spacer

ClustalW Results


Results of search
Number of sequences 3
Alignment score 6036
Sequence format Pearson
Sequence type aa
ClustalW version 1.83
JalView
Output file clustalw-20070528-18454734.output
Alignment file clustalw-20070528-18454734.aln
Guide tree file clustalw-20070528-18454734.dnd
Your input file clustalw-20070528-18454734.input

To save a result file right-click the file link in the above table and choose "Save Target As".
If you cannot see the JalView button, reload the page and check your browser settings to enable Java Applets.




Scores Table

SeqA Name                         Len(aa)  SeqB Name                         Len(aa)  Score
===========================================================================================
1    lef_B.anthracis_Ames_Anc._   809      2    B.anthracis_A2012            809      100  
1    lef_B.anthracis_Ames_Anc._   809      3    B.cereus_G9241               476      25   
2    B.anthracis_A2012            809      3    B.cereus_G9241               476      25   
===========================================================================================
PLEASE NOTE: Some scores may be missing from the above table if the alignment was done using multiple CPU mode. Please check the output.




Alignment

CLUSTAL W (1.83) multiple sequence alignment


lef_B.anthracis_Ames_Anc._      MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKN 50
B.anthracis_A2012               MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKN 50
B.cereus_G9241                  --------------------------------------------------
                                                                                  

lef_B.anthracis_Ames_Anc._      KDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVP 100
B.anthracis_A2012               KDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVP 100
B.cereus_G9241                  ------------------MKEIIRNLVRLDVRSDVDENSKKTQELVEKLP 32
                                                  :***::::*:::*:.:   :.: :::*:**:*

lef_B.anthracis_Ames_Anc._      SDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEH 150
B.anthracis_A2012               SDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEH 150
B.cereus_G9241                  HEVLELYKNVGGEIYITDKRLTQHEELSDSSHKDMFIVSSEGKSFPLREH 82
                                 :***:** :**:***.*  :*:* .*.  *...  * .  **.  *:**

lef_B.anthracis_Ames_Anc._      YVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKIN--Q 198
B.anthracis_A2012               YVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKIN--Q 198
B.cereus_G9241                  FVFAKGGKEPSLIIHAED--YASHLSSVEVYYELGKAIIRDTFPLNQKEL 130
                                :*:** * ** *:*::.:    .  .:::****:** : ** :.  :   

lef_B.anthracis_Ames_Anc._      PYQKFLDVLNTIKN---------ASDSDGQDLLFTNQLK---EHPTDFSV 236
B.anthracis_A2012               PYQKFLDVLNTIKN---------ASDSDGQDLLFTNQLK---EHPTDFSV 236
B.cereus_G9241                  GNPKFINAINEVNQQKEGKGVNAKADEDGRDLLFGKELKKNLEHGQLVDL 180
                                   **::.:* :::          :*.**:**** ::**   **   ..:

lef_B.anthracis_Ames_Anc._      EFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEIN 286
B.anthracis_A2012               EFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEIN 286
B.cereus_G9241                  DLISGNLSEFQHVFAKSFALYYEPHYKEALKSYAPALFNYMLELDQMRFK 230
                                :::. * .*.*.****:** * **::::.*: ***  **** :::: .::

lef_B.anthracis_Ames_Anc._      LSLEELKDQRMLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPK 336
B.anthracis_A2012               LSLEELKDQRMLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPK 336
B.cereus_G9241                  EISDDVKE------------------------------------------ 238
                                   :::*:                                          

lef_B.anthracis_Ames_Anc._      KDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEE 386
B.anthracis_A2012               KDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEE 386
B.cereus_G9241                  ----------------KNKNVLDFKWYTRKAESWGVQTFKNWKENLTISE 272
                                                *. :: . .: : : :.:  :   : ::.*: .*

lef_B.anthracis_Ames_Anc._      KELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPS 436
B.anthracis_A2012               KELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPS 436
B.cereus_G9241                  KDIITGYTGSKYDPIN----EYLRKYDGEIIP--------NIGGDLDKKS 310
                                *:::.    .. :*:.    *:*:* . :* *        : ** :*. *

lef_B.anthracis_Ames_Anc._      INLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGAD 486
B.anthracis_A2012               INLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGAD 486
B.cereus_G9241                  K--KALEKIENQIKNLDAALQKSK---------ITENLIVYR-------- 341
                                   .. :: :.:*:*:** *::*          : **: : .        

lef_B.anthracis_Ames_Anc._      LVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRI 536
B.anthracis_A2012               LVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRI 536
B.cereus_G9241                  --------------------------------------------------
                                                                                  

lef_B.anthracis_Ames_Anc._      QLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKS 586
B.anthracis_A2012               QLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKS 586
B.cereus_G9241                  ------------------------RVSELQFGKKYEDYNLRQNGIINEE- 366
                                                        .:.::*: *: *.  :* :. :  : 

lef_B.anthracis_Ames_Anc._      KIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVESAYLIL 636
B.anthracis_A2012               KIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVESAYLIL 636
B.cereus_G9241                  ------------------KVMELESNFKGQTFIQHNYMSTSLVQDPHQSY 398
                                                  *.: * .  *  **  **  ::.:*:..:   

lef_B.anthracis_Ames_Anc._      NEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQV 686
B.anthracis_A2012               NEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQV 686
B.cereus_G9241                  SNDR--------------------YPILLEITIP---------EGVHGAY 419
                                .: :                      :: :**:*         : ::   

lef_B.anthracis_Ames_Anc._      HSKGLYVPESRSILLHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKN 736
B.anthracis_A2012               HSKGLYVPESRSILLHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKN 736
B.cereus_G9241                  IADMSEYPGQYEMLIN--------------------------RGYTFKYD 443
                                 :.    * . .:*::                           ** :. :

lef_B.anthracis_Ames_Anc._      QSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERL 786
B.anthracis_A2012               QSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERL 786
B.cereus_G9241                  KFSIVKPTR--------EEDKGKEYLKVNLSIYLGNLNREK--------- 476
                                : .:*. ::        * .: ..* :.* : ::.:  *           

lef_B.anthracis_Ames_Anc._      KVQKNAPKTFQFINDQIKFIINS 809
B.anthracis_A2012               KVQKNAPKTFQFINDQIKFIINS 809
B.cereus_G9241                  -----------------------
                                                       
PLEASE NOTE: Showing colors on large alignments is slow.




Guide Tree

(
lef_B.anthracis_Ames_Anc._:0.00000,
B.anthracis_A2012:0.00000,
B.cereus_G9241:0.74160);


Phylogram

Right-click on the above tree to see display options.
Problems printing? Read how to print a Phylogram or Cladogram.
spacer
spacer