spacer

ClustalW Results


Results of search
Number of sequences 13
Alignment score 35423
Sequence format Pearson
Sequence type aa
ClustalW version 1.83
JalView
Output file clustalw-20070528-19424989.output
Alignment file clustalw-20070528-19424989.aln
Guide tree file clustalw-20070528-19424989.dnd
Your input file clustalw-20070528-19424989.input

To save a result file right-click the file link in the above table and choose "Save Target As".
If you cannot see the JalView button, reload the page and check your browser settings to enable Java Applets.




Scores Table

SeqA Name                             Len(aa)  SeqB Name                             Len(aa)  Score
===================================================================================================
1    capA_B.anthracis_Ames            411      2    B.licheniformis_ATCC14580        389      47   
1    capA_B.anthracis_Ames            411      3    B.subtilis_subsp.sub._str168     380      50   
1    capA_B.anthracis_Ames            411      4    Geobacter_sulfurreducens_PCA     351      28   
1    capA_B.anthracis_Ames            411      5    Pelobacter_propionicus_DSM2379   340      26   
1    capA_B.anthracis_Ames            411      6    Clostridium_thermocellum_ATCC2   411      21   
1    capA_B.anthracis_Ames            411      7    Myxococcus_xanthus_DK1622]       405      22   
1    capA_B.anthracis_Ames            411      8    B.cereus_G9241                   367      24   
1    capA_B.anthracis_Ames            411      9    Bacillus_weihenstephanensis_KB   367      23   
1    capA_B.anthracis_Ames            411      10   B.anthracis_str.Ames             367      23   
1    capA_B.anthracis_Ames            411      11   Listeria_monocytogenes_str.4b_   372      24   
1    capA_B.anthracis_Ames            411      12   Bdellovibrio_bacteriovorus_HD1   370      21   
1    capA_B.anthracis_Ames            411      13   Streptococcus_thermophilus_LMG   393      21   
2    B.licheniformis_ATCC14580        389      3    B.subtilis_subsp.sub._str168     380      67   
2    B.licheniformis_ATCC14580        389      4    Geobacter_sulfurreducens_PCA     351      26   
2    B.licheniformis_ATCC14580        389      5    Pelobacter_propionicus_DSM2379   340      25   
2    B.licheniformis_ATCC14580        389      6    Clostridium_thermocellum_ATCC2   411      23   
2    B.licheniformis_ATCC14580        389      7    Myxococcus_xanthus_DK1622]       405      21   
2    B.licheniformis_ATCC14580        389      8    B.cereus_G9241                   367      24   
2    B.licheniformis_ATCC14580        389      9    Bacillus_weihenstephanensis_KB   367      25   
2    B.licheniformis_ATCC14580        389      10   B.anthracis_str.Ames             367      24   
2    B.licheniformis_ATCC14580        389      11   Listeria_monocytogenes_str.4b_   372      23   
2    B.licheniformis_ATCC14580        389      12   Bdellovibrio_bacteriovorus_HD1   370      20   
2    B.licheniformis_ATCC14580        389      13   Streptococcus_thermophilus_LMG   393      19   
3    B.subtilis_subsp.sub._str168     380      4    Geobacter_sulfurreducens_PCA     351      26   
3    B.subtilis_subsp.sub._str168     380      5    Pelobacter_propionicus_DSM2379   340      23   
3    B.subtilis_subsp.sub._str168     380      6    Clostridium_thermocellum_ATCC2   411      25   
3    B.subtilis_subsp.sub._str168     380      7    Myxococcus_xanthus_DK1622]       405      22   
3    B.subtilis_subsp.sub._str168     380      8    B.cereus_G9241                   367      24   
3    B.subtilis_subsp.sub._str168     380      9    Bacillus_weihenstephanensis_KB   367      25   
3    B.subtilis_subsp.sub._str168     380      10   B.anthracis_str.Ames             367      25   
3    B.subtilis_subsp.sub._str168     380      11   Listeria_monocytogenes_str.4b_   372      22   
3    B.subtilis_subsp.sub._str168     380      12   Bdellovibrio_bacteriovorus_HD1   370      21   
3    B.subtilis_subsp.sub._str168     380      13   Streptococcus_thermophilus_LMG   393      21   
4    Geobacter_sulfurreducens_PCA     351      5    Pelobacter_propionicus_DSM2379   340      51   
4    Geobacter_sulfurreducens_PCA     351      6    Clostridium_thermocellum_ATCC2   411      29   
4    Geobacter_sulfurreducens_PCA     351      7    Myxococcus_xanthus_DK1622]       405      33   
4    Geobacter_sulfurreducens_PCA     351      8    B.cereus_G9241                   367      25   
4    Geobacter_sulfurreducens_PCA     351      9    Bacillus_weihenstephanensis_KB   367      25   
4    Geobacter_sulfurreducens_PCA     351      10   B.anthracis_str.Ames             367      25   
4    Geobacter_sulfurreducens_PCA     351      11   Listeria_monocytogenes_str.4b_   372      24   
4    Geobacter_sulfurreducens_PCA     351      12   Bdellovibrio_bacteriovorus_HD1   370      20   
4    Geobacter_sulfurreducens_PCA     351      13   Streptococcus_thermophilus_LMG   393      18   
5    Pelobacter_propionicus_DSM2379   340      6    Clostridium_thermocellum_ATCC2   411      31   
5    Pelobacter_propionicus_DSM2379   340      7    Myxococcus_xanthus_DK1622]       405      31   
5    Pelobacter_propionicus_DSM2379   340      8    B.cereus_G9241                   367      26   
5    Pelobacter_propionicus_DSM2379   340      9    Bacillus_weihenstephanensis_KB   367      26   
5    Pelobacter_propionicus_DSM2379   340      10   B.anthracis_str.Ames             367      25   
5    Pelobacter_propionicus_DSM2379   340      11   Listeria_monocytogenes_str.4b_   372      21   
5    Pelobacter_propionicus_DSM2379   340      12   Bdellovibrio_bacteriovorus_HD1   370      22   
5    Pelobacter_propionicus_DSM2379   340      13   Streptococcus_thermophilus_LMG   393      14   
6    Clostridium_thermocellum_ATCC2   411      7    Myxococcus_xanthus_DK1622]       405      21   
6    Clostridium_thermocellum_ATCC2   411      8    B.cereus_G9241                   367      28   
6    Clostridium_thermocellum_ATCC2   411      9    Bacillus_weihenstephanensis_KB   367      27   
6    Clostridium_thermocellum_ATCC2   411      10   B.anthracis_str.Ames             367      26   
6    Clostridium_thermocellum_ATCC2   411      11   Listeria_monocytogenes_str.4b_   372      24   
6    Clostridium_thermocellum_ATCC2   411      12   Bdellovibrio_bacteriovorus_HD1   370      16   
6    Clostridium_thermocellum_ATCC2   411      13   Streptococcus_thermophilus_LMG   393      19   
7    Myxococcus_xanthus_DK1622]       405      8    B.cereus_G9241                   367      24   
7    Myxococcus_xanthus_DK1622]       405      9    Bacillus_weihenstephanensis_KB   367      25   
7    Myxococcus_xanthus_DK1622]       405      10   B.anthracis_str.Ames             367      26   
7    Myxococcus_xanthus_DK1622]       405      11   Listeria_monocytogenes_str.4b_   372      21   
7    Myxococcus_xanthus_DK1622]       405      12   Bdellovibrio_bacteriovorus_HD1   370      21   
7    Myxococcus_xanthus_DK1622]       405      13   Streptococcus_thermophilus_LMG   393      14   
8    B.cereus_G9241                   367      9    Bacillus_weihenstephanensis_KB   367      92   
8    B.cereus_G9241                   367      10   B.anthracis_str.Ames             367      94   
8    B.cereus_G9241                   367      11   Listeria_monocytogenes_str.4b_   372      47   
8    B.cereus_G9241                   367      12   Bdellovibrio_bacteriovorus_HD1   370      22   
8    B.cereus_G9241                   367      13   Streptococcus_thermophilus_LMG   393      16   
9    Bacillus_weihenstephanensis_KB   367      10   B.anthracis_str.Ames             367      91   
9    Bacillus_weihenstephanensis_KB   367      11   Listeria_monocytogenes_str.4b_   372      47   
9    Bacillus_weihenstephanensis_KB   367      12   Bdellovibrio_bacteriovorus_HD1   370      23   
9    Bacillus_weihenstephanensis_KB   367      13   Streptococcus_thermophilus_LMG   393      11   
10   B.anthracis_str.Ames             367      11   Listeria_monocytogenes_str.4b_   372      47   
10   B.anthracis_str.Ames             367      12   Bdellovibrio_bacteriovorus_HD1   370      22   
10   B.anthracis_str.Ames             367      13   Streptococcus_thermophilus_LMG   393      17   
11   Listeria_monocytogenes_str.4b_   372      12   Bdellovibrio_bacteriovorus_HD1   370      18   
11   Listeria_monocytogenes_str.4b_   372      13   Streptococcus_thermophilus_LMG   393      19   
12   Bdellovibrio_bacteriovorus_HD1   370      13   Streptococcus_thermophilus_LMG   393      17   
===================================================================================================
PLEASE NOTE: Some scores may be missing from the above table if the alignment was done using multiple CPU mode. Please check the output.




Alignment

CLUSTAL W (1.83) multiple sequence alignment


B.licheniformis_ATCC14580           MKKQLNFQEKLLKLT--------------------KQEKKKTNKHVFIVL 30
B.subtilis_subsp.sub._str168        MKKELSFHEKLLKLT--------------------KQQKKKTNKHVFIAI 30
capA_B.anthracis_Ames               MRRKLTFQEKLLIFI--------------------KKTKKKNPRYVAIVL 30
Geobacter_sulfurreducens_PCA        --MTIFPAALTLVLV--------------------LLAVP---------- 18
Pelobacter_propionicus_DSM2379      --MKSAIILFITALL--------------------PLLCP---------- 18
Myxococcus_xanthus_DK1622]          MRHVALLLLMLSACH--------------------PRTIPPPEPLPPEEP 30
B.cereus_G9241                      -MKTLLKRFLLIA----------------------FCITPIVLLINYSFT 27
B.anthracis_str.Ames                -MKTLLKRFLLIA----------------------FCITPIVVLINHSFT 27
Bacillus_weihenstephanensis_KB      -MKTLLKRFLLIA----------------------FFITPIVLLINYSFI 27
Listeria_monocytogenes_str.4b_      -MKSRKKGIILVLSI--------------------IIIFSIGLLVNNIMT 29
Clostridium_thermocellum_ATCC2      MRKKYVALAVIVFLIGISALGGCNFRSDSVAVVNEKNTGTYENDLDQKKV 50
Bdellovibrio_bacteriovorus_HD1      --MRLNKAFLIASLL----------------------------------- 13
Streptococcus_thermophilus_LMG      MTNKILMRLIALVVG----------------------------------- 15
                                                                                      

B.licheniformis_ATCC14580           PVIFCLMFVFTWVGSAKTPSQMDKKEDAKLTATFVGDIMMGR-------- 72
B.subtilis_subsp.sub._str168        PIVFVLMFAFMWAGKAETP-KVKTYSDDVLSASFVGDIMMGR-------- 71
capA_B.anthracis_Ames               PLIAVILIAATWVQRTEAVAPVKHRENEKLTMTMVGDIMMGR-------- 72
Geobacter_sulfurreducens_PCA        ----------------------AGALAERISLSFVGDVMLAG-------- 38
Pelobacter_propionicus_DSM2379      ----------------------AVATAQEIVVNAVGDIMLAG-------- 38
Myxococcus_xanthus_DK1622]          AGQSPAPGDAGQAPAPPIGAPAAEPPARSVSIIVGGDVTLGHNYQTHYDA 80
B.cereus_G9241                      S-KAKDKPDLQNKSSKTASNSEKKIENPEITLTFSGDTMFDW-------- 68
B.anthracis_str.Ames                S-KATDKPDFQNKSSKTASKSDKKIEDPEITLTFSGDTMFDW-------- 68
Bacillus_weihenstephanensis_KB      S-KAKDKPDMQNKSSKTASKSEKKTEDPEITLTFSGDTMFDW-------- 68
Listeria_monocytogenes_str.4b_      NNKDTAKPKKKTVAAVKKKKETPPKPKEPFNIDFTGDIMFDW-------- 71
Clostridium_thermocellum_ATCC2      ADAAKDGTVGTVSETVYSTVQPTATPEKELKIVAVGDILLGRG------- 93
Bdellovibrio_bacteriovorus_HD1      ------------FATSAHANKGANCADGSVVLGFAGDILVHD-------- 43
Streptococcus_thermophilus_LMG      ----LLFLEILIIHSKNEQQKSVSNQVQTARIMANGDLLYHDG-----LY 56
                                                                       **             

B.licheniformis_ATCC14580           -NVEKVTNLHGSESVFKNVKPYFNVSDFITGNFENPVTN---AKDYQEAE 118
B.subtilis_subsp.sub._str168        -YVEKVTEQKGADSIFQYVEPIFRASDYVAGNFENPVTY---QKNYKQAD 117
capA_B.anthracis_Ames               -HVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLE-DKKNYQKAD 120
Geobacter_sulfurreducens_PCA        -SATDTLQRYGYSYPFSATAAELRRSDLVVGNLEAPLTD----GGREFRA 83
Pelobacter_propionicus_DSM2379      -RWTADLRAAGYDPLFDNLRDELARGDINLANLESPLAR----CGREFTT 83
Myxococcus_xanthus_DK1622]          ETAKGRPQDALLAYGFQEVKPLTDAADLFVVNLECPFTE----RG-EKLP 125
B.cereus_G9241                      -QLRPVIEKNGADYPFQHVKEEIKKADISFVNLESAFTT----REKKAPG 113
B.anthracis_str.Ames                -QLRPVIEKNGADYPFQHVKEEITKADISFVNLESAFTT----KEKKAPG 113
Bacillus_weihenstephanensis_KB      -QLRPVIEKNGADYPFQHVKEEITKADISFVNLESAFTT----REKRVPG 113
Listeria_monocytogenes_str.4b_      -DLRPVLAEKGMDYPFNNVREELKSSDYTFVDLETAITT----RTKKVPY 116
Clostridium_thermocellum_ATCC2      VGMRLKNGNKDFTYPFLEVRDILRKGDVVFGNLEEPITSSTHSLTGIKEG 143
Bdellovibrio_bacteriovorus_HD1      ALYKNILPKQNFTSLWSKAIPLFNKADYMTVNLEGPAAVGIDKAGRDVGD 93
Streptococcus_thermophilus_LMG      MSALQADGSYDFTENFTYVKPWLKQADLVLGDFEGTINP-----DYPLSG 101
                                                   :         .*    ::* .              

B.licheniformis_ATCC14580           K------------NIHLQTNQESVETLKKLNFSVLNFANNHAMDYGEDGL 156
B.subtilis_subsp.sub._str168        K------------EIHLQTNKESVKVLKDMNFTVLNSANNHAMDYGVQGM 155
capA_B.anthracis_Ames               K------------NIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGT 158
Geobacter_sulfurreducens_PCA        K------------RFRFKASPVAAAALKRAGFSVMTLANNHMMDFGADGL 121
Pelobacter_propionicus_DSM2379      K------------KFRFRGEPAVAPALRRAGFNLVTLANNHSMDFGWPAL 121
Myxococcus_xanthus_DK1622]          K------------NFNFRAKPELVGILTAGGVDVVSLANNHLMDYGAQGL 163
B.cereus_G9241                      Q------------LFWIKSDPSTLQAIKNTGYDIVNIGNNHTLDYGQEGL 151
B.anthracis_str.Ames                Q------------LFWIKSDPSTLQAIKNTGYDIVNIGNNHTLDYGQNGL 151
Bacillus_weihenstephanensis_KB      Q------------QFWIKSDPSTLQAIKNTGYDIVNIGNNHTLDYGQDGL 151
Listeria_monocytogenes_str.4b_      Q------------EFWIKSDPSSLTALKNAGVDMVNISNNHILDYYEDGL 154
Clostridium_thermocellum_ATCC2      G------------KYVLKNDVEAIEGIKYAGFNLMNLANNHILDYYERGL 181
Bdellovibrio_bacteriovorus_HD1      QGFTYDLNVYSGTNFSFNFHPQILRDLKSSNIDLISTANNHSLDRQWRGV 143
Streptococcus_thermophilus_LMG      YP-------------LFNAPQSVTAVISDAGYDVMDLAHNHILDSGLEGA 138
                                                    :         :   .  ::  .:**  *    . 

B.licheniformis_ATCC14580           KDTLNKFSNENLELVGAGNNLEDAKQHVSYQNVNGVKIATLGFTDVYT-- 204
B.subtilis_subsp.sub._str168        KDTLGEFAKQNLDIVGAGYSLSDAKKKISYQKVNGVTIATLGFTDVSG-- 203
capA_B.anthracis_Ames               KDTIKAFKEADLDYVGAGENFKDVKN-IVYQNVNGVRVATLGFTDAFV-- 205
Geobacter_sulfurreducens_PCA        SDTIHHLNRNGIAFAGAGPSIADARR-EASVTVRGQTVAFLAYSLT---- 166
Pelobacter_propionicus_DSM2379      AETRGHLKDAGIAWIGAGENLEQARR-MALFTVRGKRVAFLGYSLT---- 166
Myxococcus_xanthus_DK1622]          LDTLDTLDAAHIPYFGAGRNLAEARR-PAIVTVGGQRVALLGYFFLGTRN 212
B.cereus_G9241                      LDTISHVEKLKFPYIGAGKNAKDAYT-AREMTVKGKKFKFLSFVRFMP-- 198
B.anthracis_str.Ames                LDTISHVEKLKFPYIGAGKNAKDAYT-AREMTVKGKKFKFLSFVRFMP-- 198
Bacillus_weihenstephanensis_KB      LDTISHVEKLKLPYTGAGKNAEDAYT-ARELTVKGKKFKFLSFVRFMP-- 198
Listeria_monocytogenes_str.4b_      LDTTAALRANNLAYVGAGKNEDEAYQ-LKVADIKGNKVGFMSFCHFFP-- 201
Clostridium_thermocellum_ATCC2      FDTMDILDKNGIKYAGAGRNLEEARK-PAIMEVKSMKVGMLAYTDMAEIV 230
Bdellovibrio_bacteriovorus_HD1      DRTIEAAKNIGLSTVGTRPSYAPNESFYHLADVRGYRMAFVACTEATN-- 191
Streptococcus_thermophilus_LMG      FTTADAFKEVGIDPVGVYENPVHDKAPLFIKNVNGIKVAILSYAYGFN-- 186
                                      *        :   *.  .            : .  .  :.        

B.licheniformis_ATCC14580           ------KNFTAKKNRGGVLPLSPKI--FIPMIAEASK----KADLVLVHV 242
B.subtilis_subsp.sub._str168        ------KGFAAKKNTPGVLPADPEI--FIPMISEAKK----HADIVVVQS 241
capA_B.anthracis_Ames               ------AGAIATKEQPGSLSMNPDV--LLKQISKAKDPKKGNADLVVVNT 247
Geobacter_sulfurreducens_PCA        ----QPIEFFATEGRPGTAPGY------AGHYLADIRRVRSSADHVVVSF 206
Pelobacter_propionicus_DSM2379      ----QPLEFFAAPRRPGTAPGY------AKLVAADVAAARGKADYVIVSF 206
Myxococcus_xanthus_DK1622]          I---EPPGVYATETTPGVAGHFSDEAVMEQMLREDIAAARAQADIVLPYF 259
B.cereus_G9241                      -----DTNWVAGDNKPGVANGYDLN--LVTKTIKEQ---KKDADYLIVYM 238
B.anthracis_str.Ames                -----DFTWVADDNKPGVANGYDLN--LVTKTIKEQ---KKDADYLIVYM 238
Bacillus_weihenstephanensis_KB      -----NFNWVAGDNKPGVANGYDLD--LVTKTIQEQ---KKDADYVIVYM 238
Listeria_monocytogenes_str.4b_      -----NTGWIADEDTPGVTNGYDIN--LVEEKIKEERAKNKDIDYMVVYF 244
Clostridium_thermocellum_ATCC2      YKGNPNYKFAAGEDKPGVAPRPLKFD---DSIKKDIEELRSKVDILIVSL 277
Bdellovibrio_bacteriovorus_HD1      -------GIADTKSQVLSCYGKSQQ---VETLIRQLR-ARGDVDGVIVLP 230
Streptococcus_thermophilus_LMG      -------GLESNLTEKEIANHLSNLD--EKRMKVEIERAEKEADVTVIMP 227
                                                                               *  :   

B.licheniformis_ATCC14580           HWGQEYDNEPNDRQKDLAKAIADAG-ADVIIGAHPHVLEPIEVYNG---- 287
B.subtilis_subsp.sub._str168        HWGQEYDNDPNDRQRQLARAMSDAG-ADIIVGHHPHVLEPIEVYNG---- 286
capA_B.anthracis_Ames               HWGEEYDNKPSPRQEALAKAMVDAG-ADIIVGHHPHVLQSFDVYKQ---- 292
Geobacter_sulfurreducens_PCA        HWGQERAALPSPYQIETAHRAIDAG-ADIVIGHHPHVLQGIEIYRG---- 251
Pelobacter_propionicus_DSM2379      HWGREASTTVQAYQRDTAHRAIDAG-ADVIIGHHPHVLQGVERYRR---- 251
Myxococcus_xanthus_DK1622]          HWGREGTYTPEPYQVRLAHVAIDAG-AAGVLGAHPHVLQAMELYQG---- 304
B.cereus_G9241                      HWGVEKSNRPVEYQKQYVPKMVEAG-ADAIVGSHPHWLQGFEYYNK---- 283
B.anthracis_str.Ames                HWGVEKSNRPVDYQKQYVNKMVTAG-ADAIVGSHPHWLQGFEYYNN---- 283
Bacillus_weihenstephanensis_KB      HWGVEKSNRPIEYQKQYVPKMVEAG-ADAIVGSHPHWLQGFEYYNK---- 283
Listeria_monocytogenes_str.4b_      HWGVEKTNTPVDYQTQYVKKLVDDHLVDAIVASHPHWLQSFEVYKD---- 290
Clostridium_thermocellum_ATCC2      HWGVEESFEVLPEQREFAHSLIDNG-VDVILGHHPHQFQGIEIYKG---- 322
Bdellovibrio_bacteriovorus_HD1      HWGVEYSHKPDKSQTAYAKRFLEAG-AVAVVGSHPHVLQPWESYRTSDGR 279
Streptococcus_thermophilus_LMG      QMGVEYRLEPTDEQVKLYHKMIDWG-ADIIFGGHPHVVEPSEVVKK-DGQ 275
                                    : * *        *            .  :.. *** .:  :  .     

B.licheniformis_ATCC14580           -TVIFYSLGNFVFDQGWSRTR--------DSALVQYHLMNDGKGRFEVTP 328
B.subtilis_subsp.sub._str168        -TVIFYSLGNFVFDQGWTRTR--------DSALVQYHLKKNGTGRFEVTP 327
capA_B.anthracis_Ames               -GIIFYSLGNFVFDQGWTRTK--------DSALVQYHLRDNGTAILDVVP 333
Geobacter_sulfurreducens_PCA        -SPIFYSLGNFAFG-SRSPSA--------DRSIIAR--VTLGEGPPIVEV 289
Pelobacter_propionicus_DSM2379      -GIIFYSLGNFAFA-STSTIA--------DVSALVR--LRLDGRQRQAEL 289
Myxococcus_xanthus_DK1622]          -RPVVYSLGNFVFGGNWNPRD--------KRGALWKGHFGPDGGYLSSEI 345
B.cereus_G9241                      -VPIAYSLGNFLFPSYVSGKS--------AETGVLTLTFKGKDVQMSFNP 324
B.anthracis_str.Ames                -VPVAYSLGNFLFPSYVNGKS--------AETGVLTLTFKGKDVQMSFNP 324
Bacillus_weihenstephanensis_KB      -VPIAYSLGNFLFPNYVNGKS--------AETGVLTLTFKGKDVQMSFNP 324
Listeria_monocytogenes_str.4b_      -VPIAYSLGNFLFPDYVSGHS--------AETGIYKLNFNQGKVTAHFDP 331
Clostridium_thermocellum_ATCC2      -KPVFYSLGNFIFDQNDPENQ--------ESFIVTLDYKGSRLTGIEAVP 363
Bdellovibrio_bacteriovorus_HD1      LTMIVYSLGNFLAFQAGVEKK--------TGAVVYLHLGRDVQGRTQVLT 321
Streptococcus_thermophilus_LMG      QKLIIYSMGNFISNQRIETVDGVDNAAWTERSVLMDVTLEKKNCQTTIKT 325
                                       : **:***                      :                

B.licheniformis_ATCC14580           LNIR-------EATPTPLGKSDFLKRKAIFRQLTKGT--NLDWKEENGKL 369
B.subtilis_subsp.sub._str168        IDIH-------EATPAPVKK-DSLKQKTIIRELTKDS--NFAWKVEDGKL 367
capA_B.anthracis_Ames               LNIQ-------EGSPKPVTS--ALDKNRVYRQLTKDTSKGALWSKKDDKL 374
Geobacter_sulfurreducens_PCA        IPLN-VLFREVRFQPAILTGRKAADVVDRLNRLSAPFSTVITSTAGSHLV 338
Pelobacter_propionicus_DSM2379      LPLD-VLYRRVRFQPRLLKGDRGAAVISRINELSRPFRTEIREMGGRYVV 338
Myxococcus_xanthus_DK1622]          LPLRTDRFPELPFQPVPVTGEAAEAVLRLLAESSEGVERMLPELEPWARP 395
B.cereus_G9241                      YAIR-------NNQVSPVNEEEKRKALQYLQTISTDVEIDDTGKIKNQRN 367
B.anthracis_str.Ames                YIIR-------NNQVSPVNEEEKRKALQYLQTISTDVEIDDTGKIINKRN 367
Bacillus_weihenstephanensis_KB      YIIR-------NNQVSPVNEEEKKKALQYLQTVSTDVEIDDTGKIINKRN 367
Listeria_monocytogenes_str.4b_      GIIS-------GNQINMLDGSAKTAQLNYLQSISPNATINSNGDISAK-- 372
Clostridium_thermocellum_ATCC2      VRTIG------KIQVVPQKGDEAKPILEREKNLCNRLDTNCIIKDDKLYF 407
Bdellovibrio_bacteriovorus_HD1      SYYTP-----TYRDGYTVYPISSKGSKDALKEAARHLGTQNRLEPDQKIP 366
Streptococcus_thermophilus_LMG      AQAHPTWVNRTPKGTISPEGYPLYTYQTYILEDFIKGRKYRNKLDEETKE 375
                                                                                      

B.licheniformis_ATCC14580           TFEVDHA---DKLKNNKNGVVNK-------------- 389
B.subtilis_subsp.sub._str168        TFDIDHS---DKLKSK--------------------- 380
capA_B.anthracis_Ames               EIKLNHKHVIEKMKKREKQEHQDKQEKENQVSVETTT 411
Geobacter_sulfurreducens_PCA        APAEANARLARRQ------------------------ 351
Pelobacter_propionicus_DSM2379      LF----------------------------------- 340
Myxococcus_xanthus_DK1622]          PPSPEVRGRE--------------------------- 405
B.cereus_G9241                      -------------------------------------
B.anthracis_str.Ames                -------------------------------------
Bacillus_weihenstephanensis_KB      -------------------------------------
Listeria_monocytogenes_str.4b_      -------------------------------------
Clostridium_thermocellum_ATCC2      EIGK--------------------------------- 411
Bdellovibrio_bacteriovorus_HD1      HCNQ--------------------------------- 370
Streptococcus_thermophilus_LMG      RIDTAYKEMNAHVNLKWK------------------- 393
                                                                         
PLEASE NOTE: Showing colors on large alignments is slow.




Guide Tree

(
(
(
(
capA_B.anthracis_Ames:0.25260,
(
B.licheniformis_ATCC14580:0.16590,
B.subtilis_subsp.sub._str168:0.16042)
:0.09385)
:0.11432,
(
Bdellovibrio_bacteriovorus_HD1:0.40214,
Streptococcus_thermophilus_LMG:0.41948)
:0.01148)
:0.01714,
(
(
(
B.cereus_G9241:0.03020,
B.anthracis_str.Ames:0.02974)
:0.00967,
Bacillus_weihenstephanensis_KB:0.04210)
:0.21045,
Listeria_monocytogenes_str.4b_:0.27047)
:0.11118)
:0.00842,
(
(
Geobacter_sulfurreducens_PCA:0.23738,
Pelobacter_propionicus_DSM2379:0.24498)
:0.08077,
Myxococcus_xanthus_DK1622]:0.35399)
:0.03335,
Clostridium_thermocellum_ATCC2:0.36802);


Cladogram

Right-click on the above tree to see display options.
Problems printing? Read how to print a Phylogram or Cladogram.
spacer
spacer