGAD ++GHHPH+L+ +VY+ +IFYSLGNF D W R+ Sbjct 231 DAGADAVLGHHPHILKPVEVYQGKVIFYSLGNFALDLNDSWWRSFSREWLEEAKAFHEAL 290 Query 312 ----------KDSALVQYHLRDNGTAILDVVPLNI-QEGSPKPVTSALDKNRVYR----Q 356 ++SA+V+ H+ D G + ++++P+ I +E P P + + R R + Sbjct 291 SPERDLKAEGRNSAIVRLHIADGGVSRVEILPVVINEENEPVPYRADTPEGRAVRDYLAE 350 Query 357 LTKDTSKGALWSKKDDKLEIKL 378 +T + + DD++ +++ Sbjct 351 ITAEAGMNTAFDVVDDRVLVRI 372 >ref|ZP_00569973.1| similar to Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation) [Frankia sp. EAN1pec] gb|EAN15763.1| similar to Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation) [Frankia sp. EAN1pec] Length=431 Score = 117 bits (292), Expect = 2e-24, Method: Composition-based stats. Identities = 77/235 (32%), Positives = 111/235 (47%), Gaps = 9/235 (3%) Query 119 ADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGEN 178 A K A A+ AG V+N+ANNH DYG +G D++++ +EAD VG G + Sbjct 176 ATKAFVFRAPPTAFTAMHAAGIDVVNMANNHGMDYGVEGLADSLRSAREADFPTVGIGAD 235 Query 179 FKDVKNIVYQNVNGVRVATLGFT----DAFVAGAIATKEQPGSLSMNPDVLLKQISKAKD 234 +NG R+A G T D V A +PG S +++++ A Sbjct 236 DSAAYTPYVTTMNGQRIAIFGATQVLDDELVPAWTAGPGKPGLASAKK---VERLATAIR 292 Query 235 PKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGI 294 + D VVV HWG E + PS Q L +V AGAD +VG H HVLQ G+ Sbjct 293 EVRPTVDTVVVYLHWGVEREACPSDTQTGLVAPLVAAGADALVGGHAHVLQGAGWNHDGV 352 Query 295 -IFYSLGNFVF-DQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTSA 347 + Y LGNFVF G ++ +++ + + VP I +G P+P+T A Sbjct 353 YVGYGLGNFVFYASGGGPNTETGVLELTFQGRAVTTANWVPGRIVDGVPRPLTGA 407 >emb|CAK18893.1| hypothetical protein [Ruminococcus flavefaciens] Length=419 Score = 116 bits (290), Expect = 3e-24, Method: Composition-based stats. Identities = 90/267 (33%), Positives = 139/267 (52%), Gaps = 21/267 (7%) Query 56 ENEKLTMTMVGDIMMGRHVKEIVNRY--GTDYVFRHV---SPYLKNSDYVSGNFEHPVLL 110 E++ + VGD ++ V + Y G Y FR + YL S V+ + V+ Sbjct 60 EDKVAHVVAVGDNLIHYSVYKNAEAYAGGNGYDFRPIYKEVKYLVESADVAVINQETVIS 119 Query 111 EDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTI----KAFK 166 E + + + ++ E AV + GF V+ +ANNH+ D GA G +++I K + Sbjct 120 ESNEICGANNGVLIFNSPPEVADAVIDCGFDVITMANNHLLDMGADGLEESIRFWNKKAE 179 Query 167 EADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNP--DV 224 E DL +GA N +D +NI + VNG+++A L + + +I + P + +N DV Sbjct 180 ENDLTVLGAYLNEEDSENIRIREVNGIKIAFLAYAEHLNGFSIP-EGSPLRVILNSEEDV 238 Query 225 LLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVL 284 + +QI KAK+ AD VVV+ HWG E N S ++ LAK MVD GAD+I+G H H Sbjct 239 IERQIKKAKE----MADAVVVSAHWGAEDTNIVSDDRKELAKKMVDWGADMILGGHTHTA 294 Query 285 QSF-----DVYKQGIIFYSLGNFVFDQ 306 Q+ D +G ++YS+GNFV Q Sbjct 295 QTMEWITRDDGTKGFVYYSMGNFVCAQ 321 >ref|ZP_01311108.1| Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Desulfuromonas acetoxidans DSM 684] gb|EAT17282.1| Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Desulfuromonas acetoxidans DSM 684] Length=358 Score = 115 bits (289), Expect = 4e-24, Method: Composition-based stats. Identities = 75/259 (28%), Positives = 116/259 (44%), Gaps = 10/259 (3%) Query 57 NEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNY 116 N + + ++GD++ G + V ++ N D V N E + + Sbjct 4 NPSIRLAIIGDLLFTTPYASQNGSRGLESVSAQITTLFANCDLVVANLESTLAAD----- 58 Query 117 QKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAG 176 Q+ + + ++ +A V+ LANNH D +G + T E + GAG Sbjct 59 QQVATEPRVLGTAQQFDSLIQAHINVVTLANNHAFDALDEGFRKTSDKLNELGIHAFGAG 118 Query 177 ENFKDVKNIVYQNVNGVRVATLGFTDAFVA-GAIATKEQPGSLSMNPDVLLKQISKAKDP 235 N + V +NGVR+A +G G A + G + + QI + K Sbjct 119 NNLTAAQAPVSLTMNGVRIAFIGAVATSTGMGTFAGNDSAGVAPLETRAICDQIQQLKT- 177 Query 236 KKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGII 295 + D VV HWGEE P+P Q A +A +DAGA ++ GHHPHVLQ + Y G+I Sbjct 178 ---SHDHVVFIPHWGEERFRFPAPDQVAQGRAFIDAGASVVAGHHPHVLQGTETYHHGVI 234 Query 296 FYSLGNFVFDQGWTRTKDS 314 YSLGNF+ + + + DS Sbjct 235 TYSLGNFLSNPVYWQDGDS 253 >ref|YP_958922.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Marinobacter aquaeolei VT8] gb|ABM18735.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Marinobacter aquaeolei VT8] Length=368 Score = 115 bits (288), Expect = 5e-24, Method: Composition-based stats. Identities = 79/281 (28%), Positives = 132/281 (46%), Gaps = 38/281 (13%) Query 55 RENEKLTMTMVGDIMMGRH-------VKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFE-- 105 + N+ L ++ VGDI +G H ++ +R G + ++ + +D V GN E Sbjct 3 KANKNLKISAVGDISLGDHPVCVGHGMRSAFSRRGFS-ILEEMTECFEGADIVIGNLETV 61 Query 106 -HPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKA 164 V LE +K + + E ++ +K+ G L +ANNH +G DT+ Sbjct 62 TSDVGLESRKL-----ASFEMRGNPEHLRFLKQVGIDALGVANNHAMQHGEPAFWDTVSN 116 Query 165 FKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQ--------PG 216 +++ +D +G + V V + G D+ + E+ P Sbjct 117 IRKSGMDVIG----------LEASGSTNVHVISHGGLDSHLFNVSLRPEEWAEDKDSLPY 166 Query 217 SLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADII 276 S + LL ++ + + G ++ + HWG E+ + PS RQ +A+VDAG D++ Sbjct 167 SNRQDHKALLAEVERLRANCPG---FLICSIHWGLEFLDYPSTRQVEFGRALVDAGVDVV 223 Query 277 VGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWTRTKDSALV 317 GHH HV+Q + YK+G+IFYSLGNFVFD W+ + LV Sbjct 224 FGHHSHVVQPVERYKKGLIFYSLGNFVFDL-WSDSTKQTLV 263 >ref|ZP_01575958.1| poly-gamma-glutamate synthesis protein (capsule biosynthesis protein) [Clostridium cellulolyticum H10] gb|EAV69903.1| poly-gamma-glutamate synthesis protein (capsule biosynthesis protein) [Clostridium cellulolyticum H10] Length=422 Score = 115 bits (287), Expect = 7e-24, Method: Composition-based stats. Identities = 84/284 (29%), Positives = 141/284 (49%), Gaps = 25/284 (8%) Query 58 EKLTMTMVGDIMMGRHVKEIVNRYGT-----DYV--FRHVSPYLKNSDYVSGNFEHPVLL 110 + +T++ VGDIM+ H + + Y + D+ F HV PYL +SD NFE V Sbjct 75 QSVTISAVGDIML--HQGNLNSAYDSKSRKYDFTGFFEHVKPYLSSSDLTIANFE-TVTA 131 Query 111 EDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADL 170 Y+ ++ + + A+ +G +L+ ANNH D+G G TI+ +E ++ Sbjct 132 GTGIKYRSYPL---FNSPDSILPALSGSGIDILSTANNHCLDWGINGLTRTIQKIREYNM 188 Query 171 DYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVA--GAIATKEQPGSLSMNPDVLLKQ 228 +G+ N D + + V G+++A L ++ F ++++++ LS + ++ Sbjct 189 VNIGSSINGND--KYIIKEVKGIKIAILSYSQFFNGHEAKLSSRDKTKYLSTLNETQIQN 246 Query 229 ISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFD 288 KA K AD V+ HWG EY PS Q L+K ++ GADII+G HPHV+Q + Sbjct 247 DIKAVKGK--GADAVITVLHWGNEYHRSPSTYQTNLSKKILSWGADIILGSHPHVIQKSE 304 Query 289 VYKQG----IIFYSLGNFVFDQGWTRTKDSALVQYHLRDNGTAI 328 + K I YS+GNF+ G+ RT + + ++G I Sbjct 305 IVKSNGKNKFIIYSMGNFI--SGYRRTDKAKRMNKVFTEDGVII 346 >ref|YP_628409.1| Gene info CapA family protein [Myxococcus xanthus DK 1622] gb|ABF90603.1| Gene info CapA family protein [Myxococcus xanthus DK 1622] Length=440 Score = 114 bits (286), Expect = 9e-24, Method: Composition-based stats. Identities = 72/242 (29%), Positives = 113/242 (46%), Gaps = 17/242 (7%) Query 78 VNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKE 137 +N G D+VF ++ L+ +D N E PV N + + + +A V A+ Sbjct 57 LNHEGWDHVFGPIADVLRTADVGVVNLETPV----TDNTKAVARELLFNAPSAMVHALAS 112 Query 138 AGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVAT 197 AG V++ ANNH D G +T++ A + + G G + +V GV+V Sbjct 113 AGVKVVSTANNHARDQHPAGMLETLRHLDAAGIRHTGTGATKDAAWEPAFVDVRGVKVGF 172 Query 198 LGFTDAFVAGAIATKEQPGSLSMNP--------DVLLKQISKAKDPKKGNADLVVVNTHW 249 L FT + Q +++ P + +Q +A D ++V HW Sbjct 173 LSFTRMLNGFSNPKDAQAPHVALVPYSGHETHRGIQPEQAVEAVRAAAAQCDALIVLAHW 232 Query 250 GEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVY-----KQGIIFYSLGNFVF 304 G EY +P P L +A++DAGA ++GHHPHVLQ + Y ++G+I YSLGN V Sbjct 233 GTEYKGEPRPEDRELGRALLDAGARAVIGHHPHVLQPLESYQTVDGRKGLIAYSLGNLVA 292 Query 305 DQ 306 +Q Sbjct 293 NQ 294 >ref|ZP_01668594.1| putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Anaeromyxobacter sp. Fw109-5] gb|EAX52268.1| putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Anaeromyxobacter sp. Fw109-5] Length=474 Score = 114 bits (284), Expect = 1e-23, Method: Composition-based stats. Identities = 90/319 (28%), Positives = 146/319 (45%), Gaps = 40/319 (12%) Query 45 RTEAVAPVKHRENE-----KLTMTMVGDIMMGRHVKEIVNRYGT-------DYVFRHVSP 92 R VAP E + + T+ VGD++M VK+ +G +++ ++ Sbjct 48 RGGVVAPAAPAEEQVRTVAQATLGAVGDVLMHDAVKQSAATHGRGSADAGYSWLYAPLAD 107 Query 93 YLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTD 152 L D N E P+ + + +A E V A++ AG +++ ANNH+ D Sbjct 108 LLAAPDVTFANLETPI----APGTTQGTRPFVFNAPPEAVTALQRAGVDLVSFANNHVFD 163 Query 153 YGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATK 212 G G ++TI+ + YVGAG + + + + G+R+A LG+ F A Sbjct 164 QGRSGFEETIRRLDGLGMRYVGAGPSGRAAGPVTVE-AGGLRIAFLGYAHFFNQDGNACP 222 Query 213 EQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNT--HWGEEYDNKPSPRQEALAKAMVD 270 L + L + + +D ++ A V HWG+EY +P P LA + D Sbjct 223 TTKPCLQASQ---LDRKAAVEDVRRAAASADAVVVSLHWGDEYVTQPRPADVELAHQLAD 279 Query 271 AGADIIVGHHPHVLQSFDVYKQ-----GIIFYSLGNFVFDQ-----------GWTRTKDS 314 AGA +++GHHPHVLQ ++Y++ +I YSLGNFV +Q T+D Sbjct 280 AGALVVLGHHPHVLQPVELYRRADGRTALIAYSLGNFVSNQSRLYVPGVTPAAVAATRDG 339 Query 315 ALVQYHL--RDNGTAILDV 331 AL++ L RD G ++ V Sbjct 340 ALLRVTLARRDYGRGVVRV 358 >ref|ZP_01463805.1| capsule biosynthesis protein CapA [Stigmatella aurantiaca DW4/3-1] gb|EAU65444.1| capsule biosynthesis protein CapA [Stigmatella aurantiaca DW4/3-1] Length=439 Score = 113 bits (283), Expect = 2e-23, Method: Composition-based stats. Identities = 72/245 (29%), Positives = 121/245 (49%), Gaps = 23/245 (9%) Query 78 VNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKE 137 +N G D +F ++ L+ +D N E P+ N + + + +A +A+ Sbjct 59 LNHEGWDQLFGPIADVLRTADVAVVNLETPI----TDNPKAVTRELLFNAPPALAQALAA 114 Query 138 AGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVAT 197 AG +++ NNH D G +T++ A + +VG G + + V V G+R+ Sbjct 115 AGVRLVSTGNNHARDQHPTGMVETLQHLDAAGIRHVGTGASRGEAWEPVVMEVRGMRLGF 174 Query 198 LGFTDAFVAGAIATKEQPGSLSMNP----------DVLLKQISKAKDPKKGNADLVVVNT 247 + FT + + + +++ P LL+++ +A G D+++V Sbjct 175 VSFTRLLNGFSNPVRSELPHVALVPYERLGRPSGVAALLERVRQAA----GQCDVLIVLV 230 Query 248 HWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVY-----KQGIIFYSLGNF 302 HWG EY +P P ALA+A++DAGA +VGHHPHVLQ + Y ++G+I YSLGN Sbjct 231 HWGAEYTAQPLPEDAALARALIDAGAGAVVGHHPHVLQPLEAYTTKDGRRGLIAYSLGNL 290 Query 303 VFDQG 307 V +QG Sbjct 291 VANQG 295 >ref|YP_643269.1| Gene info poly-gamma-glutamate synthesis protein (capsule biosynthesis protein) [Rubrobacter xylanophilus DSM 9941] gb|ABG03457.1| Gene info poly-gamma-glutamate synthesis protein (capsule biosynthesis protein) [Rubrobacter xylanophilus DSM 9941] Length=327 Score = 113 bits (283), Expect = 2e-23, Method: Composition-based stats. Identities = 79/287 (27%), Positives = 128/287 (44%), Gaps = 15/287 (5%) Query 60 LTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKA 119 + + + GD+M+GR V E + + V+ V P L N E + + ++ + + Sbjct 2 VVLNLAGDVMLGRGVNEALAEMPPEEVWGDVLPLLLEGGVRIVNLECAIT-DHRRPWTRT 60 Query 120 DKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENF 179 K H A V+ + A ++LANNH D+ +G DTI + A + GAG + Sbjct 61 PKVFHFRADPRAVRVLTAARIDAVSLANNHTLDFEERGLLDTIAHLRSAGIACAGAGRDL 120 Query 180 KDVKNIVYQNVNGVRVATLGFTD---AFVAGAIATKEQPGS----LSMNPDVLLKQISKA 232 + G RVA + FTD F AG ++PG+ +S+ +VL + Sbjct 121 AEASRPAVVEGGGERVALVAFTDNEPPFAAGP----DRPGTNYLPVSLEGEVLERVEEAV 176 Query 233 KDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQ 292 + A VV + HWG +P A+A++D GAD+ GH HV Q +VY+ Sbjct 177 ARARAEGAGTVVFSNHWGPNMVERPPECFRRFARAVIDRGADVYYGHSAHVFQGVEVYRG 236 Query 293 GIIFYSLGNFVFDQG---WTRTKDSALVQYHLRDNGTAILDVVPLNI 336 I Y G+FV D R S L + + + G L++ P+ + Sbjct 237 RPILYDTGDFVDDYAVDPRLRNDRSFLFRVEVGEEGLRGLELFPVRL 283 >gb|AAQ74380.1| UniGene info poly-gamma-glutamate synthesis protein [Hydra magnipapillata] Length=369 Score = 113 bits (282), Expect = 3e-23, Method: Composition-based stats. Identities = 75/236 (31%), Positives = 118/236 (50%), Gaps = 22/236 (9%) Query 86 VFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQK-ADKNIHLSAKEETVKAVKEAGFTVLN 144 + ++V+ Y KN+D+ N E P +L+ +N +K IH A E+V+A+ AG + Sbjct 51 ILKYVAKYFKNADFNMINLEAPFVLKQNENLTFFPNKGIHNKAWPESVEALTSAGIKSVT 110 Query 145 LANNHMTDYGAKGTKDTIKAFKEADLDYVGA--GEN--FKDVKNIVYQNVNGVRVATLGF 200 LANNH++DYG T K +DYVG GE+ + K ++ + +NG++V LG+ Sbjct 111 LANNHISDYGGDSVDLTTKILFYNKIDYVGITYGESPPYSPQKPLI-KEINGIKVGFLGY 169 Query 201 T-------DAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEY 253 + F AG + ++ D L+Q+ K D++V HWG EY Sbjct 170 CGDETGECEMFRAGVKTSTALLRKQTVEYD--LQQL-------KSKVDIIVTFLHWGTEY 220 Query 254 DNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWT 309 P Q LA + G ++I+G HPHV+Q + ++ YSLGN VF +T Sbjct 221 FAIPKETQRNLAIYLSQLGVNLIIGSHPHVMQGHEWLNNTLVHYSLGNLVFHPHFT 276 >ref|YP_138651.1| Gene info hypothetical protein stu0110 [Streptococcus thermophilus LMG 18311] gb|AAV59836.1| Gene info conserved hypothetical protein [Streptococcus thermophilus LMG 18311] Length=393 Score = 112 bits (281), Expect = 3e-23, Method: Composition-based stats. Identities = 79/228 (34%), Positives = 122/228 (53%), Gaps = 17/228 (7%) Query 87 FRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLA 146 F +V P+LK +D V G+FE + +Y + + +A + + +AG+ V++LA Sbjct 72 FTYVKPWLKQADLVLGDFEGTI----NPDYPLSGYPL-FNAPQSVTAVISDAGYDVMDLA 126 Query 147 NNHMTDYGAKGTKDTIKAFKEADLDYVGAGEN-FKDVKNIVYQNVNGVRVATLGFTDAF- 204 +NH+ D G +G T AFKE +D VG EN D + +NVNG++VA L + F Sbjct 127 HNHILDSGLEGAFTTADAFKEVGIDPVGVYENPVHDKAPLFIKNVNGIKVAILSYAYGFN 186 Query 205 -VAGAIATKEQPGSLSMNPDVLLK-QISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQE 262 + + KE LS + +K +I +A+ AD+ V+ G EY +P+ Q Sbjct 187 GLESNLTEKEIANHLSNLDEKRMKVEIERAEK----EADVTVIMPQMGVEYRLEPTDEQV 242 Query 263 ALAKAMVDAGADIIVGHHPHVLQSFDVYK----QGIIFYSLGNFVFDQ 306 L M+D GADII G HPHV++ +V K Q +I YS+GNF+ +Q Sbjct 243 KLYHKMIDWGADIIFGGHPHVVEPSEVVKKDGQQKLIIYSMGNFISNQ 290 >ref|YP_723582.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Trichodesmium erythraeum IMS101] gb|ABG53109.1| Gene info Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Trichodesmium erythraeum IMS101] Length=588 Score = 112 bits (281), Expect = 3e-23, Method: Composition-based stats. Identities = 95/324 (29%), Positives = 152/324 (46%), Gaps = 41/324 (12%) Query 39 AATWVQRT-EAVAPVKHR-----ENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSP 92 + WV+ E V V+HR ++ +T+ GD+ + V +V R DY P Sbjct 160 SGQWVETAIEKVRVVEHRKVQNSQDPMVTLMFGGDVNLSNQVSNLVKR---DYKL----P 212 Query 93 YLKNSDYVSG-----NFEHPVL---LEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLN 144 + K ++Y + N E P+ L + QK+ N VKA+ G ++N Sbjct 213 FAKMNEYRAADLSIVNLESPLTRSTLNSRTQQQKSTVN------PSYVKALTSGGVDLVN 266 Query 145 LANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAF 204 LAN+H Y K +TI+ + A + +GAG+ ++ + V G ++A L + D Sbjct 267 LANDHTLGYEQKSLLETIETLENAGIHSLGAGKTEEEARRPKIFEVKGQKIAYLNYYDTD 326 Query 205 VAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEAL 264 + T E S N D L I K D ++VN HWG + P Q + Sbjct 327 IQ---PTTESVYVNSRNKDRLSSDIQILKK----QVDWIIVNYHWGVQLSEYPGDWQMNI 379 Query 265 AKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWTRTK----DSALVQYH 320 A+ +D GAD++VGHHP VLQ ++Y+ I YSLGNF+F G T K D+A+++ Sbjct 380 ARMTIDQGADLVVGHHPKVLQGAEIYRGRPIIYSLGNFIF--GDTSNKESDYDTAVLKVS 437 Query 321 LRDNGTAILDVVPLNIQEGSPKPV 344 L+ G ++ +P+ + + P V Sbjct 438 LKP-GKMKIEFLPVVVSKYQPHIV 460 >ref|NP_781225.1| Gene info encapsulation protein capA [Clostridium tetani E88] gb|AAO35162.1| Gene info encapsulation protein capA [Clostridium tetani E88] Length=383 Score = 112 bits (279), Expect = 5e-23, Method: Composition-based stats. Identities = 93/308 (30%), Positives = 145/308 (47%), Gaps = 41/308 (13%) Query 77 IVNRYGTD--YVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKA 134 I N+ G D Y F++V+ K D N E+ ++ KA K + A K Sbjct 96 IYNKNGQDPSYFFKNVANIFKEDDLTIVNLENNF----TESKDKAKKQFNFKAPPSYAKT 151 Query 135 VKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVR 194 + +++ NNH+ DY KG DTI + KE +++Y G G FK +K V GV+ Sbjct 152 LPAGYIDGVDIGNNHIYDYKQKGFDDTINSLKENNINYFGEG--FKWIKE-----VKGVK 204 Query 195 VATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYD 254 + LG+ + P+ + ++ K+ K + V+V+ HWG E Sbjct 205 LGFLGYR---------------GFNDYPEFRTQIENEIKELKNKGCNAVLVSFHWGLESQ 249 Query 255 NKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWT-RTKD 313 P Q+ LA +D GAD+I+GHHPHVLQS + YK II YSLGNF F + + KD Sbjct 250 YYPIKTQKDLAYYAIDKGADLIIGHHPHVLQSIEKYKNAIICYSLGNFCFGGNFNPKDKD 309 Query 314 SALVQ----YHLRDNGTAILDVVPLNIQEGS------PKPVTSALDKNRVYRQLTKDTSK 363 + + Q + R+ + ++P I + P P+ +K+RV +++ KD S Sbjct 310 TMIFQIKYNFKNREIENYEVKIIPCRISSVTYMNDYCPTPLQGD-EKDRVLKKI-KDLSP 367 Query 364 GALWSKKD 371 A + D Sbjct 368 KAYFEISD 375 >ref|NP_842273.1| Gene info possible poly-gamma-glutamate synthesis protein [UI:99417512] [Nitrosomonas europaea ATCC 19718] emb|CAD86183.1| Gene info possible poly-gamma-glutamate synthesis protein [UI:99417512] [Nitrosomonas europaea ATCC 19718] Length=381 Score = 112 bits (279), Expect = 6e-23, Method: Composition-based stats. Identities = 75/251 (29%), Positives = 119/251 (47%), Gaps = 22/251 (8%) Query 60 LTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKA 119 +++ GD R + IV G+ + + + +K +D+ N E P+ Sbjct 2 ISLIFCGDYAPCRRFEAIVLERGSA-ILGNAAIEIKTADFSFVNLECPL----------T 50 Query 120 DKNIHLSAKEETVKAVKE-----AGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVG 174 D + ++ ++A + A FTV LANNH DYG +G DTI A + + VG Sbjct 51 DHQVAINKSGPALRAGPQCASGIADFTVAGLANNHSLDYGVQGLIDTITACRSVGVSTVG 110 Query 175 AGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKD 234 AG N + + I V G ++A + + + PGS ++P QI +A+ Sbjct 111 AGINLAEAQKIHISKVKGKKLAVIAVAEHEFNQS--ENNGPGSAPLDPVDNYYQIREAQ- 167 Query 235 PKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGI 294 AD+V+V H G E+ + P P L K +D G + ++ HHPHV ++++Y Sbjct 168 ---AKADIVIVTIHGGNEHFHYPRPGLRKLCKHYIDLGVNAVICHHPHVPGAYEIYNGRP 224 Query 295 IFYSLGNFVFD 305 I YSLGNFVFD Sbjct 225 IVYSLGNFVFD 235 >ref|YP_710372.1| Gene info hypothetical protein; putative signal peptide [Frankia alni ACN14a] emb|CAJ58755.1| Gene info hypothetical protein; putative signal peptide [Frankia alni ACN14a] Length=405 Score = 110 bits (275), Expect = 1e-22, Method: Composition-based stats. Identities = 84/264 (31%), Positives = 118/264 (44%), Gaps = 17/264 (6%) Query 90 VSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNH 149 +S L +D N E V A K A AV+ AG V+ +ANNH Sbjct 126 ISATLSAADLAVANLETAV----TDGGTPAPKEFTFRAPPTAFDAVRAAGIDVVTMANNH 181 Query 150 MTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFT----DAFV 205 DYG G +D+++ + A +G GE+ V G R+A +G T D V Sbjct 182 GMDYGLAGLQDSLRNARNAHFPVIGIGEDDTSAFTPYTTTVKGQRIAVIGATQVLDDQLV 241 Query 206 AGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALA 265 A +PG S + ++ A + AD VVV HWG E PS Q +L Sbjct 242 PAWTAGPHKPGLASAKE---VDKLVAAVRAARARADTVVVFLHWGVEQQQCPSDAQRSLV 298 Query 266 KAMVDAGADIIVGHHPHVLQSFDVYKQGI-IFYSLGNFVF-DQGWTRTKDSALVQYHLRD 323 + AGAD++VG H HVL G+ + Y LGNFVF G R +S +++ L Sbjct 299 PRLTAAGADVVVGSHAHVLLGAGWTSDGVYVDYGLGNFVFYSSGTGRNTESGVLR--LTV 356 Query 324 NGTAILDV--VPLNIQEGSPKPVT 345 G A+ D VP I G+P+P++ Sbjct 357 AGRAVTDATWVPARIVGGAPRPLS 380 >ref|YP_300440.1| Gene info poly-gamma-glutamate synthesis protein PgsA [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] dbj|BAE17495.1| Gene info poly-gamma-glutamate synthesis protein PgsA [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] Length=356 Score = 110 bits (275), Expect = 2e-22, Method: Composition-based stats. Identities = 90/317 (28%), Positives = 156/317 (49%), Gaps = 23/317 (7%) Query 3 RKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKLTM 62 +K + +E++L + K+ KK+N Y I+ + ++L+ A Q+ E V + NE ++M Sbjct 5 KKFSMEERILKWTKRHKKRNSIYTGIIFVVALILLVFAMTSQKIEPVKAIGKAPNE-ISM 63 Query 63 TMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKN 122 T +G+I + H++ + + F + LK SDY + + E +D+K Sbjct 64 TYLGNIELNNHIR----KNNLNDAFASIKEILKGSDYSTASLEMTKFSDDRKT------- 112 Query 123 IHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYV-GAGENFKD 181 ++S E V +K LN+ N + A+ +++A + +Y+ G G N + Sbjct 113 -NISKNLENVLFLKGLNLKSLNVINQVTDNITARDFMKSVEA--QTGYNYLTGNGSNPIN 169 Query 182 VKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNAD 241 K V Q + G ++A + FTD + T + S+S+ P + + I K K+ N D Sbjct 170 SKT-VQQTIKGKKIANVSFTDV-ESNYTDTLKNTTSVSLEPSIYMPLIKKLKE----NND 223 Query 242 LVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGN 301 VVVN WG + + RQ A ++ +AGAD+I+GH+ V+Q + YK IFYSLGN Sbjct 224 YVVVNVDWGITDERSVTTRQREYAHSLSEAGADVIIGHNS-VVQEIEKYKNTDIFYSLGN 282 Query 302 FVFDQGWTRTKDSALVQ 318 + ++ K VQ Sbjct 283 TTSEDFLSKNKQGLAVQ 299 >ref|YP_479183.1| Gene info poly-gamma-glutamate biosynthesis protein [Frankia sp. CcI3] gb|ABD09454.1| Gene info poly-gamma-glutamate biosynthesis protein [Frankia sp. CcI3] Length=405 Score = 110 bits (274), Expect = 2e-22, Method: Composition-based stats. Identities = 76/235 (32%), Positives = 109/235 (46%), Gaps = 9/235 (3%) Query 119 ADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGEN 178 A K A AV+ AG V+ +ANNH DYG +G +D+++ +EA VG G + Sbjct 151 AQKAYVFRASPTAFTAVRAAGIDVVTMANNHGMDYGIEGLQDSLRYAREAHFPLVGIGVD 210 Query 179 FKDVKNIVYQNVNGVRVATLGFT----DAFVAGAIATKEQPGSLSMNPDVLLKQISKAKD 234 V G R+A LG T D +A A +PG S + ++ +A Sbjct 211 DTAAYAPYTTTVKGQRIAVLGATQVLDDELIAAWTAGPHKPGLASAKE---VDRLVRAVR 267 Query 235 PKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGI 294 + AD V+V HWG E P+ Q AL + AGAD+++G H HVL G+ Sbjct 268 AVRAAADTVIVFLHWGTEQQQCPNEAQRALLPRLAAAGADVVIGSHAHVLLGAGWNSDGV 327 Query 295 -IFYSLGNFVF-DQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTSA 347 + Y LGNFVF G R +S +++ + +P I G P+PVT A Sbjct 328 YVGYGLGNFVFYSSGAGRNTESGVLELTVAGRAVTAAAWLPARIVGGIPQPVTGA 382 >ref|NP_469859.1| Gene info hypothetical protein lin0516 [Listeria innocua Clip11262] emb|CAC95748.1| Gene info lin0516 [Listeria innocua] Length=475 Score = 109 bits (273), Expect = 3e-22, Method: Composition-based stats. Identities = 84/274 (30%), Positives = 122/274 (44%), Gaps = 37/274 (13%) Query 42 WVQRTEAVAPVKHRENEKLTMTMVGDIMMGRHVKEIVN---------RYGTD-YVFRHVS 91 W A +EN +T+TMVGD G + + N GT+ YVF++ Sbjct 143 WFYAAAAANEQGLKENGVVTLTMVGDNSFGTYPETPENLKFDNVFKKNNGTNTYVFKNCL 202 Query 92 PYLKNSDYVSGNFEHPVLLEDKKNYQKAD-KNIHLSAKEETVKAVKEAGFTVLNLANNHM 150 P+ K+ D+ N E N KA+ K + + V + +G NLANNH Sbjct 203 PWFKSDDFTVINAESAF-----TNATKAENKKWRIKSDPAHVAFLPASGVDAANLANNHT 257 Query 151 TDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIA 210 DY G DT+KAFK+ ++ + + + G++ LG+ Sbjct 258 KDYFQVGYDDTLKAFKDNNIPVFNSDAPLE-------TTIKGMKTVMLGYD--------- 301 Query 211 TKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVD 270 +S L++I K K LV+VN HWG EY P+ Q A++D Sbjct 302 -----CRMSQQSPAYLERIVKDVKKYKKEDTLVIVNMHWGVEYRETPTNYQTQFGHAILD 356 Query 271 AGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVF 304 AGADII+G HPH L+S + YK I YS+G+F F Sbjct 357 AGADIIMGAHPHRLESIEKYKDKYIVYSMGDFAF 390 >ref|YP_288205.1| Gene info hypothetical protein Tfu_0144 [Thermobifida fusca YX] gb|AAZ54182.1| Gene info conserved hypothetical protein [Thermobifida fusca YX] Length=378 Score = 108 bits (271), Expect = 5e-22, Method: Composition-based stats. Identities = 71/225 (31%), Positives = 106/225 (47%), Gaps = 5/225 (2%) Query 121 KNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFK 180 K A A+KEAG V +ANNH DYG +G DT++ + AD +GAG + Sbjct 118 KQFVFRAPATAFTALKEAGIDVATVANNHGMDYGTEGLLDTLENAEAADFPIIGAGRDIA 177 Query 181 DVKNIVYQNVNGVRVATLGFTDAF----VAGAIATKEQPGSLSMNPDVLLKQISKAKDPK 236 + + V G +A +G TD + A + +PG S +++ I A + Sbjct 178 EAYEPEFFEVKGNTLAIIGATDVLDDHLIPEWTAGEGKPGLASTKGEMITHAID-AVEKA 236 Query 237 KGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIF 296 AD V+V HWG E D+ P P LAK ++DAGA +VG H HV+ + Sbjct 237 SAEADAVIVFLHWGLEGDHCPLPHAPDLAKQLIDAGATAVVGGHAHVVSPGGYMGSSYVH 296 Query 297 YSLGNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSP 341 Y LGNFVF T ++ +++ L+ + +P I+ G P Sbjct 297 YGLGNFVFYNFNGPTAETGVLRLTLQGGEILEDEWLPGRIEGGVP 341 >ref|YP_464763.1| Gene info putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Anaeromyxobacter dehalogenans 2CP-C] gb|ABC81326.1| Gene info putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Anaeromyxobacter dehalogenans 2CP-C] Length=466 Score = 108 bits (271), Expect = 5e-22, Method: Composition-based stats. Identities = 90/315 (28%), Positives = 145/315 (46%), Gaps = 33/315 (10%) Query 45 RTEAVAPVKH---RENEKLTMTMVGDIMMGRHVKEIVNRY-------GTDYVFRHVSPYL 94 R A+AP R +LT+ VGD++M VK G ++F V+ L Sbjct 34 RAVALAPKVEPPVRSEARLTLAAVGDVLMHDAVKRAAEARRADAPDGGYAWLFAPVADLL 93 Query 95 KNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYG 154 +D N E P+ + + +A + A++ AG ++++ANNH D G Sbjct 94 GAADLTFANLETPI----APQASQGSRAFVFNAPPAVIAALQRAGVDLVSVANNHAMDQG 149 Query 155 AKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQ 214 +G ++T++ + A L YVGAG + + + NG+ +A LG+T Sbjct 150 RRGFEETLRWLRAAGLPYVGAGPAPRAAGPVRLER-NGLSLAFLGYTYGLNQDGNTCPPA 208 Query 215 PGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGAD 274 + ++ ++ +A AD VVV+ HWG EY P + LA + DAGA Sbjct 209 AAACEQVAELDRARMVEAVRAAAAAADAVVVSVHWGVEYQQAPRADEVELAHRLADAGAL 268 Query 275 IIVGHHPHVLQSFDVYKQ-----GIIFYSLGNFVFDQGWTRT-----------KDSALVQ 318 +++GHHPHVLQ ++Y++ +I YSLGNFV +Q +D AL++ Sbjct 269 VVLGHHPHVLQPVELYRRADGRTAVIAYSLGNFVSNQSRNYVAGVTPDAVAAPRDGALLR 328 Query 319 YHL--RDNGTAILDV 331 L RD G + +V Sbjct 329 VSLARRDYGRGVEEV 343 >ref|NP_464044.1| Gene info hypothetical protein lmo0516 [Listeria monocytogenes EGD-e] emb|CAC98595.1| Gene info lmo0516 [Listeria monocytogenes] Length=476 Score = 108 bits (270), Expect = 6e-22, Method: Composition-based stats. Identities = 92/318 (28%), Positives = 133/318 (41%), Gaps = 40/318 (12%) Query 42 WVQRTEAVAPVKHRENEKLTMTMVGDIMMG------RHVKE----IVNRYGTDYVFRHVS 91 W A +E +T+TMVGD G H+K N YV+++ Sbjct 144 WFYAAAATNQQGLKEKGVVTLTMVGDNSFGTYPETPEHLKFDNVFQKNNGNNTYVYKNCL 203 Query 92 PYLKNSDYVSGNFEHPVLLEDKKNYQKADKNI-HLSAKEETVKAVKEAGFTVLNLANNHM 150 P+ K+ DY N E N KA+ + + + V + +G NLANNH Sbjct 204 PWFKSDDYTIINAESAF-----TNATKAENKMWRIKSDPAHVAFLPASGVDAANLANNHT 258 Query 151 TDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIA 210 DY G DT+KAFKE ++ A + + G++ LG+ Sbjct 259 MDYFQVGYDDTLKAFKENNIPVFNADAPLE-------TTIKGMKTVLLGYD--------- 302 Query 211 TKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVD 270 +S L++I K K LV+VN HWG EY P+ Q A++D Sbjct 303 -----CRMSQQSPAYLERIVKDVKKYKKEDTLVIVNMHWGVEYRETPTDYQTQFGHAILD 357 Query 271 AGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWT---RTKDSALVQYHLRDNGTA 327 AGADII+G HPH L+S + YK I YS+G+F F T R +++ DN Sbjct 358 AGADIIMGSHPHRLESVEKYKDKYIVYSMGDFAFGADPTLLSRMTSMFQLRFTKEDNKIV 417 Query 328 ILDVVPLNIQEGSPKPVT 345 + D+ + E S T Sbjct 418 LKDISIVPTYENSDGSTT 435 >ref|ZP_00230916.1| capA domain protein [Listeria monocytogenes str. 4b H7858] gb|EAL09270.1| capA domain protein [Listeria monocytogenes str. 4b H7858] Length=476 Score = 108 bits (269), Expect = 9e-22, Method: Composition-based stats. Identities = 92/318 (28%), Positives = 132/318 (41%), Gaps = 40/318 (12%) Query 42 WVQRTEAVAPVKHRENEKLTMTMVGDIMMG------RHVKE----IVNRYGTDYVFRHVS 91 W A +E +T+TMVGD G H+K N YV+++ Sbjct 144 WFYAAAATNQQGLKEKGVVTLTMVGDNSFGTYPETPEHLKFDNVFQKNNGNNTYVYKNCL 203 Query 92 PYLKNSDYVSGNFEHPVLLEDKKNYQKAD-KNIHLSAKEETVKAVKEAGFTVLNLANNHM 150 P+ K+ DY N E N KA+ K + + V + +G NLANNH Sbjct 204 PWFKSDDYTVINAESAF-----TNATKAENKKWRIKSDPAHVAFLPASGVEAANLANNHT 258 Query 151 TDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIA 210 DY G DT+KAFKE ++ + + G++ LG+ Sbjct 259 MDYFQVGYDDTLKAFKENNIPVFNTDAPLE-------TTIKGMKTVLLGYD--------- 302 Query 211 TKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVD 270 +S L++I K K LV+VN HWG EY P+ Q A++D Sbjct 303 -----CRMSQQSPAYLERIVKDVKKYKKENTLVIVNMHWGVEYRETPTDYQSQFGHAILD 357 Query 271 AGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWT---RTKDSALVQYHLRDNGTA 327 AGADII+G HPH L+S + YK I YS+G+F F T R +++ DN Sbjct 358 AGADIIMGSHPHRLESVEKYKDKYIVYSMGDFAFGADPTLLSRMTSMFQLRFTKEDNKIV 417 Query 328 ILDVVPLNIQEGSPKPVT 345 + D+ + E S T Sbjct 418 LKDISIVPTYENSDGSTT 435 >ref|YP_013150.1| Gene info capA domain protein [Listeria monocytogenes str. 4b F2365] gb|AAT03327.1| Gene info capA domain protein [Listeria monocytogenes str. 4b F2365] gb|EBA29842.1| hypothetical protein LMHG_01952 [Listeria monocytogenes FSL N1-017] gb|EBA37986.1| hypothetical protein LMSG_02514 [Listeria monocytogenes HPB2262] Length=476 Score = 107 bits (268), Expect = 1e-21, Method: Composition-based stats. Identities = 84/274 (30%), Positives = 118/274 (43%), Gaps = 37/274 (13%) Query 42 WVQRTEAVAPVKHRENEKLTMTMVGDIMMG------RHVKE----IVNRYGTDYVFRHVS 91 W A +E +T+TMVGD G H+K N YV+++ Sbjct 144 WFYAAAATNQQGLKEKGVVTLTMVGDNSFGTYPETPEHLKFDNVFQKNNGNNTYVYKNCL 203 Query 92 PYLKNSDYVSGNFEHPVLLEDKKNYQKAD-KNIHLSAKEETVKAVKEAGFTVLNLANNHM 150 P+ K+ DY N E N KA+ K + + V + +G NLANNH Sbjct 204 PWFKSDDYTVINAESAF-----TNATKAENKKWRIKSDPAHVAFLPASGVEAANLANNHT 258 Query 151 TDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIA 210 DY G DT+KAFKE ++ + + G++ LG+ Sbjct 259 MDYFQVGYDDTLKAFKENNIPVFNTDAPLE-------TTIKGMKTVLLGYD--------- 302 Query 211 TKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVD 270 +S L++I K K LV+VN HWG EY P+ Q A++D Sbjct 303 -----CRMSQQSPAYLERIVKDVKKYKKENTLVIVNMHWGVEYRETPTDYQTQFGHAILD 357 Query 271 AGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVF 304 AGADII+G HPH L+S + YK I YS+G+F F Sbjct 358 AGADIIMGSHPHRLESVEKYKDKYIVYSMGDFAF 391 >ref|ZP_00232357.1| capA domain protein [Listeria monocytogenes str. 1/2a F6854] gb|EAL07800.1| capA domain protein [Listeria monocytogenes str. 1/2a F6854] gb|EBA19112.1| hypothetical protein LMOG_02639 [Listeria monocytogenes J0161] Length=476 Score = 107 bits (267), Expect = 1e-21, Method: Composition-based stats. Identities = 92/318 (28%), Positives = 132/318 (41%), Gaps = 40/318 (12%) Query 42 WVQRTEAVAPVKHRENEKLTMTMVGDIMMG------RHVKE----IVNRYGTDYVFRHVS 91 W A +E +T+TMVGD G H+K N YV+++ Sbjct 144 WFYAAAATNQQGLKEKGVVTLTMVGDNSFGTYPETPEHLKFDNVFQKNNGNNTYVYKNCL 203 Query 92 PYLKNSDYVSGNFEHPVLLEDKKNYQKAD-KNIHLSAKEETVKAVKEAGFTVLNLANNHM 150 P+ K+ DY N E N KA+ K + + V + +G NLANNH Sbjct 204 PWFKSDDYTIINAESAF-----TNATKAENKKWRIKSDPAHVAFLPASGVEAANLANNHT 258 Query 151 TDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIA 210 DY G DT+KAFKE ++ + + G++ LG+ Sbjct 259 MDYFQVGYDDTLKAFKENNIPVFNTDAPLE-------TTIKGMKTVLLGYD--------- 302 Query 211 TKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVD 270 +S L++I K K LV+VN HWG EY P+ Q A++D Sbjct 303 -----CRMSQQSPAYLERIVKDVKKYKKEDTLVIVNMHWGVEYRETPTDYQTQFGHAILD 357 Query 271 AGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWT---RTKDSALVQYHLRDNGTA 327 AGADII+G HPH L+S + YK I YS+G+F F T R +++ DN Sbjct 358 AGADIIMGSHPHRLESVEKYKDKYIVYSMGDFAFGADPTLLSRMTSMFQLRFTKEDNKIV 417 Query 328 ILDVVPLNIQEGSPKPVT 345 + D+ + E S T Sbjct 418 LKDISIVPTYENSDGSTT 435 >gb|EBA24133.1| hypothetical protein LMRG_00197 [Listeria monocytogenes 10403S] Length=476 Score = 107 bits (267), Expect = 1e-21, Method: Composition-based stats. Identities = 84/274 (30%), Positives = 118/274 (43%), Gaps = 37/274 (13%) Query 42 WVQRTEAVAPVKHRENEKLTMTMVGDIMMG------RHVKE----IVNRYGTDYVFRHVS 91 W A +E +T+TMVGD G H+K N YV+++ Sbjct 144 WFYAAAATNQQGLKEKGVVTLTMVGDNSFGTYPETPEHLKFDNVFQKNNGNNTYVYKNCL 203 Query 92 PYLKNSDYVSGNFEHPVLLEDKKNYQKAD-KNIHLSAKEETVKAVKEAGFTVLNLANNHM 150 P+ K+ DY N E N KA+ K + + V + +G NLANNH Sbjct 204 PWFKSDDYTVINAESAF-----TNATKAENKKWRIKSDPAHVAFLPASGVEAANLANNHT 258 Query 151 TDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIA 210 DY G DT+KAFKE ++ + + G++ LG+ Sbjct 259 MDYFQVGYDDTLKAFKENNIPVFNTDAPLE-------TTIKGMKTVLLGYD--------- 302 Query 211 TKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVD 270 +S L++I K K LV+VN HWG EY P+ Q A++D Sbjct 303 -----CRMSQQSPAYLERIVKDVKKYKKEDTLVIVNMHWGVEYRETPTDYQTQFGHAILD 357 Query 271 AGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVF 304 AGADII+G HPH L+S + YK I YS+G+F F Sbjct 358 AGADIIMGSHPHRLESVEKYKDKYIVYSMGDFAF 391 >ref|ZP_01649421.1| Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Salinispora arenicola CNS205] gb|EAX26635.1| Putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)-like [Salinispora arenicola CNS205] Length=372 Score = 107 bits (266), Expect = 2e-21, Method: Composition-based stats. Identities = 88/352 (25%), Positives = 151/352 (42%), Gaps = 63/352 (17%) Query 57 NEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNY 116 N + + GD+++ R +FR+V L +D G E D+ + Sbjct 4 NRGIVVAATGDLLIARDRPH--------DIFRYVRDLLTEADITFGQLE--TAYSDQGSL 53 Query 117 QKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAG 176 + + E + A+ AGF V+++A+NH D+GA D I+ + + VGAG Sbjct 54 GSSGPRGGVPHDVENLVAIPHAGFDVISMASNHTGDWGADALLDCIERCRRHGITVVGAG 113 Query 177 ENFKDVKNIVYQNVNGVRVATLGFT----DAFVAG----AIATK-----------EQPGS 217 + + + +G RV L + D + AG +A +QPG Sbjct 114 ADIAEARRPGIIERDGTRVGFLAYCSVAPDGYYAGPGKHGVAPMRARTHYEPFEYDQPGG 173 Query 218 ---LSMNPDVL-LKQISKAKDPKKGNADLVVVNTHWGEEYD-NKPSPRQEALAKAMVDAG 272 + +PD L + D + D+++V+ HWG + + + Q +A A +DAG Sbjct 174 PPLVRTSPDESDLAALVADVDELRDQVDVLIVSFHWGLHFQPARLADYQPVVAHAAIDAG 233 Query 273 ADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFD------QGWTR---------------- 310 AD ++GHHPH+L+ +VY+ +IFYSLGNF + Q +++ Sbjct 234 ADAVIGHHPHILKPVEVYRGKVIFYSLGNFALEINERWWQSYSKEWFEKANEFHQERSPH 293 Query 311 ------TKDSALVQYHLRDNGTAILDVVPLNIQEG-SPKPVTSALDKNRVYR 355 ++SA+V+ H+ D + +VP+ I E P P + R R Sbjct 294 RDLKEEARNSAIVRLHIVDGRIDRVGIVPVVINEAHEPVPHRADTTDGRAVR 345 >ref|NP_969633.1| Gene info putative capsule biosynthesis protein [Bdellovibrio bacteriovorus HD100] emb|CAE80626.1| Gene info putative capsule biosynthesis protein [Bdellovibrio bacteriovorus HD100] Length=384 Score = 106 bits (265), Expect = 2e-21, Method: Composition-based stats. Identities = 83/287 (28%), Positives = 137/287 (47%), Gaps = 33/287 (11%) Query 58 EKLTMTMVGDIMMGRHV-KEIVNRYGTDY---VFRHVSPYLKNSDYVSGNFEHPVLLE-D 112 E++ ++ VGDI++ + + +VN GT + ++R P + + + GN E P L D Sbjct 41 ERIGLSFVGDILVHEALYRAVVN--GTQHFNQIWRRTDPLMSKAHFSVGNLEGPAALGVD 98 Query 113 KKNYQKAD------------KNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKD 160 K+ D N + + + +G+ +L +ANNH D G Sbjct 99 KRGKDHGDVGFIYDEVVYSGSNFSFNYHPRILSDLYRSGYDLLTVANNHSLDRSWLGIDK 158 Query 161 TIKAFKEADLDYVG---AGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGS 217 TI+A + + VG + E +I ++ G RVA LG T+ G +K+Q Sbjct 159 TIRAARNVGIPTVGIRMSSERSGAFHHIA--SIGGFRVAFLGCTE-MSNGHKDSKDQVLF 215 Query 218 LSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIV 277 NPD +++ I + D +++ HWG+EY + P RQ+A A+ ++AG I+ Sbjct 216 CYKNPDKMVELIKNIT--SDSSVDALILLPHWGQEYKHSPDSRQKAFARRYLEAGVTAIL 273 Query 278 GHHPHVLQSFDVY-----KQGIIFYSLGNFVFDQGWTRTKDSALVQY 319 G HPHVLQ ++ Y ++ ++ YSLGNFV Q K + LV Y Sbjct 274 GSHPHVLQPWEKYVTKDGRETLVAYSLGNFVAGQAGLARK-TGLVVY 319 >ref|NP_721253.1| Gene info hypothetical protein SMU.843 [Streptococcus mutans UA159] gb|AAN58559.1|AE014926_2 Gene info conserved hypothetical protein [Streptococcus mutans UA159] Length=393 Score = 106 bits (265), Expect = 3e-21, Method: Composition-based stats. Identities = 69/239 (28%), Positives = 125/239 (52%), Gaps = 14/239 (5%) Query 81 YGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGF 140 Y D F +V ++ ++D G+FE + +Y A + +A E +++K+ G+ Sbjct 72 YDFDPYFEYVKSWISSADLAIGDFEGTI----SPDYPLAGYPL-FNAPTEAAQSMKDTGY 126 Query 141 TVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGF 200 V++LA+NH+ D G +T+K F + LD +G + + ++ + + VNG+++A LG+ Sbjct 127 DVVDLAHNHILDSQLSGALNTVKTFNDLGLDTIGIYKEDRAKESFLIKKVNGIKIAILGY 186 Query 201 TDAF--VAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPS 258 + + + +EQ LS + +K K+ + K AD+ +V G EY +P+ Sbjct 187 AYGYNGMESNLTEEEQAAHLSNLDEKKIKAELKSAEKK---ADVTIVMPQMGTEYALEPT 243 Query 259 PRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQG----IIFYSLGNFVFDQGWTRTKD 313 Q+ L M+ GAD+I G HPHV + +V KQ I YS+GNF+ +Q + ++ Sbjct 244 EEQKTLYHKMIKWGADVIFGGHPHVAEPSEVVKQDGQKKFIIYSMGNFISNQSYENLQN 302 >gb|EBA32775.1| hypothetical protein LMIG_02687 [Listeria monocytogenes FSL N3-165] Length=476 Score = 106 bits (264), Expect = 3e-21, Method: Composition-based stats. Identities = 91/318 (28%), Positives = 131/318 (41%), Gaps = 40/318 (12%) Query 42 WVQRTEAVAPVKHRENEKLTMTMVGDIMMG------RHVKE----IVNRYGTDYVFRHVS 91 W A +E +T+TMVGD G H+K N YV+ + Sbjct 144 WFYAAAATNQQGLKEKGVVTLTMVGDNSFGTYPETPEHLKFDNVFQKNNGNNTYVYNNCL 203 Query 92 PYLKNSDYVSGNFEHPVLLEDKKNYQKADKNI-HLSAKEETVKAVKEAGFTVLNLANNHM 150 P+ K+ DY N E N KA+ + + + V + +G NLANNH Sbjct 204 PWFKSDDYTVINAESAF-----TNATKAENKMWRIKSDPAHVAFLPASGVDAANLANNHT 258 Query 151 TDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIA 210 DY G DT+KAFKE ++ + + G++ LG+ Sbjct 259 MDYFQVGYDDTLKAFKENNIPVFNTDAPLE-------TTIKGMKTVLLGYD--------- 302 Query 211 TKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVD 270 +S L++I K K LV+VN HWG EY P+ Q A++D Sbjct 303 -----CRMSQQSPAYLERIVKDVKKYKKEDTLVIVNMHWGVEYRETPTDYQTQFGHAILD 357 Query 271 AGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWT---RTKDSALVQYHLRDNGTA 327 AGADII+G HPH L+S + YK I YS+G+F F T R +++ DN Sbjct 358 AGADIIMGSHPHRLESVEKYKDKYIVYSMGDFAFGADPTLLSRMTSMFQLRFTKEDNKIV 417 Query 328 ILDVVPLNIQEGSPKPVT 345 + D+ + E S T Sbjct 418 LKDISIVPTYENSDGSTT 435 >ref|NP_969818.1| Gene info capsule biosynthesis protein capA [Bdellovibrio bacteriovorus HD100] emb|CAE80811.1| Gene info capsule biosynthesis protein capA [Bdellovibrio bacteriovorus HD100] Length=370 Score = 106 bits (264), Expect = 3e-21, Method: Composition-based stats. Identities = 83/285 (29%), Positives = 134/285 (47%), Gaps = 29/285 (10%) Query 60 LTMTMVGDIMMGRHV-KEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLE-DKKNYQ 117 + + GDI++ + K I+ + ++ P +DY++ N E P + DK Sbjct 31 VVLGFAGDILVHDALYKNILPKQNFTSLWSKAIPLFNKADYMTVNLEGPAAVGIDKAGRD 90 Query 118 KADK------------NIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAF 165 D+ N + + ++ +K + +++ ANNH D +G TI+A Sbjct 91 VGDQGFTYDLNVYSGTNFSFNFHPQILRDLKSSNIDLISTANNHSLDRQWRGVDRTIEAA 150 Query 166 KEADLDYVGAGENFKDVKNIVY-QNVNGVRVATLGFTDAFVAGAIATKEQPGSL---SMN 221 K L VG ++ ++ + +V G R+A + T+A G TK Q S S Sbjct 151 KNIGLSTVGTRPSYAPNESFYHLADVRGYRMAFVACTEA-TNGIADTKSQVLSCYGKSQQ 209 Query 222 PDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHP 281 + L++Q+ +G+ D V+V HWG EY +KP Q A AK ++AGA +VG HP Sbjct 210 VETLIRQLRA-----RGDVDGVIVLPHWGVEYSHKPDKSQTAYAKRFLEAGAVAVVGSHP 264 Query 282 HVLQSFDVYKQG-----IIFYSLGNFVFDQGWTRTKDSALVQYHL 321 HVLQ ++ Y+ +I YSLGNF+ Q K A+V HL Sbjct 265 HVLQPWESYRTSDGRLTMIVYSLGNFLAFQAGVEKKTGAVVYLHL 309 >ref|NP_269033.1| Gene info hypothetical protein SPy0818 [Streptococcus pyogenes M1 GAS] ref|YP_281995.1| Gene info capsule biosynthesis protein [Streptococcus pyogenes MGAS5005] gb|AAK33754.1| Gene info hypothetical protein SPy_0818 [Streptococcus pyogenes M1 GAS] gb|AAZ51250.1| Gene info capsule biosynthesis protein [Streptococcus pyogenes MGAS5005] Length=430 Score = 105 bits (263), Expect = 4e-21, Method: Composition-based stats. Identities = 91/338 (26%), Positives = 159/338 (47%), Gaps = 23/338 (6%) Query 11 LLIFIKKTKKKNPRYVAIVLPLIAVILIAATW-VQRTEAVAPVKHRENEKLTMTMV-GDI 68 +LI + KK VA+++ L+ LI VQ+ E A + K + GDI Sbjct 33 VLIKTMQYKKTMATVVALIVALLLFGLIYDLLGVQKNELAAQKSAQPKVKTARVVANGDI 92 Query 69 MMG----RHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIH 124 ++ ++ + Y F +V ++ +D G++E + +Y A + Sbjct 93 LIHDILYMSARKADDTYDFTPYFEYVKDWISGADLAIGDYEGTI----SPDYPLAGYPL- 147 Query 125 LSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKN 184 +A EE A+K G+ V++LA+NH+ D G +T K F + +D +G + + ++ Sbjct 148 FNAPEEIAGALKNTGYDVVDLAHNHILDSQLDGALNTKKVFHQLGIDSIGIYDKDRSKES 207 Query 185 IVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVV 244 + +NVNG+++A LG++ + G AT Q D+ +I K + AD+ + Sbjct 208 FLIKNVNGIKIAILGYSYGY-NGMEATLSQEDYEKHMSDLDEAKIKKELQLAEKKADVTI 266 Query 245 VNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQG----IIFYSLG 300 V G EY +P+ Q+ L M+D GAD+++G HPHV++ + +G I YS+G Sbjct 267 VMPQMGTEYALEPTAEQKELYHKMIDWGADVVLGGHPHVIEPSETVIKGRQKKFIIYSMG 326 Query 301 NFVFDQG-------WTRTKDSALVQYHLRDNGTAILDV 331 NF+ +Q WT + + +DN T I V Sbjct 327 NFISNQRLETVDDIWTERGLLMDLTFEKKDNKTKIKTV 364 >ref|YP_602214.1| Gene info Capsule biosynthesis protein capA [Streptococcus pyogenes MGAS10750] gb|ABF37670.1| Gene info Capsule biosynthesis protein capA [Streptococcus pyogenes MGAS10750] Length=430 Score = 105 bits (263), Expect = 4e-21, Method: Composition-based stats. Identities = 91/338 (26%), Positives = 159/338 (47%), Gaps = 23/338 (6%) Query 11 LLIFIKKTKKKNPRYVAIVLPLIAVILIAATW-VQRTEAVAPVKHRENEKLTMTMV-GDI 68 +LI + KK VA+++ L+ LI VQ+ E A + K + GDI Sbjct 33 VLIKTMQYKKTMATVVALIVALLLFGLIYDLLGVQKNELAAQKSAQPKVKAARVVANGDI 92 Query 69 MMG----RHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIH 124 ++ ++ + Y F +V ++ +D G++E + +Y A + Sbjct 93 LIHDILYMSARKADDTYDFTPYFEYVKDWISGADLAIGDYEGTI----SPDYPLAGYPL- 147 Query 125 LSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKN 184 +A EE A+K G+ V++LA+NH+ D G +T K F + +D +G + + ++ Sbjct 148 FNAPEEIAGALKNTGYDVVDLAHNHILDSQLDGALNTKKVFHQLGIDSIGIYDKDRSKES 207 Query 185 IVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVV 244 + +NVNG+++A LG++ + G AT Q D+ +I K + AD+ + Sbjct 208 FLIKNVNGIKIAILGYSYGY-NGMEATLSQEDYEKHMSDLDEAKIKKELQLAEKKADVTI 266 Query 245 VNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQG----IIFYSLG 300 V G EY +P+ Q+ L M+D GAD+++G HPHV++ + +G I YS+G Sbjct 267 VMPQMGTEYALEPTAEQKELYHKMIDWGADVVLGGHPHVIEPSETVIKGRQKKFIIYSMG 326 Query 301 NFVFDQG-------WTRTKDSALVQYHLRDNGTAILDV 331 NF+ +Q WT + + +DN T I V Sbjct 327 NFISNQRLETVDDIWTERGLLMDLTFEKKDNKTKIKTV 364 >ref|YP_280081.1| Gene info capsule biosynthesis protein [Streptococcus pyogenes MGAS6180] ref|YP_596419.1| Gene info capsule biosynthesis protein [Streptococcus pyogenes MGAS9429] gb|AAX71726.1| Gene info capsule biosynthesis protein [Streptococcus pyogenes MGAS6180] gb|ABF31875.1| Gene info capsule biosynthesis protein [Streptococcus pyogenes MGAS9429] Length=430 Score = 105 bits (262), Expect = 5e-21, Method: Composition-based stats. Identities = 90/338 (26%), Positives = 160/338 (47%), Gaps = 23/338 (6%) Query 11 LLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKLTMTMV--GDI 68 +LI + KK VA+++ L+ LI + +A K + + T +V GDI Sbjct 33 VLIKTMQYKKTMATVVALIVALLLFGLIYDLLGVQKNKLAAQKSAQPKVKTARVVANGDI 92 Query 69 MMG----RHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIH 124 ++ ++ + Y F +V ++ +D G++E + +Y A + Sbjct 93 LIHDILYMSARKADDTYDFTPYFEYVKDWISGADLAIGDYEGTI----SPDYPLAGYPL- 147 Query 125 LSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKN 184 +A EE A+K G+ V++LA+NH+ D G +T K F + +D +G + + ++ Sbjct 148 FNAPEEIAGALKNTGYDVVDLAHNHILDSQLDGALNTKKVFHQLGIDSIGIYDKDRSKES 207 Query 185 IVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVV 244 + +NVNG+++A LG++ + G AT Q D+ +I K + AD+ + Sbjct 208 FLIKNVNGIKIAILGYSYGY-NGMEATLSQEDYEKHMSDLDEAKIKKELQLAEKKADVTI 266 Query 245 VNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQG----IIFYSLG 300 V G EY +P+ Q+ L M+D GAD+++G HPHV++ + +G I YS+G Sbjct 267 VMPQMGTEYALEPTAEQKELYHKMIDWGADVVLGGHPHVIEPSETVIKGRQKKFIIYSMG 326 Query 301 NFVFDQG-------WTRTKDSALVQYHLRDNGTAILDV 331 NF+ +Q WT + + +DN T I V Sbjct 327 NFISNQRLETVDDIWTERGLLMDLTFEKKDNKTKIKTV 364 >ref|ZP_01620698.1| poly-gamma-glutamic synthesis PgsA protein-like protein [Lyngbya sp. PCC 8106] gb|EAW37397.1| poly-gamma-glutamic synthesis PgsA protein-like protein [Lyngbya sp. PCC 8106] Length=599 Score = 105 bits (262), Expect = 5e-21, Method: Composition-based stats. Identities = 81/284 (28%), Positives = 132/284 (46%), Gaps = 50/284 (17%) Query 59 KLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQK 118 ++ + VGDI+ G + + +F+ V P L+ +D V GNFE + NY + Sbjct 279 RIKIKAVGDIIPGTNYPSNKLPASKESLFQDVKPALQGADIVFGNFESTL-----TNYPR 333 Query 119 ADKNI------HLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDY 172 + KNI E +K+AGF +L++ANNH D+ G DTI + + Sbjct 334 SAKNIGRGLVFAFRTPPEYTSILKDAGFNILSVANNHSFDFFEAGFDDTIDNINQLGMKA 393 Query 173 VGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKA 232 VG + IVY V GV+ A +GF+ ++ ++L + SKA Sbjct 394 VGRKDE------IVYHEVKGVKFAFIGFS---------------YFPVHNNMLDLEASKA 432 Query 233 --KDPKKGNADLVVVNTHWGEEYDNKPSPRQEA-------------LAKAMVDAGADIIV 277 K + AD++V++ H G E + R + A+ ++DAGAD+++ Sbjct 433 IVKKAEAEGADVIVISVHAGAEGTAALNVRNKTEYFYGENRGNKVLFARTLIDAGADLVL 492 Query 278 GHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWTRTKDSALVQYHL 321 GH PHV ++ ++Y +I YSLGNF+ G+ A + Y L Sbjct 493 GHGPHVPRALELYNGKLIAYSLGNFM---GYRTLSTKAQLGYSL 533 >ref|NP_691512.1| Gene info hypothetical protein OB0591 [Oceanobacillus iheyensis HTE831] dbj|BAC12547.1| Gene info hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length=389 Score = 105 bits (261), Expect = 6e-21, Method: Composition-based stats. Identities = 80/258 (31%), Positives = 134/258 (51%), Gaps = 17/258 (6%) Query 58 EKLTMTMVGDIMMGRHVKEIV-NRYGTDY--VFRHVSPYLKNSDYVSGNFEHPVLLEDKK 114 +++ ++ VGD+++ V E R G D+ +F+ V YL +S N E + E+ Sbjct 53 QEIKVSAVGDVLIHSPVYEDARERDGFDFNPMFKQVKTYLDSSTVTIANQETMIGGEEMG 112 Query 115 NYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVG 174 N + E A+KE G ++ +ANNH D G + + I ++ D+ Y G Sbjct 113 LSSYPSFN----SPFEVGDALKENGVDIVTIANNHTLDRGEQAITNAIGHWQSIDMLYEG 168 Query 175 AGENFKDVKNI-VYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAK 233 A +N +D + I V + G+ +A+L +T + ++ ++ + ++I KAK Sbjct 169 AYQNKEDQEKIRVLETEEGISIASLAYTYGTNGIPVPQGKEYLVDLIDRKKMKEEIIKAK 228 Query 234 DPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYK-- 291 AD+VV++ H+G EY++ P+ Q+ LAK D G D+I+GHHPHVLQ D K Sbjct 229 KL----ADIVVLSLHFGNEYEHYPNQSQKDLAKFAADLGVDVIIGHHPHVLQPIDWVKGE 284 Query 292 ---QGIIFYSLGNFVFDQ 306 Q ++ YSLGNF+ +Q Sbjct 285 DGYQTLVAYSLGNFLSNQ 302 >ref|NP_802565.1| Gene info hypothetical protein SPs1303 [Streptococcus pyogenes SSI-1] dbj|BAC64398.1| Gene info hypothetical protein [Streptococcus pyogenes SSI-1] Length=430 Score = 105 bits (261), Expect = 7e-21, Method: Composition-based stats. Identities = 90/338 (26%), Positives = 160/338 (47%), Gaps = 23/338 (6%) Query 11 LLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKLTMTMV--GDI 68 +LI + KK VA+++ L+ LI + +A K + + T +V GDI Sbjct 33 VLIKTMQYKKTMATVVALIVALLLFGLIYDLLGVQKNKLAAQKSAQPKVKTARVVANGDI 92 Query 69 MMG----RHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIH 124 ++ ++ + Y F +V ++ +D G++E + +Y A + Sbjct 93 LIHDILYMSARKADDTYDFTPYFEYVKDWISGADLAIGDYEGTI----SPDYPLAGYPL- 147 Query 125 LSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKN 184 +A EE A+K G+ V++LA+NH+ D G +T K F + +D +G + + ++ Sbjct 148 FNAPEEIAGALKNTGYDVVDLAHNHILDSQLDGALNTKKVFHQLGIDSIGIYDKDRSKES 207 Query 185 IVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVV 244 + +NVNG+++A LG++ + G AT Q D+ +I K + AD+ + Sbjct 208 FLIKNVNGIKIAILGYSYGY-NGMEATLSQEDYEKHMSDLDEAKIKKELQLAEKKADVTI 266 Query 245 VNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQG----IIFYSLG 300 V G EY +P+ Q+ L M+D GAD+++G HPHV++ + +G I YS+G Sbjct 267 VMPQTGTEYALEPTAEQKELYHKMIDWGADVVLGGHPHVIEPSETVIKGRQKKFIIYSMG 326 Query 301 NFVFDQG-------WTRTKDSALVQYHLRDNGTAILDV 331 NF+ +Q WT + + +DN T I V Sbjct 327 NFISNQRLETVDDIWTERGLLMDLTFEKKDNKTKIKTV 364 >ref|ZP_00910663.1| encapsulation protein CapA [Clostridium beijerincki NCIMB 8052] gb|EAP58720.1| encapsulation protein CapA [Clostridium beijerincki NCIMB 8052] Length=401 Score = 104 bits (259), Expect = 1e-20, Method: Composition-based stats. Identities = 82/328 (25%), Positives = 142/328 (43%), Gaps = 59/328 (17%) Query 14 FIKKTKKKNP--RYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKL---TMTMVGDI 68 +I+ KKK+ +Y+ +L I V+ + +++ E ++ K+ N+K+ T + D Sbjct 14 YIRDKKKKSDYLKYITFILVTILVLTSSLIYLKYREGLSNKKNTANDKVNGETDKSIDDN 73 Query 69 MMGRHVKEIVNR-----------YGTD---------------------YVFRHVSPYLKN 96 +KE + + GTD Y ++VS Sbjct 74 YKTNQLKEPIKKTIVISFAGDFTLGTDTKFPYDGSLPAAFIGSGKNYSYFMQNVSSVFSK 133 Query 97 SDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAK 156 DY N E K ++ + + +E V + + +ANNH+ DYG + Sbjct 134 DDYTLVNLETTFTDSKDKAHKDGEVFYNFKGPKEYVDILTSGSIEGVTIANNHIYDYGKQ 193 Query 157 GTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPG 216 G DTI KE ++D G G + +++ G++ LG+T + + +K Sbjct 194 GINDTINTLKEKNIDICGEGYK-------ILKDIQGIKFGFLGYTGWEYSNNLKSK---- 242 Query 217 SLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADII 276 IS + +K A++V+ HWG E +P Q++LA+ +D GAD + Sbjct 243 -----------IISDISELRKRGAEVVIPYFHWGVERKYEPDDVQKSLARFSIDNGADAV 291 Query 277 VGHHPHVLQSFDVYKQGIIFYSLGNFVF 304 +G HPHV++S + YK I YS+GNF F Sbjct 292 IGSHPHVIESMEDYKGKFIAYSMGNFCF 319
  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding 
environmental samples from WGS projects
    Posted date:  May 27, 2007  5:53 PM
  Number of letters in database: 1,723,618,044
  Number of sequences in database:  4,984,388
Lambda     K      H
   0.315    0.132    0.375 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4984388
Number of Hits to DB: 69269042
Number of extensions: 3037874
Number of successful extensions: 12863
Number of sequences better than 10: 21
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 12999
Number of HSP's successfully gapped: 23
Length of query: 411
Length of database: 1723618044
Length adjustment: 135
Effective length of query: 276
Effective length of database: 1050725664
Effective search space: 290000283264
Effective search space used: 290000283264
T: 11
A: 40
X1: 16 (7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 79 (35.0 bits)