spacer

ClustalW Results


Results of search
Number of sequences 10
Alignment score 43502
Sequence format Pearson
Sequence type aa
ClustalW version 1.83
JalView
Output file clustalw-20070528-19094606.output
Alignment file clustalw-20070528-19094606.aln
Guide tree file clustalw-20070528-19094606.dnd
Your input file clustalw-20070528-19094606.input

To save a result file right-click the file link in the above table and choose "Save Target As".
If you cannot see the JalView button, reload the page and check your browser settings to enable Java Applets.




Scores Table

SeqA Name                          Len(aa)  SeqB Name                          Len(aa)  Score
=============================================================================================
1    pagA_B.anthracis_Ames_Anc._   764      2    B.cereus_G9241                760      59   
1    pagA_B.anthracis_Ames_Anc._   764      3    Cl.spiroforme                 879      27   
1    pagA_B.anthracis_Ames_Anc._   764      4    Cl.perfringens                875      27   
1    pagA_B.anthracis_Ames_Anc._   764      5    C.difficile                   876      27   
1    pagA_B.anthracis_Ames_Anc._   764      6    C.botulinum                   721      26   
1    pagA_B.anthracis_Ames_Anc._   764      7    Brevibacillus_laterosporus    785      23   
1    pagA_B.anthracis_Ames_Anc._   764      8    B.thuringiensis               775      22   
1    pagA_B.anthracis_Ames_Anc._   764      9    B.anthracis_A2012             225      27   
1    pagA_B.anthracis_Ames_Anc._   764      10   Spiroplasma_citri             438      30   
2    B.cereus_G9241                760      3    Cl.spiroforme                 879      26   
2    B.cereus_G9241                760      4    Cl.perfringens                875      25   
2    B.cereus_G9241                760      5    C.difficile                   876      24   
2    B.cereus_G9241                760      6    C.botulinum                   721      25   
2    B.cereus_G9241                760      7    Brevibacillus_laterosporus    785      22   
2    B.cereus_G9241                760      8    B.thuringiensis               775      25   
2    B.cereus_G9241                760      9    B.anthracis_A2012             225      23   
2    B.cereus_G9241                760      10   Spiroplasma_citri             438      30   
3    Cl.spiroforme                 879      4    Cl.perfringens                875      80   
3    Cl.spiroforme                 879      5    C.difficile                   876      77   
3    Cl.spiroforme                 879      6    C.botulinum                   721      37   
3    Cl.spiroforme                 879      7    Brevibacillus_laterosporus    785      31   
3    Cl.spiroforme                 879      8    B.thuringiensis               775      28   
3    Cl.spiroforme                 879      9    B.anthracis_A2012             225      16   
3    Cl.spiroforme                 879      10   Spiroplasma_citri             438      29   
4    Cl.perfringens                875      5    C.difficile                   876      80   
4    Cl.perfringens                875      6    C.botulinum                   721      37   
4    Cl.perfringens                875      7    Brevibacillus_laterosporus    785      29   
4    Cl.perfringens                875      8    B.thuringiensis               775      27   
4    Cl.perfringens                875      9    B.anthracis_A2012             225      15   
4    Cl.perfringens                875      10   Spiroplasma_citri             438      31   
5    C.difficile                   876      6    C.botulinum                   721      38   
5    C.difficile                   876      7    Brevibacillus_laterosporus    785      31   
5    C.difficile                   876      8    B.thuringiensis               775      28   
5    C.difficile                   876      9    B.anthracis_A2012             225      8    
5    C.difficile                   876      10   Spiroplasma_citri             438      31   
6    C.botulinum                   721      7    Brevibacillus_laterosporus    785      23   
6    C.botulinum                   721      8    B.thuringiensis               775      23   
6    C.botulinum                   721      9    B.anthracis_A2012             225      18   
6    C.botulinum                   721      10   Spiroplasma_citri             438      32   
7    Brevibacillus_laterosporus    785      8    B.thuringiensis               775      56   
7    Brevibacillus_laterosporus    785      9    B.anthracis_A2012             225      10   
7    Brevibacillus_laterosporus    785      10   Spiroplasma_citri             438      31   
8    B.thuringiensis               775      9    B.anthracis_A2012             225      5    
8    B.thuringiensis               775      10   Spiroplasma_citri             438      30   
9    B.anthracis_A2012             225      10   Spiroplasma_citri             438      12   
=============================================================================================
PLEASE NOTE: Some scores may be missing from the above table if the alignment was done using multiple CPU mode. Please check the output.




Alignment

CLUSTAL W (1.83) multiple sequence alignment


pagA_B.anthracis_Ames_Anc._      ------MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNE--SE 42
B.cereus_G9241                   ------MKKRKVFIPLLAVSTILAASPVNLNIIQANTTQEDSILQG--KE 42
Brevibacillus_laterosporus       --MTYMKKKLVSVVTCALLAPMFLNGNVNPVYADNQTNQLSTAQENQEKE 48
B.thuringiensis                  --MKNMKKKLASVVTCTLLAPMFLNGNVNAVYADSKTNQISTTQKNQQKE 48
Spiroplasma_citri                --------------------------------------------------
Cl.perfringens                   MNIQIKN--VFSFLTLTAMISQTLSYNVYAQTTTQNDTNQKEEITN-ENT 47
C.difficile                      MKIQMRNKKVLSFLTLTAIVSQALVYPVYAQTSTSNHSNKKKEIVN-EDI 49
Cl.spiroforme                    ----MKNKKILGLLTCTVLVGQMMTYPVYAKTITQNYDNQEVETTN-EKT 45
C.botulinum                      -------------------------------MLVSKFEN-SVKNSN-KNY 17
B.anthracis_A2012                --------------------------------------------------
                                                                                   

pagA_B.anthracis_Ames_Anc._      SSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPS-ENQYFQS 91
B.cereus_G9241                   TNSQGLLGYYFNDLDFKNPTVITTLETGDLSIDNSEIESTLSNEKQYFQS 92
Brevibacillus_laterosporus       VDRKGLLGYYFKGKEFNHLTLFAPTRDNTLIYDQQTVDFLLDKKQQEYQS 98
B.thuringiensis                  MDRKGLLGYYFKGKDFSNLTMFAPTRDNTLIYDQQTANKLLDKKQQQYQS 98
Spiroplasma_citri                --------------------------------------------------
Cl.perfringens                   LSSNGLMGYYFADEHFKDLELMAPIKNGDLKFEEKKVDKLLTEDNSSIKS 97
C.difficile                      LPNNGLMGYYFSDEHFKDLKLMAPIKDGNLKFEEKKVDKLLDKDKSDVKS 99
Cl.spiroforme                    VSSNGLMGYYFADEHFKDLELMAPVKNGELKFEKNKVEKLLTEEKTNIKS 95
C.botulinum                      FTINGLMGYYFENDFFN-LNIISPTLDGNLTFSKEDINSILG--NKIIKS 64
B.anthracis_A2012                --------------------------------------------------
                                                                                   

pagA_B.anthracis_Ames_Anc._      AIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGR 141
B.cereus_G9241                   AIWTGFVNVEKDGEYTFSTSDNNHVTISVNDQEVMNRTSDLHKIWLEKGQ 142
Brevibacillus_laterosporus       IRWIGLIQSKETGDFTFNLSDDKNAIIEIDGKTISHKGQNKQVVHLEKGK 148
B.thuringiensis                  IRWIGLIQSKEKGDFTFNLSEDEQAIIEIDGKIISNKGKEKQVVHLEKEK 148
Spiroplasma_citri                --------------------------------------------------
Cl.perfringens                   IRWTGRIIPSEDGEYILSTDRN-DVLMQIN---AKGDIAKTLKVNMKKGQ 143
C.difficile                      IRWTGRIIPSKDGEYTLSTDRD-DVLMQVN---TESTISNTLKVNMKKGK 145
Cl.spiroforme                    IRWTGRIIPSKDGEYTLSTDKD-NVLMQIN---AEGEIANTLKVNMIKGQ 141
C.botulinum                      ARWIGLIKPSITGEYILSTNSP-NCRVELNGEIFNLSLNTSNTVNLIQGN 113
B.anthracis_A2012                --------------------------------------------------
                                                                                   

pagA_B.anthracis_Ames_Anc._      LYQIKIQYQRENPTEKGLD----FKLYWTDSQNKKEVISSDNLQLPELKQ 187
B.cereus_G9241                   LYEITVKYQRESPSEKGIG----FQLYWTTPDNTTETIPKSKLLLPKLKA 188
Brevibacillus_laterosporus       LVPIKIEYQSDQIVNRDSKIFKEFKLFKVDSQQQSHQVQLDELRNPEFNK 198
B.thuringiensis                  LVPIKIEYQSDTKFNIDSKTFKEFKLFKIDSQNQSQQVKRDELRNPEFNK 198
Spiroplasma_citri                -----------------------------------------MEKNTEIKN 9
Cl.perfringens                   AYNIRIEIQDKNLGSIDN--LSVPKLYWELNGN-KTVIPEENLFFRDYSK 190
C.difficile                      EYKVRIELQDKNLGSIDN--LSSPNLYWELDGM-KKIIPEENLFLRDYSN 192
Cl.spiroforme                    EYSIRIEIQDKDIGYVDD--LSSPKLYWELNGD-KTLIPEKNLFLRDYSK 188
C.botulinum                      VYDIRIEQLMSENQLLKN--YEGIKLYWETSDIIKEIIPSEVLLKPNYSN 161
B.anthracis_A2012                --------------------------------------------------
                                                                                   

pagA_B.anthracis_Ames_Anc._      KSSNS----------RKKRSTSAG--------PTVPDRDNDGIPDSLEVE 219
B.cereus_G9241                   KSSKS----------RTERSANMN--------REIVDEDNDGIPDSLEIE 220
Brevibacillus_laterosporus       KETQQFLEKASKTNIFTQNMKRD---------EDATDTDGDSIPDLWEEN 239
B.thuringiensis                  KESREFLAKASKTNFFMQKMKRDI--------DEDTDTDGDSIPDLWEEN 240
Spiroplasma_citri                IKQQ------------SSCLDNDC--------DHALDSDDDGIPDCWEIN 39
Cl.perfringens                   IDEND--PFIPNNNFFDVRFFSA------AWEDEDLDTDNDNIPDAYEKN 232
C.difficile                      IEKDD--PFIPNNNFFDPKLMS-------DWEDEDLDTDNDNIPDSYERN 233
Cl.spiroforme                    IDEND--PFIPKDNFFDLKLKSRSARLASGWGDEDLDTDNDNIPDAYEKN 236
C.botulinum                      TNEKS--KFIPNNTLFSNAKLK---------ANANRDTDRDGIPDEWEIN 200
B.anthracis_A2012                --------------------------------------------------
                                                                                   

pagA_B.anthracis_Ames_Anc._      GYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT 269
B.cereus_G9241                   GYTVDVKNKRSILTPWVPTVHEKKGLRKYQSSPQKWSTASDPYSDFEKVT 270
Brevibacillus_laterosporus       GYTIQNK----VAVKWDDSFAAKG-YTKFVSNPFDSHTVGDPYTDYEKAA 284
B.thuringiensis                  GYTIQNK----VAVKWDDKFAQQG-YVKYLSSPYQAHTVGDPYTDWEKAA 285
Spiroplasma_citri                GYTVEKG----LIVPWDDKKHKTGKFIKYKSDPYNSHTTGDPYSDAEKVL 85
Cl.perfringens                   GYTIKDS----IAVKWNDSFAEQG-YKKYVSSYLESNTAGDPYTDYQKAS 277
C.difficile                      GYTIKDL----IAVKWEDSFAEQG-YKKYVSNYLESNTAGDPYTDYEKAS 278
Cl.spiroforme                    GYTIKDS----IAVKWEDSFAQQG-YKKYLSSYLESNTAGDPYTDYQKAS 281
C.botulinum                      GYTVMNQ----KAVAWDDKFAANG-YKKYVSNPFKPCTANDPYTDFEKVS 245
B.anthracis_A2012                ---------------------------------MESLGINNIYNALDRIK 17
                                                                   .    .: *.  ::  

pagA_B.anthracis_Ames_Anc._      GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDS----QT 315
B.cereus_G9241                   GRIDKKVSLEARDPRIAAFPNVTVDMEKIIISKIEDKSKQQGGS----QG 316
Brevibacillus_laterosporus       RDLDLANAKETFNPLVAAFPSVNVNLEKVILSPNEDLSN----------- 323
B.thuringiensis                  GDIPKSNAAATRNPLVAAFPSINVDMRKMILSKDSNLSN----------- 324
Spiroplasma_citri                GKIDQGVLPEAHHPLVAAYPKIGVMMNKMILSNNFNVTNEEGRSVGQQKS 135
Cl.perfringens                   GSIDKAIKLEARDPLVAAYPVVGVGMENLIISTNEHASSDQGK------- 320
C.difficile                      GSFDKAIKTEARDPLVAAYPIVGVGMEKLIISTNEHASTDQGK------- 321
Cl.spiroforme                    GSFDKAIKAEARDPLVAAYPVVGVGMEKLIISTNEHASTDQGK------- 324
C.botulinum                      GQIDPSVSMVARDPMISAYPIVGVQMERLVVSKSETITGDSTK------- 288
B.anthracis_A2012                --LNAKMNILVRDP------------------------------------ 29
                                   :       . .*                                    

pagA_B.anthracis_Ames_Anc._      RTISKNTSTSRTHTSEVHGNAEVHASFFDIG---GSVSAGFSNSNSSTVA 362
B.cereus_G9241                   NTISTGTSTSKTHTLEEHADVSFHASLFDFG---GSVSAGISNSNSSTVT 363
Brevibacillus_laterosporus       -SVESHSSTNWSYTNTEGASIEAGSGPL-----------GISYGVSANYQ 361
B.thuringiensis                  -SAEAHSNNSYTYANSEGASIEAGFGPK-----------GFSFGVSANYQ 362
Spiroplasma_citri                NTISVSTSSSNTEATTVGASVSAEISLFPSLSVSANISHEWSSTVSSEHS 185
Cl.perfringens                   -TVSRATTNSKTDANTVGVSISAGYQNG--------FTGNITTSYSHTTD 361
C.difficile                      -TVSRATTNSKTESNTAGVSVNVGYQNG--------FTANVTTNYSHTTD 362
Cl.spiroforme                    -TVSRNTTNSKTDANTAGVAINIAYQNG--------FTGSITTNYSHTTE 365
C.botulinum                      -SMSKSTSHSSTNINTVGAEVSGSLQLAGG--IFPVFSMSASANYSHTWQ 335
B.anthracis_A2012                ------------------------------------------YHYDNNGN 37
                                                                              .    

pagA_B.anthracis_Ames_Anc._      IDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSL 412
B.cereus_G9241                   IDTSESTNIEKSWSETLGVNTADAAKLNANIRFKNTGTAPIYNALSTTSL 413
Brevibacillus_laterosporus       HSETVAKEWGTSTGNTSQFNTASAGYLNANVRYNNVGTGAIYEVKPTTGF 411
B.thuringiensis                  HTETVGSDWGNSKSNTEQFNSASAGYLNANVHYNNVGTGGIYDAQPTTSF 412
Spiroplasma_citri                SSNTSSEEQGQTWTHSLGINTSEVAYLNGNVKYLNVGTAPIYEVCPTLNF 235
Cl.perfringens                   NSTAVQDSNGESWNTGLSINKGESAYINANVRYYNTGTAPMYKVTPTTNL 411
C.difficile                      NSTAVQDSNGESWNTGLSINKGESAYINANVRYYNTGTAPMYKVTPTTNL 412
Cl.spiroforme                    NSTAVQNSNGESWNTSLSINKGESAYINANVRYYNTGTAPMYKVTPTTNL 415
C.botulinum                      NTSTVDDTTGESFSQGLSINTGESAYINPNIRYYNTGTAPVYNVTPTTTI 385
B.anthracis_A2012                IVGVDDSYLKNAYKQILNWSS-DGVSLNLDEDVNQALSGYMLQIKKPSNH 86
                                            :       .. .   :* :    :. :. : .   .   

pagA_B.anthracis_Ames_Anc._      VLGK---NQTLATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSST 459
B.cereus_G9241                   VLGN---NQTIATIKAKENQMAQLIAPNEYYPSKKLAAISLNAQDDFSST 460
Brevibacillus_laterosporus       VLDN----DTVATITAKSNSTALSISPGESYPKKGQNGIAINTMDDFNSH 457
B.thuringiensis                  ILQD----STIATITAKSNATALSIPSGDRYPAS-KEGISLKTMDDFNSH 457
Spiroplasma_citri                VLGIGELSNTIATIIAKSNTTANVILPGAIFPDKVQNSIAWNTIDNFNSQ 285
Cl.perfringens                   VLDG----ETLATIKAQDNQIGNNLSPNETYPKKGLSPLALNTMDQFNAR 457
C.difficile                      VLDG----DTLSTIKAQENQIGNNLSPGDTYPKKGLSPLALNTMDQFSSR 458
Cl.spiroforme                    VLDG----DTLTTIKAQDNQIGNNLSPNETYPKKGLSPLALNTMDQFSSR 461
C.botulinum                      VIDK----QSVATIKGQESLIGDYLNPGGTYPIIGEPPMALNTMDQFSSR 431
B.anthracis_A2012                LTNS----PVTITLAGKDSGVGELYR----VLSDGTGFLDFNKFDENWRS 128
                                 :           *: .:..  .                :  :  *:    

pagA_B.anthracis_Ames_Anc._      PITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV 509
B.cereus_G9241                   PITMNYNQLMELEKTKKLRLDTDQVYGNIGEFNHSKGRVEVNTNLNWSNF 510
Brevibacillus_laterosporus       PITLNKQQLDQIFNNKPLMLETNQADGVYKIKDTS-GNIVTGG--EWNGV 504
B.thuringiensis                  PITLNKPQLDAVLNNEVIKINTDQTDGRYGIIGVD-GKAEIGD--RWSPI 504
Spiroplasma_citri                PIKLNYEQVEALQTGVPLQIQTIQTSGLYKTYTAD-MLPMVNEYQKWEHI 334
Cl.perfringens                   LIPINYDQLKKLDSGKQIKLETTQVSGNYGTKNSQ-GQIITEG-NSWSNY 505
C.difficile                      LIPINYDQLKKLDAGKQIKLETTQVSGNFGTKNSS-GQIVTEG-NSWSDY 506
Cl.spiroforme                    LIPINYDQLKKLDAGKQIKLETTQVSGNYGIKNSQ-GQIITEG-NSWSDY 509
C.botulinum                      LIPINYNQLKSIDNGGTVMLSTSQFTGNFAKYNSN-GNLVTDG-NNWGPY 479
B.anthracis_A2012                LVDPGDDVYVYAVTKEDFNAVTRDENGNIANKLKN--TLVLSG------K 170
                                  :  .            .   * :  *       .               

pagA_B.anthracis_Ames_Anc._      LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIA 559
B.cereus_G9241                   LPQIEETTARIILQEDNNDSTERRVAAVDPNDFLEMTKPDVTLKEALKLA 560
Brevibacillus_laterosporus       IQQIQAKTASIIVDTGEG-VSEKRVAAKDYDNPEDK-TPSLSLKEALKLG 552
B.thuringiensis                  IDEIKGRTASIIIDPADGKALETRIAAKDYKNPEDK-TPSLTIKEGLKIA 553
Spiroplasma_citri                MVDIYNRTACLNLIFENGDIQERRVSVRKEDNYDDQLQPELTLGEAFQIA 384
Cl.perfringens                   ISQIDSVSASIILDTGSQ-TFERRVAAKEQGNPEDK-TPEITIGEAIKKA 553
C.difficile                      ISQIDSISASIILDTENE-SYERRVTAKNLQDPEDK-TPELTIGEAIEKA 554
Cl.spiroforme                    ISQIDSLSASIILDTGSD-VFERRVTAKDSSNPEDK-TPVLTIGEAIEKA 557
C.botulinum                      LGTIKSTTASLTLSFSGQ-TTQVAVVAPNFSDPEDK-TPKLTLEQALVKA 527
B.anthracis_A2012                IKEINIKTTNINIFVVFMFIIYLLFYIISSTVFAKSCNCILIYVEVSQLM 220
                                 :  *   :: : .           .   .     .     :   :     

pagA_B.anthracis_Ames_Anc._      FGFNEPN---GNLQYQGKD-----------ITEFDFNFDQQTSQNIKNQL 595
B.cereus_G9241                   YGFKEEN---RQLKYKEKD-----------ISRFEFVFDKETNQNIQQQL 596
Brevibacillus_laterosporus       YPEEIKE-KDGLLYYNDK---------PIYESSVMTYLDENTAKEVKEQL 592
B.thuringiensis                  YPESISEDKDGILFYEYKNDEGKVTKKQLSEENIMPYLDEDTSKEFERQL 603
Spiroplasma_citri                FNNAKVN--DDVLTYNNT--------KFILQGNIYIILDERTLALLKKKK 424
Cl.perfringens                   FSATKNG---ELLYFNGIP--------IDES-CVELIFDDNTSEIIKEQL 591
C.difficile                      FGATKKD---GLLYFNDIP--------IDES-CVELIFDDNTANKIKDSL 592
Cl.spiroforme                    FGATKNG---EILYFNGMP--------IDES-CVELIFDGNTANLIKERL 595
C.botulinum                      FALEKKN---GKFYFHGLE--------ISKNEKIQVFLDSNTNNDFENQL 566
B.anthracis_A2012                N----------SVFY----------------------------------- 225
                                             . :                                   

pagA_B.anthracis_Ames_Anc._      AELNATN-IYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEA 644
B.cereus_G9241                   KGRKFKN-IYEALDNIQLNAKMNILVRDANFRY-VDGKRVGANDWFIKTT 644
Brevibacillus_laterosporus       NDITGKFKDVKQLFDVKLTPKMNFTIKLATLYDGAEDGSSPTDVGISSPL 642
B.thuringiensis                  SDGS-----AKGLYDIKLTPKMNITIRLATVTLGFDDQFS------AYPW 642
Spiroplasma_citri                -------------------KLKNMIWKIFLILD----------------- 438
Cl.perfringens                   KYLD-----DKKIYNVKLERGMNILIKVPSYFTNFDEYNNFPASWSNIDT 636
C.difficile                      KTLS-----DKKIYNVKLERGMNILIKTPTYFTNFDDYNNYPSTWSNVNT 637
Cl.spiroforme                    NALN-----DKKIYNVQLERGMKILIKTSTYFNNFDGYNNFPSSWSNVDS 640
C.botulinum                      KNTA-----DKDIMHCIIKRNMNILVKVITFKENISSINIINDTNFGVQS 611
B.anthracis_A2012                --------------------------------------------------
                                                                                   

pagA_B.anthracis_Ames_Anc._      HREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNI 694
B.cereus_G9241                   HQQVIKWSEESATLKIDKNTTEMMAGYLIEIVEPSGKKELVNSRYDSIDI 694
Brevibacillus_laterosporus       GEWAFKPDINNVEGGNTGKRQ---YQLSKNKDGYYYGMLALSPEVSNKLK 689
B.thuringiensis                  ENATWSDKFGNLRLGSLAIPQESKYTIPKDKVKPNYDYLITGYIKHDFTT 692
Spiroplasma_citri                --------------------------------------------------
Cl.perfringens                   KNQDGLQSVANKLSGETKIIIPMSKLKPYKRYVFSGYSKDPSTSNSITVN 686
C.difficile                      TNQDGLQGSANKLNGETKIKIPMSELKPYKRYVFSGYSKDPLTSNSIIVK 687
Cl.spiroforme                    NNQDGLQNAANKLSGETKIVIPMSKLNPYKRYVFSGYLKNSSTSNPITVN 690
C.botulinum                      -----MTGLSNRSKGQDGIYRAATTAFSFK-------SKE---------- 639
B.anthracis_A2012                --------------------------------------------------
                                                                                   

pagA_B.anthracis_Ames_Anc._      SSLRQDGKTFIDFKKYNDKLPLYISNP----------------------- 721
B.cereus_G9241                   FSILKDGTVFLDFKKHNDNTPLRINN------------------------ 720
Brevibacillus_laterosporus       KNYQYYISMSIKADAGVEPTVTVMDN------------------------ 715
B.thuringiensis                  DNESLGIVAFTKKDN------FEMWN------------------------ 712
Spiroplasma_citri                --------------------------------------------------
Cl.perfringens                   IKSKEQKTDYLVPEKDYTKFSYEFETTGKDSSDIEITLTSSGVIFLDNLS 736
C.difficile                      IKAKEEKTDYLVPEQGYTKFSYEFETTEKDSSNIEITLIGSGTTYLDNLS 737
Cl.spiroforme                    IKAKEQKTYNLVSENDYKKFSYEFETIGRDASNIEITLTSSGTIFLDNLS 740
C.botulinum                      LKYPEGRYRMRFVIQSYEPFTCNFK------------------------- 664
B.anthracis_A2012                --------------------------------------------------
                                                                                   

pagA_B.anthracis_Ames_Anc._      ------------------------------NYKVNVYAVTKENTIIN--- 738
B.cereus_G9241                   ------------------------------GETVNIYAITKERKNLA--- 737
Brevibacillus_laterosporus       -----------------------------LLNGIVDKKLKLSSNGYQRFD 736
B.thuringiensis                  -----------------------------MGTSIFSQN---SGGEFKKFT 730
Spiroplasma_citri                --------------------------------------------------
Cl.perfringens                   ITELNSTPEILKEPEIKVPSDQEILDAHNKYYADIKLDTNTGNTYIDGIY 786
C.difficile                      ITELNSTPEILDEPEVKIPTDQEIMDAHKIYFADLNFNPSTGNTYINGMY 787
Cl.spiroforme                    ITELNSTPEILKEPDIKVPSDQEIIDAHKKYYADLSFNQSTANYYLDGLY 790
C.botulinum                      ------------------------------LFNNLIYSSSFDKGYYDEFF 684
B.anthracis_A2012                --------------------------------------------------
                                                                                   

pagA_B.anthracis_Ames_Anc._      ----------------------PSENGDTSTN-GIKKILIFSKKGYEIG- 764
B.cereus_G9241                   ----------------------IEEGRFPNINDSEKGVLVLSLKK----- 760
Brevibacillus_laterosporus       ILVDNSESHPINVMVIDLGVSSQDYNNYSKNIYIDDITITEVSAMKVKN- 785
B.thuringiensis                  IKTQN-ISGDYILDSIQLMKRNNDVNKIDS--YLDDISIIPIGPNKSR-- 775
Spiroplasma_citri                --------------------------------------------------
Cl.perfringens                   FEPTQTNKEALDYIQKYRVEATLQYSGFKDIGTKDKEIRNYLGDQNQPKT 836
C.difficile                      FAPTQTNKEALDYIQKYRVEATLQYSGFKDIGTKDKEMRNYLGDPNQPKT 837
Cl.spiroforme                    FEPTQTNKEVLDYIQKYKVEATLEYSGFKDIGTKDKELRNYTGDSNQPKT 840
C.botulinum                      Y---------------------FYYNGSKSFFNISCDIINSINR------ 707
B.anthracis_A2012                --------------------------------------------------
                                                                                   

pagA_B.anthracis_Ames_Anc._      ---------------------------------------
B.cereus_G9241                   ---------------------------------------
Brevibacillus_laterosporus       ---------------------------------------
B.thuringiensis                  ---------------------------------------
Spiroplasma_citri                ---------------------------------------
Cl.perfringens                   NYINFRSYFTSGENVMTYKKLRIYAVTPDNRELLVLSVN 875
C.difficile                      NYVNLRSYFTGGENIMTYKKLRIYAITPDDRELLVLSVD 876
Cl.spiroforme                    NYVNFRSYFTSGENVMPYKKLRIYAITPENKELLVLSIN 879
C.botulinum                      ---------LSGVFLIELDKLII---------------- 721
B.anthracis_A2012                ---------------------------------------
                                                                        
PLEASE NOTE: Showing colors on large alignments is slow.




Guide Tree

(
(
(
(
pagA_B.anthracis_Ames_Anc._:0.19543,
B.cereus_G9241:0.20852)
:0.10405,
B.anthracis_A2012:0.44064)
:0.07348,
(
(
Cl.spiroforme:0.10366,
(
Cl.perfringens:0.09330,
C.difficile:0.10670)
:0.00763)
:0.20268,
C.botulinum:0.31476)
:0.02994)
:0.02332,
(
Brevibacillus_laterosporus:0.20861,
B.thuringiensis:0.22881)
:0.15113,
Spiroplasma_citri:0.31851);


Cladogram

Right-click on the above tree to see display options.
Problems printing? Read how to print a Phylogram or Cladogram.
spacer
spacer