spacer

ClustalW Results


Results of search
Number of sequences 15
Alignment score 287585
Sequence format Pearson
Sequence type aa
ClustalW version 1.83
JalView
Output file clustalw-20070607-02081783.output
Alignment file clustalw-20070607-02081783.aln
Guide tree file clustalw-20070607-02081783.dnd
Your input file clustalw-20070607-02081783.input

To save a result file right-click the file link in the above table and choose "Save Target As".
If you cannot see the JalView button, reload the page and check your browser settings to enable Java Applets.




Scores Table

SeqA Name                     Len(aa)  SeqB Name                     Len(aa)  Score
===================================================================================
1    Psittacid                1081     2    ILTV                     1007     56   
1    Psittacid                1081     3    MDV-2.                   1190     46   
1    Psittacid                1081     4    HVT.                     1205     49   
1    Psittacid                1081     5    HSV-1.                   1235     50   
1    Psittacid                1081     6    HSV-2.                   1240     50   
1    Psittacid                1081     7    VZV.                     1194     48   
1    Psittacid                1081     8    PRV.                     1048     49   
1    Psittacid                1081     9    Bovineherpesvirus        1246     51   
1    Psittacid                1081     10   Humancytomegalovirus.    1242     32   
1    Psittacid                1081     11   Murinecytomegalovirus.   1097     32   
1    Psittacid                1081     12   Humanherpesvirus         1015     34   
1    Psittacid                1081     13   Equineherpesvirus        1008     35   
1    Psittacid                1081     14   VHV.                     1219     51   
1    Psittacid                1081     15   MDV-1_                   1218     48   
2    ILTV                     1007     3    MDV-2.                   1190     44   
2    ILTV                     1007     4    HVT.                     1205     46   
2    ILTV                     1007     5    HSV-1.                   1235     45   
2    ILTV                     1007     6    HSV-2.                   1240     45   
2    ILTV                     1007     7    VZV.                     1194     44   
2    ILTV                     1007     8    PRV.                     1048     44   
2    ILTV                     1007     9    Bovineherpesvirus        1246     47   
2    ILTV                     1007     10   Humancytomegalovirus.    1242     31   
2    ILTV                     1007     11   Murinecytomegalovirus.   1097     31   
2    ILTV                     1007     12   Humanherpesvirus         1015     32   
2    ILTV                     1007     13   Equineherpesvirus        1008     30   
2    ILTV                     1007     14   VHV.                     1219     47   
2    ILTV                     1007     15   MDV-1_                   1218     46   
3    MDV-2.                   1190     4    HVT.                     1205     69   
3    MDV-2.                   1190     5    HSV-1.                   1235     51   
3    MDV-2.                   1190     6    HSV-2.                   1240     50   
3    MDV-2.                   1190     7    VZV.                     1194     50   
3    MDV-2.                   1190     8    PRV.                     1048     54   
3    MDV-2.                   1190     9    Bovineherpesvirus        1246     53   
3    MDV-2.                   1190     10   Humancytomegalovirus.    1242     28   
3    MDV-2.                   1190     11   Murinecytomegalovirus.   1097     29   
3    MDV-2.                   1190     12   Humanherpesvirus         1015     35   
3    MDV-2.                   1190     13   Equineherpesvirus        1008     36   
3    MDV-2.                   1190     14   VHV.                     1219     55   
3    MDV-2.                   1190     15   MDV-1_                   1218     75   
4    HVT.                     1205     5    HSV-1.                   1235     50   
4    HVT.                     1205     6    HSV-2.                   1240     51   
4    HVT.                     1205     7    VZV.                     1194     54   
4    HVT.                     1205     8    PRV.                     1048     56   
4    HVT.                     1205     9    Bovineherpesvirus        1246     53   
4    HVT.                     1205     10   Humancytomegalovirus.    1242     28   
4    HVT.                     1205     11   Murinecytomegalovirus.   1097     29   
4    HVT.                     1205     12   Humanherpesvirus         1015     36   
4    HVT.                     1205     13   Equineherpesvirus        1008     35   
4    HVT.                     1205     14   VHV.                     1219     55   
4    HVT.                     1205     15   MDV-1_                   1218     71   
5    HSV-1.                   1235     6    HSV-2.                   1240     90   
5    HSV-1.                   1235     7    VZV.                     1194     54   
5    HSV-1.                   1235     8    PRV.                     1048     58   
5    HSV-1.                   1235     9    Bovineherpesvirus        1246     55   
5    HSV-1.                   1235     10   Humancytomegalovirus.    1242     28   
5    HSV-1.                   1235     11   Murinecytomegalovirus.   1097     30   
5    HSV-1.                   1235     12   Humanherpesvirus         1015     38   
5    HSV-1.                   1235     13   Equineherpesvirus        1008     37   
5    HSV-1.                   1235     14   VHV.                     1219     55   
5    HSV-1.                   1235     15   MDV-1_                   1218     50   
6    HSV-2.                   1240     7    VZV.                     1194     54   
6    HSV-2.                   1240     8    PRV.                     1048     59   
6    HSV-2.                   1240     9    Bovineherpesvirus        1246     55   
6    HSV-2.                   1240     10   Humancytomegalovirus.    1242     29   
6    HSV-2.                   1240     11   Murinecytomegalovirus.   1097     30   
6    HSV-2.                   1240     12   Humanherpesvirus         1015     37   
6    HSV-2.                   1240     13   Equineherpesvirus        1008     37   
6    HSV-2.                   1240     14   VHV.                     1219     54   
6    HSV-2.                   1240     15   MDV-1_                   1218     49   
7    VZV.                     1194     8    PRV.                     1048     60   
7    VZV.                     1194     9    Bovineherpesvirus        1246     57   
7    VZV.                     1194     10   Humancytomegalovirus.    1242     28   
7    VZV.                     1194     11   Murinecytomegalovirus.   1097     29   
7    VZV.                     1194     12   Humanherpesvirus         1015     35   
7    VZV.                     1194     13   Equineherpesvirus        1008     34   
7    VZV.                     1194     14   VHV.                     1219     56   
7    VZV.                     1194     15   MDV-1_                   1218     51   
8    PRV.                     1048     9    Bovineherpesvirus        1246     66   
8    PRV.                     1048     10   Humancytomegalovirus.    1242     33   
8    PRV.                     1048     11   Murinecytomegalovirus.   1097     32   
8    PRV.                     1048     12   Humanherpesvirus         1015     36   
8    PRV.                     1048     13   Equineherpesvirus        1008     36   
8    PRV.                     1048     14   VHV.                     1219     62   
8    PRV.                     1048     15   MDV-1_                   1218     55   
9    Bovineherpesvirus        1246     10   Humancytomegalovirus.    1242     30   
9    Bovineherpesvirus        1246     11   Murinecytomegalovirus.   1097     31   
9    Bovineherpesvirus        1246     12   Humanherpesvirus         1015     36   
9    Bovineherpesvirus        1246     13   Equineherpesvirus        1008     37   
9    Bovineherpesvirus        1246     14   VHV.                     1219     56   
9    Bovineherpesvirus        1246     15   MDV-1_                   1218     53   
10   Humancytomegalovirus.    1242     11   Murinecytomegalovirus.   1097     51   
10   Humancytomegalovirus.    1242     12   Humanherpesvirus         1015     37   
10   Humancytomegalovirus.    1242     13   Equineherpesvirus        1008     37   
10   Humancytomegalovirus.    1242     14   VHV.                     1219     29   
10   Humancytomegalovirus.    1242     15   MDV-1_                   1218     27   
11   Murinecytomegalovirus.   1097     12   Humanherpesvirus         1015     37   
11   Murinecytomegalovirus.   1097     13   Equineherpesvirus        1008     35   
11   Murinecytomegalovirus.   1097     14   VHV.                     1219     31   
11   Murinecytomegalovirus.   1097     15   MDV-1_                   1218     29   
12   Humanherpesvirus         1015     13   Equineherpesvirus        1008     55   
12   Humanherpesvirus         1015     14   VHV.                     1219     35   
12   Humanherpesvirus         1015     15   MDV-1_                   1218     35   
13   Equineherpesvirus        1008     14   VHV.                     1219     37   
13   Equineherpesvirus        1008     15   MDV-1_                   1218     36   
14   VHV.                     1219     15   MDV-1_                   1218     54   
===================================================================================
PLEASE NOTE: Some scores may be missing from the above table if the alignment was done using multiple CPU mode. Please check the output.




Alignment

CLUSTAL W (1.83) multiple sequence alignment


Psittacid                   --------------------MAAFDNP-VFNKTLTPVAGAGPNFR----- 24
ILTV                        --------------------MDTFSSAGTGAARVAPIIGLGPHSG----- 25
PRV.                        -----------------------------------MAARQG--------- 6
Bovineherpesvirus           -------MDRDCEQGTAPPRAGFFNPYLAPR-GRGAPARQGPDIPDGAGE 42
VZV.                        ----------------MAIRTGFCNPFLTQASGIKYNPRTGRG------- 27
HSV-1.                      MFSGGGGPLSPGGKSAARAASGFFAPAGPRGASR-GPPPCLRQNFYNPYL 49
HSV-2.                      MFCAAGGPASPGGKSAARAASGFFAPHNPRGATQTAPPPCRRQNFYNPHL 50
VHV.                        ----------------MEGREGFYNPFLKKNRDLWKKNKDGQQ------- 27
MDV-2.                      --------------MSVDGARTFFNPYLGARKRGRDEDSTIPPLS----- 31
MDV-1_                      --------------MSVDGTKTFFNPYIGARKRSLEARNGLSFST----- 31
HVT.                        --------------MSIVGT-TFFNPCLERRKRKHDEQNALRYRI----- 30
Humancytomegalovirus.       ---------------------MFFNPYLSGGVTGGAVAGGRRQRSQP--- 26
Murinecytomegalovirus.      ---------------MDTCVETFFNPYLR-----------RKPRRDW--- 21
Humanherpesvirus            -----------------MSGGLFYNPFLRP------------NKGLL--- 18
Equineherpesvirus           -----------------MS---FYNPYLVKRT--------FLKKAAP--- 19
                                                                              

Psittacid                   ---------------ATYYTSVTEFTHVCPRSLIDG-------------- 45
ILTV                        ---------------ASYYTSVREFPYVCPTCINGG-------------- 46
PRV.                        ----------------SYVTRLSEFKFIAPRCLDAP-------------- 26
Bovineherpesvirus           APADEAAGRGGGRAAESYCTAASSFRFIAPRCLDADGADGGTDDEAAGAA 92
VZV.                        ---------SNREFLHSYKTTMSSFQFLAPKCLDEDVP------------ 56
HSV-1.                      APVGTQQKPTGPTQRHTYYSECDEFRFIAPRVLDEDAP------------ 87
HSV-2.                      AQTGTQPKAPGPAQRHTYYSECDEFRFIAPRSLDEDAP------------ 88
VHV.                        ----------SRRKDHSYYTDIKEFKFVAPRCLDEDAAP----------- 56
MDV-2.                      RPRDGERYLRQHRNAITYIATIDEFKYIAPKCLDAAEI------------ 69
MDV-1_                      GQNYDEKNNRRDRNSITYVTTIDEFKYIAPKCLDDKDV------------ 69
HVT.                        GQGRGAKH-----NLKTYITDLGEFKYISPKCLDVGNS------------ 63
Humancytomegalovirus.       ----------GSAQGSGKRPPQKQFLQIVPRGVMFDG------------- 53
Murinecytomegalovirus.      ----------RRCEDN-----NKNFLQVVPRGVLYDG------------- 43
Humanherpesvirus            ----------KKP--------DKEYLRLIPKCFQTPG------------- 37
Equineherpesvirus           ----------SRP--------TKEYTRIIPKCFKTPG------------- 38
                                                   .:  : *  .                 

Psittacid                   --ERLGTSVGKVADPPRFTVDDRTVDMFSHD--HGAWPMRMEHWPGTSAE 91
ILTV                        --GRIGTQIGRATSKPTFYHNERQLDILTST--HGAWPVRMKYWNAGPGM 92
PRV.                        --EQRGVHVGTLAREPTVYCGGATRPILR---GEPFWPRRVAAWEG--AP 69
Bovineherpesvirus           APRRRGVHIGTAERAPKVYLDGEEHDILDFA-GHCCWPRRVSVWAGRAAP 141
VZV.                        MEERKGVHVGTLSRPPKVYCNGKEVPILDFR-CSSPWPRRVNIWGEIDFR 105
HSV-1.                      PEKRAGVHDGHLKRAPKVYCGGDERDVLRVG-SGGFWPRRSRLWGGVDHA 136
HSV-2.                      AEQRTGVHDGRLRRAPKVYCGGDERDVLRVG-PEGFWPRRLRLWGGADHA 137
VHV.                        -SDRRGMHIGSLARSPKAYLNGKERNILEYS-GEEMWPRRMLVWDGVSYR 104
MDV-2.                      --KQRGTHIGKLKRSPILYKNGEEREFLNFEALGDAWPRRCFSWNNVSFL 117
MDV-1_                      --KQKGTHIGKLKRSPVLYKNGEEYVFLNFEDCEDVWPRRCSIWNNRSFL 117
HVT.                        --QQKGTHVGRLKRSPILYKNGDVYEFLDFDACTGIWPRRCSVWNGRSFL 111
Humancytomegalovirus.       ---QTGLIKHKTGRLPLMFYREIKHLLSHDMVWPCP-WRETLVGRVVG-- 97
Murinecytomegalovirus.      ---ATGLIKVQSGMEPRMFYAEKEYVLNPDKPWPTLRTRGWCRGPYSD-- 88
Humanherpesvirus            ---AAGVVDVRGPQPPLCFYQDSLTVVGGDEDGKGMWWR-QRAQEGTARP 83
Equineherpesvirus           ---AAGVVPHTSTLDPVCFVGDKETPILYGDGSRSLWSAGGRGGPGTGAG 85
                                 *         *          .                       

Psittacid                   RRRDKNALRFHEFHVYDIIEAHETAQSCSAWLHPR-FMETLRPSGTVVTL 140
ILTV                        THHNKGDVKFYEFHVYDLFENTEIAQSCVRWMHSR-FLDTLKPTGTVITL 141
PRV.                        ERP--VSPRFERFHVYDIVESTEYASA-----------DPRFPNGTVVTL 106
Bovineherpesvirus           ERAA-LDPRFERFHVYDIVETTEYPSAGDASRFAA---EARPGGATVVTL 187
VZV.                        GDK--FDPRFNTFHVYDIVETTEAASNGDVSRFAT---ATRPLG-TVITL 149
HSV-1.                      PAG--FNPTVTVFHVYDILENVEHAYGMRAAQFHARFMDAITPTGTVITL 184
HSV-2.                      PEG--FDPTVTVFHVYDILEHVEHAYSMRAAQLHERFMDAITPAGTVITL 185
VHV.                        PDG--YDPRFEKVHVYDFVETTETISADG-SHLAERFANSLRPSGTVVTL 151
MDV-2.                      PTE--FDPRFSRFHVYDMIETVEFANGATGRDKNR-FLELLRPMGTIITM 164
MDV-1_                      PAD--FDPRFSRFHVYDMIETVEFASAAIDRDKNR-FLELLRPMGTIVTM 164
HVT.                        PSD--FDPRFSRFHVYDMLETVDFADGAIDRDKNR-FCDLLRPMGTIVTM 158
Humancytomegalovirus.       ---------PIRFHTYDQTDAVLFFDSPENVSPRY--RQHLVPSGNVLRF 136
Murinecytomegalovirus.      ---------DVRFHTYDQVVNLVLADSDEQISPRW--NSHVVPAGNVIRM 127
Humanherpesvirus            EADT--HGSPLDFHVYDILETVYTHEKCAVIPSDK--QGYVVPCGIVIKL 129
Equineherpesvirus           QGHT--P-VALTFHVYDIIETVYGQDRCDHVPFQF--QTDIIPSGTVLKL 130
                                        .*.**                             :: :

Psittacid                   LG-MSACGKRVAVHVYGQQPYFYAKKSEIDASIGISTPGELAHAMAASLR 189
ILTV                        VG-NSACGKRVAVHVYGSLPYFFVKKREIDQAAKVTNSEELAHALALATR 190
PRV.                        LG-LSACGKRVAVHVYGVRHYFFLGKAEADAALGVASAEQLARALSAAAA 155
Bovineherpesvirus           LG-MSEDGKRVAVHVYGVRHYFYMEKAAVDLACGVRDEGQLIDAMVAALR 236
VZV.                        LG-MSRCGKRVAVHVYGICQYFYINKAEVDTACGIRSGSELSVLLAECLR 198
HSV-1.                      LG-LTPEGHRVAVHVYGTRQYFYMNKEEVDRHLQCRAPRDLCERMAAALR 233
HSV-2.                      LG-LTPEGHRVAVHVYGTRQYFYMNKAEVDRHLQCRAPRDLCERLAAALR 234
VHV.                        LG-MTACGKRIAIHVYGVSQYFYMNKVEIDAACGSKNGFDLAEKMASVLR 200
MDV-2.                      MG-MTECGRRVAVHVYGVKPYFYMRKIDVDTACGSRSTRGLAEQMASVVR 213
MDV-1_                      MG-ITECGKRVAVHVYGIKPYFYMRKVDTDTICGTRCPRELAEKLANVVR 213
HVT.                        LG-ITECGKRVAVHVYGIKPYFYMRKVEVDAACGCKCPRDLAENLATTIR 207
Humancytomegalovirus.       FG-ATEHGYSICVNVFGQRSYFYCEYSDTDRLREVIASVGELVPEP---- 181
Murinecytomegalovirus.      FG-ATDEGVSVCVNVFGQKAYFYCERMQSEDLKNTVYDIADKVPEP---- 172
Humanherpesvirus            LGRRKADGASVCVNVFGQQAYFYASAPQGLDVEFAVLSALKASTFDR--- 176
Equineherpesvirus           LG-RTSDDRSVCVNVFRQELYFYVRVPEGLKLDFLIQQCSRE-NFN---- 174
                            .*  .  .  :.::*:    **:                           

Psittacid                   SAAS-----------------RRSTFVEATAESFVIDVVQRRDIYYYES- 221
ILTV                        KTSL-----------------KNSPFLAVSAESFCIDVVRRRDIYYSES- 222
PRV.                        R---------------------GPRLGPADVDAR---VVDAAPVYYYDA- 180
Bovineherpesvirus           SSALAAGAAQQDAAGRAGARRPGGYLGRASRDSLSVAVVEAADVYFYDT- 285
VZV.                        SSMITQNDATLNGDKN---AFHGTSFKSASPESFRVEVIERTDVYYYDT- 244
HSV-1.                      ES-------------------PGASFRGISADHFEAEVVERTDVYYYET- 263
HSV-2.                      ES-------------------PGASFRGISADHFEAEVVERADVYYYET- 264
VHV.                        ASAFGGGGDGPAGRGNE-WSGPKFSFKTATADCFEIDVVTRTDVYYFDT- 248
MDV-2.                      SSVNESA----------RKRFYG--SSTVTADCFEVDVVRRKDIYFYGT- 250
MDV-1_                      SSVNEVAN---------AKRFCTPVTRTVSADCFEVDVVQRKDIYYYGT- 253
HVT.                        SSLMETTD---------GKRPCLFAARSVSADCFEIDIVRRRDVYYYGT- 247
Humancytomegalovirus.       ----------------------------RTPYAVSVTPATKTSIYGYGTR 203
Murinecytomegalovirus.      ----------------------------CSPFSVSISPVTKSSFYGYGLG 194
Humanherpesvirus            ----------------------------RTPCRVSVEKVTRRSIMGYGN- 197
Equineherpesvirus           ----------------------------FSQGRYRYEKTSKRVLREYCV- 195
                                                                       .      

Psittacid                   REEEYYRVKSCSAKYISFLCDNFC--RGVKKYEGGIDATTRFAVDNE-LF 268
ILTV                        EEEDFYRVKVCNGKVMKFICDNFF--PSVPKYESNVDAITRFILDNN-LT 269
PRV.                        PRRPFYRVSSNSGRLVAHLRETVC--AGLVTHEAGVDATTRLLLDHD-LP 227
Bovineherpesvirus           RPQLFYKVSSASARLGGYLCDNFL--PGVTKYEGHVDVTTRFLLDNEGFT 333
VZV.                        QPCAFYRVYSPSSKFTNYLCDNFH--PELKKYEGRVDATTRFLMDNPGFV 292
HSV-1.                      RPALFYRVYVRSGRVLSYLCDNFC--PAIKKYEGGVDATTRFILDNPGFV 311
HSV-2.                      RPTLYYRVFVRSGRALAYLCDNFC--PAIRKYEGGVDATTRFILDNPGFV 312
VHV.                        PSCEFYRIKARNGRFVSFICDNFY--PEVKKYEGNVDALTRLILDNAGFS 296
MDV-2.                      DCEEYYRIRCQSGKFVALICDNFH--PSIIKYEGSVDTITRMVLDNAGFS 298
MDV-1_                      GHDEFYRVKSQSGKFITLLCDNFY--PSIIKYEGNIDAITRMVLDNNGFS 301
HVT.                        ELEEYYRVKCQSGKYMSFICDNFH--PSITKYEGNVDSITRMVLDNAGFG 295
Humancytomegalovirus.       PVPDLQCVSISNWTMARKIGEYLL-EQGFPVYEVRVDPLTRLVIDRR-IT 251
Murinecytomegalovirus.      HIPNLYRLSFNNWNMCRKIGKRML-EEGRKVYELGVDPLARFLIDRK-IP 242
Humanherpesvirus            HAGDYHKITLSHPNSVCHVATWLQDKHGCRIFEANVDATRRFVLDND-FV 246
Equineherpesvirus           EAREVYRVFASSQGFVDLLAGGLT-AAGCEVFETNVDAARRFIIDNG-FS 243
                                   :          :   .        .*  :*   *: :*.  : 

Psittacid                   TFGWYRFKP--CAGAIQIRDVTRHSTSANVEVNCTVEN--LEVIRGRADW 314
ILTV                        SFGWYRFRA--QGGALQIRDPGQHATSADVEINCTASN--LELGN-NVSW 314
PRV.                        SFGWYRLRPGPAGERV-VLR-HQRLTSSDVEVNCTPLN---LARDEDGPW 272
Bovineherpesvirus           SFGWYRLRPGRAGARA-LRAPAQHATSCDVEVNCTADNLEPIAGAEADAW 382
VZV.                        SFGWYQLKPGVDGERVRVRPASRQLTLSDVEIDCMSDN--LQAIPNDDSW 340
HSV-1.                      TFGWYRLKPGRNNTLAQPAAPMAFGTSSDVEFNCTADN--LAIEGGMSDL 359
HSV-2.                      TFGWYRLKPGRGNAPAQPRPPTAFGTSSDVEFNCTADN--LAVEGAMCDL 360
VHV.                        TFGWYRLKPGCRGEKVQVRRTENHVTSSDVEINCTPDN--LEPDAEDAAW 344
MDV-2.                      TFGWYSLKIGNCGEKVQVRAPQHHVTSCDIEINCTVDN--LIGHPEDDHW 346
MDV-1_                      TFGWYSFKVGNNGEKVQVRAPCHHCTSCDIEINCTVDN--LIGYPEDDAW 349
HVT.                        TFGWYSLKVGDCGEKVQVRSPLHHVTSCDIEINCTVDN--LIGHPEDGIW 343
Humancytomegalovirus.       TFGWCSVNR-----YDWR--QQGRASTCDIEVDCDVSD--LVAVPDDSSW 292
Murinecytomegalovirus.      SFGWCLARR-----YSVR--AAGYVSRAQLEIDCDVAD--ILPIEEQSNW 283
Humanherpesvirus            TFGWYSCRR-----AIPR--LQHRDSYAELEYDCEVGD--LSVRREDSSW 287
Equineherpesvirus           TFGWYSCAA-----AVPRQGGAARDSWTELEYDCAAGD--LEFHAGRADW 286
                            :***                     :  ::* :*   :            

Psittacid                   PDYKLLSFDIECKAGGANDLAFPTAERIEDVVIQISAVVSSLL------- 357
ILTV                        PDYKLLCFDIECKAGGANEFAFPSAEKVEDLVIQISAVTYSLL------- 357
PRV.                        PDYKLLCFDIECK--AGDDAAFPAAENPEDLVIQISCLLYSLA------- 313
Bovineherpesvirus           PDYKLLCFDIECLSCAGDGLAFPAAANAEDLVVQISCLTYSLR------- 425
VZV.                        PDYKLLCFDIECKSGGSNELAFPDATHLEDLVIQISCLLYSIP------- 383
HSV-1.                      PAYKLMCFDIECKAGGEDELAFPVAGHPEDLVIQISCLLYDLS------- 402
HSV-2.                      PAYKLMCFDIECKAGGEDELAFPVAERPEDLVIQISCLLYDLS------- 403
VHV.                        PEYKLMCFDIECKAGGANELAFPIATNQEDVVIQISCLLYSIR------- 387
MDV-2.                      PDYKLLCFDIECKSGGANECAFPVATNEEDVVIQISCLMYSVR------- 389
MDV-1_                      PDYKLLCFDIECKSGGVNECAFPCATNEEDVVIQISCLLYSIN------- 392
HVT.                        PDYKLLCFDIECKSGGSNEYAFPTATNEEDVVIQISCLLYSIG------- 386
Humancytomegalovirus.       PRYRCLSFDIECMS---GEGGFPCAEKSDDIVIQISCVCYETGGNTAVDQ 339
Murinecytomegalovirus.      PFYRCLSFDIECMS---GTGAFPAAENVDDIIIQISCVCFGVG------E 324
Humanherpesvirus            PSYQALAFDIECLG---EEG-FPTATNEADLILQISCVLWSTG------- 326
Equineherpesvirus           PGYNVLSFDIECLG---ENG-FPNASRDEDMILQISCVIWKAG------- 325
                            * *. :.*****         ** * .  *:::***.:            

Psittacid                   ----------------TRRVEHEILFSLGTCQLPEDIADH--------VK 383
ILTV                        ----------------TKEKEQEIIFSLGTCELSEDCSDG--------IT 383
PRV.                        ----------------TQRLEHTLLFSLGSCDS-----------DDPAVT 336
Bovineherpesvirus           ----------------TQRHEHTLLFSLGSCDLPPAFLGACAAAGLPAPA 459
VZV.                        ----------------RQSLEHILLFSLGSCDLPQRYVQEMKDAGLPEPT 417
HSV-1.                      ----------------TTALEHVLLFSLGSCDLPESHLNELAARGLPTPV 436
HSV-2.                      ----------------TTALEHILLFSLGSCDLPESHLSDLASRGLPAPV 437
VHV.                        ----------------SKELEGIILFSLGSCDLSGEFLERAAAEGWPKPT 421
MDV-2.                      ----------------QKQLEHALLFALGSCDLPETFQETFRDTYGVLPE 423
MDV-1_                      ----------------TKQLEHALLFALGACDLPQTFKETFQSSYNILPI 426
HVT.                        ----------------HKRLEHAILFSLGSCDLPQSCEDVFRDTYNTTPT 420
Humancytomegalovirus.       GIPNGNDGRGCTSEGVIFGHSGLHLFTIGTCGQVG-----------PDVD 378
Murinecytomegalovirus.      MVHHAYDVHADLSTPAVPEN---HLFTIGPCAPI------------PDVK 359
Humanherpesvirus            ------------EEAGRYRR---ILLTLGTCEDI------------EGVE 349
Equineherpesvirus           ------------SGE-APRS---VLLNLGTCEEI------------EGVE 347
                                                    :: :*.*                   

Psittacid                   VCECGSEFELLLCFMTFLKQFSPEFVTGYNILGFDWGFMYNKMVNIYGMR 433
ILTV                        VCKCGSEFELLLCFMTFFKQYSPEFVSGYNILGFDWAYLSNKLSKVYGMR 433
PRV.                        VLEFDSEFELLLAFVTFLKQYAPEFATGYNIINFDWAFVHTKLTTVYGLA 386
Bovineherpesvirus           VLEFDSEFELLLAFMTFLKQYSPEFVTGYNIVNFDWAYISEKLTAVYDVR 509
VZV.                        VLEFDSEFELLIAFMTLVKQYAPEFATGYNIVNFDWAFIMEKLNSIYSLK 467
HSV-1.                      VLEFDSEFEMLLAFMTLVKQYGPEFVTGYNIINFDWPFLLAKLTDIYKVP 486
HSV-2.                      VLEFDSEFEMLLAFMTFVKQYGPEFVTGYNIINFDWPFVLTKLTEIYKVP 487
VHV.                        VLEFDSEFELLLAFFTFLKQYSPEFVTGYNIVNFDWAYLFAKATKVYNMR 471
MDV-2.                      VLEF---------------------VTGYNIVNFDWAFIVNKLTTVYGIR 452
MDV-1_                      VLEFDSEFELLLAFMTFIKQYAPEFVTGYNIVNFDWAFIVTKLTTVYNMR 476
HVT.                        VLEFDSEFELLLAFMTFIKQYAPEFVTGYNIINFDWAFIVNKLTVVYDMK 470
Humancytomegalovirus.       VYEFPSEYELLLGFMLFFQRYAPAFVTGYNINSFDLKYILTRLEYLYKVD 428
Murinecytomegalovirus.      IYTFPSEYEMLRGFFIFLSWYSPEFITGYNINGFDIKYILTRAEKLYKMD 409
Humanherpesvirus            VYEFPSELDMLYAFFQLIRDLSVEIVTGYNVANFDWPYILDRARHIYSIN 399
Equineherpesvirus           VYQCPSELDLLYLFFTMIRDADVEFVTGYNISNFDFPYVIDRATQVYNLN 397
                            :                         :***: .**  ::  :   :* : 

Psittacid                   LDGYGKAN--AWGTFKVQDMPHS-------GRGK----------FRNVKI 464
ILTV                        LDGYGKAN--SWGTFKLQDPSAR-------GLGR----------FKKVKI 464
PRV.                        LDGYGRFN--RGGQFRVYDAGQN-------SFQK----------RSKVKI 417
Bovineherpesvirus           LDGYGKLN--RGGLFRVFDAGQN-------RFQK----------QSKVKI 540
VZV.                        LDGYGSIN--RGGLFKIWDVGKS-------GFQR----------RSKVKI 498
HSV-1.                      LDGYGRMN--GRGVFRVWDIGQS-------HFQK----------RSKIKV 517
HSV-2.                      LDGYGRMN--GRGVFRVWDIGQS-------HFQK----------RSKIKV 518
VHV.                        LDGYGRMN--RGGMFKVWEMGTN-------FFQK----------KSKVKI 502
MDV-2.                      LDGYGVIN--QRGTFKVWDAGAN-------AFQK----------KGKFKA 483
MDV-1_                      LDGYGVVN--QKGMFKVWDAGTN-------RFQK----------KGKFKA 507
HVT.                        LDGYGIVN--QKGMFRVWDAGAN-------QFQK----------KGKFKA 501
Humancytomegalovirus.       SQRFCKLPTAQGGRFFLHSPAVGFKRQYAAAFPSASHNNPASTAATKVYI 478
Murinecytomegalovirus.      VGQFTKLR--RGGRMFVFSPEKG-----KAGFG--------TSNTVKVFW 444
Humanherpesvirus            PASLGKIR--AGGVCEVRRPHDA-----GKGFLR---------ANTKVRI 433
Equineherpesvirus           LKEFTRVR--SSSIFEVHKPKNS-----SAGFMR---------AVSKVKV 431
                                        .   :                             :.  

Psittacid                   NGIVNFDMFSIIYQKIKLCSYKLNSVAETVLGEKKHDLSYKDLPRLFALG 514
ILTV                        NGVVNIDMFTISYEKLKLPSYKLNAVAECVLGEQKIDLAYKDIPVMFAAG 514
PRV.                        NGLVSLDMYAVAADKLKLPSYKLNAVAEEALGERKLDLDYKDIPRYYAAG 467
Bovineherpesvirus           NGVVSLDMYRTAVEKLKLPSYKLNAVAEEALRERKVDLDYKDIPRHFAAG 590
VZV.                        NGLISLDMYAIATEKLKLSSYKLDSVAREALNESKRDLPYKDIPGYYASG 548
HSV-1.                      NGMVNIDMYGIITDKIKLSSYKLNAVAEAVLKDKKKDLSYRDIPAYYAAG 567
HSV-2.                      NGMVNIDMYGIITDKVKLSSYKLNAVAEAVLKDKKKDLSYRDIPAYYASG 568
VHV.                        NGVISLDAYSVAVDKLKIPSYKLDAVAEAALGERKKDLSYKDIPRYFAAG 552
MDV-2.                      TGIIALDMYCIATEKLKLQSYKLDVVAEAALGERKKELSYKEIPTHFAAG 533
MDV-1_                      TGMITLDMYSIATEKLKLQSYKLDVVAEAALGERKKELSYKEIPSHFAAG 557
HVT.                        TGIIALDMYSIATEKMKLQSYKLDVVAEAALGERKKDLSYKEIPRYFASG 551
Humancytomegalovirus.       AGSVVIDMYPVCMAKTNSPNYKLNTMAELYLRQRKDDLSYKDIPRCFVAN 528
Murinecytomegalovirus.      SGTVVLDMYPVCTAKASSPNYKLDTMAEIYLKKKKDDLSYKEIPVQFSAG 494
Humanherpesvirus            TGLIPIDMYAVCRDKLSLSDYKLDTVARHLLGAKKEDVHYKEIPRLFAAG 483
Equineherpesvirus           AGVVPIDMYQVCRDKLSLSNYKLDTVAGECVGAKKEDVSYKEIPHLFRQG 481
                             * : :* :     * .  .***: :*   :   * :: *:::*  :  .

Psittacid                   PEERGKIGAYCLQDSRLATKLFFKLVPHMELSAVAQLACITLTRAVFDGQ 564
ILTV                        PKERGKIGEYCLQDSRLSGSLFFKFSPHLEMSAVAKLACIPLTRAIGDGQ 564
PRV.                        PRERGVIGRYCVQDSALVGKLFFKFLPHLELSAVARLANITLARAIYDGQ 517
Bovineherpesvirus           PEGRGVIGEYCIQDSALVGKLFFKYLPHLELSAVARLAGITVSRAIFDGQ 640
VZV.                        PNTRGIIGEYCIQDSALVGKLFFKYLPHLELSAVARLARITLTKAIYDGQ 598
HSV-1.                      PAQRGVIGEYCIQDSLLVGQLFFKFLPHLELSAVARLAGINITRTIYDGQ 617
HSV-2.                      PAQRGVIGEYCVQDSLLVGQLFFKFLPHLELSAVARLAGINITRTIYDGQ 618
VHV.                        AVKRGVIGEYCIQDSVLAGKIFFKYLPHLELAAVARLAGIALSRVIFDGQ 602
MDV-2.                      PSQRGIIGEYCFQDSLLVGKLFFKYVPHLELSAIAKLAGILLSRAVFDGQ 583
MDV-1_                      PEKRGIIGEYCLQDSLLVGKLFFKYIPHLELSAIAKLAGILLSKAIFDGQ 607
HVT.                        ANTRGIIGEYCLQDSLLVGKLFFKYVPHLELSAIAKLAGILLTKAIFDGQ 601
Humancytomegalovirus.       AEGRAQVGRYCLQDAVLVRDLFNTINFHYEAGAIARLAKIPLRRVIFDGQ 578
Murinecytomegalovirus.      DEGRAPGGKYCLQDAVLVRELFEMLAFHFEAAAIARLARIPLRKVIFDGQ 544
Humanherpesvirus            PEGRRRLGMYCVQDSALVMDLLNHFVIHVEVAEIAKIAHIPCRRVLDDGQ 533
Equineherpesvirus           PGGRARLGLYCVKDSALVLDLLRYFMTHVEISEIAKIAKIPTRRVLTDGQ 531
                               *   * **.:*: *  .::     * * . :*::* *   :.: ***

Psittacid                   QVRVFTCLLQRARKIGVVLPE-------------------KSDRFTFSAH 595
ILTV                        QLRVYTCLLQRSTASGFVLPD-------------------KKSAFSFGST 595
PRV.                        QIRVFTCLLKLAGSRGFVLPD-------------------KRRAIA---- 544
Bovineherpesvirus           QIRVFTCLLRLARARGFLLPD-------------------TQKRLAGAEA 671
VZV.                        QVRIYTCLLGLASSRGFILPD-------------------GGYPATFEYK 629
HSV-1.                      QIRVFTCLLRLADQKGFILPD-------------------TQGRFRGAGG 648
HSV-2.                      QIRVFTCLLRLAGQKGFILPD-------------------TQGRFRGLDK 649
VHV.                        QIRVFTCLLRLAGDRGFILPD-------------------FRGRFGSSRA 633
MDV-2.                      QIRVYTCLLRLAGSRNFILPN-------------------KPQVRAGTEF 614
MDV-1_                      QIRVYTCLLRLEIDG-FILPE-------------------KNKKFAETVS 637
HVT.                        QIRVYTCLLRLAGLHGFILPQ-------------------KKNGLVNDAG 632
Humancytomegalovirus.       QIRIYTSLLDECACRDFILPNHYSKGTTVPETNSVAVSPNAAIISTAAVP 628
Murinecytomegalovirus.      QIRIYTCLLEECSGRDMILPNMPSLG-----------HGAAAAIEEAAAG 583
Humanherpesvirus            QIRVFSCLLAAAQKENFILP------------------------MPSASD 559
Equineherpesvirus           QIRVFSCLLDVAGREGYILP------------------------VDRHAD 557
                            *:*:::.**        :**                              

Psittacid                   AAG-----------------------DQDDG------------------- 603
ILTV                        LAS-----------------------DASDAP------------------ 604
PRV.                        --------------------------DEDDGG------------------ 550
Bovineherpesvirus           GAARGAGRGRGERFACWADAARGEEEEEDEGGEEDGGNEGRAGAA----- 716
VZV.                        DVIPDVG-------------DVEEEMDEDESVSPTG-------------- 652
HSV-1.                      EAPKRPAAAREDEERP-----EEEGEDEDEREEGGGEREP---------- 683
HSV-2.                      EAPKRPAVPRGEGERPGDGNGDEDKDDDEDGDEDGDERE----------- 688
VHV.                        DDGVEAAVNATLLDSIEDDAVDDDESDEQGSSQGSGDKPD---------- 673
MDV-2.                      ENSI-------------------ASTDEFEGEPSPS----NPKAS----- 636
MDV-1_                      LTCE-------------------EDQTEICEHDSPQEPIHNIKQS----- 663
HVT.                        DNVA-------------------NGISEDITRSAAR-------------- 649
Humancytomegalovirus.       GDAGSVAAMFQMSPPLQSAPSSQDGVSPGSGSNSSSSVGVFSVGSGSSGG 678
Murinecytomegalovirus.      GEG--------------------DETSEGENSNNSRTVG----------- 602
Humanherpesvirus            RDG----------------------------------------------- 562
Equineherpesvirus           AEG----------------------------------------------- 560
                                                                              

Psittacid                   ------------GRSVGYQGAKVLDPDVGFHVNPVMVFDFASLYPSIIQS 641
ILTV                        -----------ATRNVGYQGAKVLDPEIGFHVTPVVVFDFASLYPSIIQS 643
PRV.                        ----------------GYQGAKVLEPDSGFHVDPVLVLDFASLYPSIIQA 584
Bovineherpesvirus           -----DRPRAAGGRAVGYQGAKVLDPESGFHVDPVMVLDFASLYPSIIQA 761
VZV.                        ---------TSSGRNVGYKGARVFDPDTGFYIDPVVVLDFASLYPSIIQA 693
HSV-1.                      -----EGARETAGRHVGYQGARVLDPTSGFHVNPVVVFDFASLYPSIIQA 728
HSV-2.                      -----EVARETGGRHVGYQGARVLDPTSGFHVDPVVVFDFASLYPSIIQA 733
VHV.                        -----KAQASTQGRVVGYQGAKVLDPLPGFHIDPVTVFDFASLYPSIIQA 718
MDV-2.                      -----SSFHGNGGRVVGYQGAKVLDPISGFHVDPVVVFDFASLYPSIIQA 681
MDV-1_                      -----SLCHSNSGRTIGYQGAKVLDPISGFHVHPVMVFDFASLYPSIIQA 708
HVT.                        -----SGKSIQTGRNVGYQGAKVLDPKAGFHIDPVVVFDFASLYPSIIQA 694
Humancytomegalovirus.       VGVSNDNHGAGGTAAVSYQGATVFEPEVGYYNDPVAVFDFASLYPSIIMA 728
Murinecytomegalovirus.      -----------------YQGATVLEPECGFHHVPVCVFDFASLYPSIIMS 635
Humanherpesvirus            -----------------YQGATVIQPLSGFYNSPVLVVDFASLYPSIIQA 595
Equineherpesvirus           -----------------YQGATVIDPSPGFYNTPVLVVDFASLYPTIIQA 593
                                             *:** *::*  *::  ** *.*******:** :

Psittacid                   NNLCYSTMTHNPAAIAHLEEG--TDYLRVEVQGRVFF-FVREHVRRSLLA 688
ILTV                        NNLCYSTLTHDPAALAGLQPE--KDFFQIDVQGRKFY-FVREHIRKSLLS 690
PRV.                        HNLCFTTLAL--ARPAGLRE---DEFSAFEVNGERLY-FVHAGVRESLLS 628
Bovineherpesvirus           HNLCFTTLVRREAAPAGLTPG--ADYATFDVGGRALH-FVRAHVRESLLS 808
VZV.                        HNLCFTTLTLNFETVKRLNP---SDYATFTVGGKRLF-FVRSNVRESLLG 739
HSV-1.                      HNLCFSTLSLRADAVAHLEAG--KDYLEIEVGGRRLF-FVKAHVRESLLS 775
HSV-2.                      HNLCFSTLSLRPEAVAHLEAD--RDYLEIEVGGRRLF-FVKAHVRESLLS 780
VHV.                        HNLCYSTLTLKPEAVAHLKSG--DDYLDITVGEQRLF-FVRPHVRESLLS 765
MDV-2.                      HNLCFTTLINDDRKLADLRPR--DDYMEIDVQGKSLH-FAKPHIRESLLG 728
MDV-1_                      HNLCFTTLVHDDTNLSNLRPQ--DDYLEINVQGKLLR-FVKPHIRESLLA 755
HVT.                        HNLCFTTLLPAGTIINDLRRG--DDYIEIDVQGSILR-FVKPHIRESLLG 741
Humancytomegalovirus.       HNLCYSTLLVPGGEYPVDP----ADVYSVTLENGVTHRFVRASVRVSVLS 774
Murinecytomegalovirus.      NNLCYSTLLVEGS-PEVPE----KDVLRVEIG-DQCHRFVRENVHRSLLA 679
Humanherpesvirus            HNLCYSTMITPGEEHRLAGLRPGEDYESFRLTGGVYH-FVKKHVHESFLA 644
Equineherpesvirus           HNLCYSTMIPGDRLCLHPHLGPG-DYETFELASGPVH-FVKKHKAVSLLA 641
                            :***::*:                :   . :       *.:     *.*.

Psittacid                   ELLTDWLNMRKALRAQIPLAATEDEKVLLDMQQIAIKVICNSVYGFTGVM 738
ILTV                        DLLGDWLSMRKAVRAKIKTAETEEERILLDKQQAALSCL-ELCYGFTGVM 739
PRV.                        ILLRDWLAMRKAIRARIPTSAPE-EAVLLDKQQAAIKVVCNSVYGFTGVA 677
Bovineherpesvirus           VLLRDWLAMRKAIRARIPTAAPE-EAVLLDKQQAAIKVVCNSVYGFTGVS 857
VZV.                        VLLKDWLAMRKAIRARIPGSSSD-EAVLLDKQQAAIKVVCNSVYGFTGVA 788
HSV-1.                      ILLRDWLAMRKQIRSRIPQSSPE-EAVLLDKQQAAIKVVCNSVYGFTGVQ 824
HSV-2.                      ILLRDWLAMRKQIRSRIPQSPPE-EAVLLDKQQAAIKVVCNSVYGFTGVQ 829
VHV.                        VLLKDWLAMRKSIRAKIPDSSEE-EALLLDKQQAAIKVVCNSVYGFTGVS 814
MDV-2.                      ILLKDWLAMRKAIRAKIPASSDD-TAVLLDKQQAAIKVVCNSVYGFCGVA 777
MDV-1_                      ILLKDWLAMRKAIRAKIPESCDE-IAVLLDKQQAAIKVVCNSVYGFCGVS 804
HVT.                        ILLKDWLAMRKAIRAKIPHSPDD-LAVLLDKQQAAIKVVCNSVYGFCGVA 790
Humancytomegalovirus.       ELLNKWVSQRRAVRECMRECQDPVRRMLLDKEQMALKVTCNAFYGFTGVV 824
Murinecytomegalovirus.      ELLVRWLTQRKLVREAMKQCTNEMQRMIMDKQQLALKVTCNAFYGFTGVA 729
Humanherpesvirus            SLLTSWLAKRKAIKKLLAACEDPRQRTILDKQQLAIKCTCNAVYGFTGVA 694
Equineherpesvirus           TLLNVWLAKRKAIRRELATVSDEAVRTILDKQQLAIKVTCNAVYGFTGVA 691
                             **  *:  *: ::  :          ::* :* *:.   :  *** ** 

Psittacid                   NGMLPCLEVAATVTAIGRDMLLKTKQYIEENWREYSNIRERFFPAMA--- 785
ILTV                        HGMLPCLEVASTVTAIGRDMLLRTKAHIEKEWRSGNQFAEKFLPGSE--- 786
PRV.                        NGLLPCLPVAATVTTIGRDMLVATRDYVQTRWATRELLERDLPAR----- 722
Bovineherpesvirus           NGLLPCLAVAATVTTIGRDMLLETRRYIHERWATPEALVRDFPAAGPA-- 905
VZV.                        QGFLPCLYVAATVTTIGRQMLLSTRDYIHNNWAAFERFITAFPDIESS-- 836
HSV-1.                      HGLLPCLHVAATVTTIGREMLLATREYVHARWAAFEQLLADFPEAAD--- 871
HSV-2.                      HGLLPCLHVAATVTTIGREMLLATRAYVHARWAEFDQLLADFPEAAG--- 876
VHV.                        NGLLPCLQVAATVTTIGRDMLLATRDYVHEKWATPELLMSAFPDTAEY-- 862
MDV-2.                      NGLLPCIDVAATVTTIGRDMLLTVRDYVKVKWGTRDALLREFPALTN--- 824
MDV-1_                      NGLLPCIDVAATVTTIGRNMLLTVRDYIHKQWGTRDALLREFPNLSN--- 851
HVT.                        NGMLPCIDVAASVTTIGRNMLLTVRDYIHDQWGDKSSIMCKFPELEN--- 837
Humancytomegalovirus.       NGMMPCLPIAASITRIGRDMLERTARFIKDNFSEPCFLHNFFNQEDYVVG 874
Murinecytomegalovirus.      AGMLPCLPIAASITKIGRDMLLATAGHIEDRCNRPDFLRTVLGLP----- 774
Humanherpesvirus            NGLFPCLSIAETVTLQGRTMLERAKAFVEA--LSPANLQALAPSPD---- 738
Equineherpesvirus           SGILPCLKIAETVTFQGRRMLENSKRYIEG--VTPEGLADILG------- 732
                             *::**: :* ::*  ** **     .:.        :            

Psittacid                   ------------HEGVPQ---------YSVAVIYGDTDSVFVS-FKGVPV 813
ILTV                        ------------RIQLNQ---------YSVRVINGETDSAYCEVYRSLHL 815
PRV.                        -------------PPAGE---------YAVRVVYGDTDSVFIR-FSGIAY 749
Bovineherpesvirus           ------------AAAAGR---------YRVRVVYGDTDSVFVK-FAGMPY 933
VZV.                        ------------VLSQKA---------YEVKVIYGDTDSVFIR-FKGVSV 864
HSV-1.                      ------------MRAPGP---------YSMRIIYGDTDSIFVL-CRGLTA 899
HSV-2.                      ------------MRAPGP---------YSMRIIYGDTDSIFVL-CRGLTG 904
VHV.                        ------------LIGGTH---------YEAKIIYGDTDSVFVR-FSGVRP 890
MDV-2.                      ------------YMLGDD---------YSVSVIYGDTDSVFIK-FKGVAI 852
MDV-1_                      ------------FMRPED---------YSVSVIYGDTDSVFIK-FKGVDI 879
HVT.                        ------------FMQNKE---------YSVDVIYGDTDSVFIK-FTGVHI 865
Humancytomegalovirus.       TREGDSEESSALPEGLETSSGGSNERRVEARVIYGDTDSVFVR-FRGLTP 923
Murinecytomegalovirus.      ------------PEAIDP-------EALRVKIIYGDTDSVFAA-FYGIDK 804
Humanherpesvirus            -----------AWAPLNP--------EGQLRVIYGDTDSLFIE-CRGFSE 768
Equineherpesvirus           -----------RRVECAP--------DASFKVIYGDTDSLFIH-CRGYRP 762
                                                           :: *:*** :     .   

Psittacid                   ACLVASGDAMAAEITNALFRRPVKLECEKVFTKLLMIAKKKYIG-VIHTG 862
ILTV                        NFNSSWWLHGRIDLNKRFLEVRVKLEWKRFSCALLLIGKEKYIG-VMHGG 864
PRV.                        DDVCELGELMAARITRDLFRPPIKLECEKTFRRLLLITKKKYIG-VINGG 798
Bovineherpesvirus           DAVCALGDGMARRVSAALFRPPIKLECEKTFAKLLLITKKKYLG-LVGGG 982
VZV.                        EGIAKIGEKMAHIISTALFCPPIKLECEKTFIKLLLITKKKYIG-VIYGG 913
HSV-1.                      AGLTAVGDKMASHISRALFLPPIKLECEKTFTKLLLIAKKKYIG-VIYGG 948
HSV-2.                      EALVAMGDKMASHISRALFLPPIKLECEKTFTKLLLIAKKKYIG-VICGG 953
VHV.                        EGLVSLGDAMAKKISSDLFRAPIKLECEKTFIKLLLITKKKYIG-VINGG 939
MDV-2.                      QGLVANGDDMAKRISSDLFPKPIKLECEKTFDKLLLITKKKYMG-TIHGG 901
MDV-1_                      HGLVTTGDDMAKRVSSDLFPKPIKLECEKTFNKLLLITKKKYMG-TIHGG 928
HVT.                        DGLVKIGDDMAQKVSSVLFPKPIKLECEKTFDRLLLITKKKYMG-TIYGG 914
Humancytomegalovirus.       QALVARGPSLAHYVTACLFVEPVKLEFEKVFVSLMMICKKRYIGKVEGAS 973
Murinecytomegalovirus.      EALLKAVGALAANVTNALFKEPVRLEFEKMFVSLMMICKKRYIGKVHGSQ 854
Humanherpesvirus            SETLRFADALAAHTTRSLFVAPISLEAEKTFSCLMLITKKRYVG-VLTDG 817
Equineherpesvirus           EQVTGFCDELAAHMTRTLFVDPIKLEAEKTFKCLILLTKKRYIG-MMTTD 811
                                          .  ::   : ** ::    *::: *::*:*      

Psittacid                   KMMMRGVDMVRKSNCRFVNDTAKALLNLVFYDEDVATAAASS-----ALV 907
ILTV                        KMLMKGVDLVRKTNCKFVNTTASRLVNLLFEDDEIAMAADTAR---AGFE 911
PRV.                        KMLMKGVDLVRKNNCAFINAYARRLVDLLFGDEAVSAAAATIARAPAARW 848
Bovineherpesvirus           KMLMKGVDLVRKNNCRFINAYTRRLVDVLMHDDAVSRAAAEASAVPPSEW 1032
VZV.                        KVLMKGVDLVRKNNCQFINDYARKLVELLLYDDTVSRAAAEASCVSIAEW 963
HSV-1.                      KMLIKGVDLVRKNNCAFINRTSRALVDLLFYDDTVSGAAAALAERPAEEW 998
HSV-2.                      KMLIKGVDLVRKNNCAFINRTSRALVDLLFYDDTVSGAAAALAERPAEEW 1003
VHV.                        KMLMKGVDLVRKNNCHFINSYAKRLVDLLFRDENVAAAAAEVTKEPAKVW 989
MDV-2.                      RMLMKGVDIVRKNNCRFINTYAKKLSDLLFQDDAVAKAAALVAERPSSFW 951
MDV-1_                      RMLMKGVDIVRKNNCRFINTYAKKLSDLLFLDDTVAKAAATVAEKPPPFW 978
HVT.                        KMLMKGVEIVRKNNCRFINTYARRLTDLLFRNDAVADAAATIASKPPTFW 964
Humancytomegalovirus.       GLSMKGVDLVRKTACEFVKGVTRDVLSLLFEDREVSEAAVRLSRLSLDEV 1023
Murinecytomegalovirus.      NLSMKGVDLVRRTACGFVKAVVSDVLHMVFNDETVSEGTMKLSRMTFDDL 904
Humanherpesvirus            KTLMKGVELVRKTACKFVQTRCRRVLDLVLADARVKEAASLLSHRPFQES 867
Equineherpesvirus           RLLMKGVDLVRKTACRFVQETTKAILDLVMGDEAVRAAAERLCAMRVEEV 861
                               ::**::**:. * *::     :  ::: :  :  .:           

Psittacid                   DVSALPRGLSKLGARVREAHAALSSPA-LDVRDFVMTSELSKAPKYYASS 956
ILTV                        DFDCLPSGLTKLGRLIAEARLAITGNG-LNIRDFIMTAELSRAVDNYASL 960
PRV.                        LERPLPRGFAAFGRVLAEAHARVAGGAGLDVADFVMTAELSRPPDAYSNT 898
Bovineherpesvirus           PGRQLPPGFARFGAVLAEAHAKIADPA-LDIGDFVMTAELSRPPEAYANK 1081
VZV.                        NRRAMPSGMAGFGRIIADAHRQITSPK-LDINKFVMTAELSRPPSAYINR 1012
HSV-1.                      LARPLPEGLQAFGAVLVDAHRRITDPE-RDIQDFVLTAELSRHPRAYTNK 1047
HSV-2.                      LARPLPEGLQAFGAVLVDAHRRITDPE-RDIQDFVLTAELSRHPRAYTNK 1052
VHV.                        LSRSLPAGLDVFGSTLAEAYRRIANGD-LDVKDFVMTAELSRSPEAYVNK 1038
MDV-2.                      ATAPLPEGLKPFGDILAEAYGQMTASTLSDVGDFVMSAELSRPPQAYANK 1001
MDV-1_                      ATSPLPEGLNSFGGVLAEAYTRMMINNITEVEDFAMSAELSRPPDAYTNK 1028
HVT.                        TSSPLPDGLKPFGDVLAEAYGQMLSKNLIDVGDFSMSAELSRPPDAYANK 1014
Humancytomegalovirus.       KKYGVPRGFWRILRRLVQARDDLYLHR-VRVEDLVLSSVLSKDISLYRQS 1072
Murinecytomegalovirus.      KKNGIPCEFGPVVSRLCRARDDLHLKK-VPVPELTLSSVLSQELSCYKQK 953
Humanherpesvirus            FTQGLPVGFLPVIDILNQAYTDLREGR-VPMGELCFSTELSRKLSAYKST 916
Equineherpesvirus           CARGPPVGFLKVVDILNDSYRKLRLNR-VPVGQLSFSTELSRPISYYKTL 910
                                 *  :  .   :  :   :       : .: ::: **:    *   

Psittacid                   KLAHLTVYRKKIARNEEPPQVKDRIEYVIIAPGQRIQGDPFREKE----- 1001
ILTV                        KLPHLTVYQKKAAPREELPPIKERIEYVIIEPGQSVPNDPATESF----- 1005
PRV.                        RLPHLTVYHKLAMRHGEVPSVKERVSYVIIAPTPEAERDAGAVRP----- 943
Bovineherpesvirus           RIAHLTVYYKLLLRSEARPNVKDRIPYVIVAPGEGVERDAAAVNALRGTA 1131
VZV.                        RLAHLTVYYKLVMRQGQIPNVRERIPYVIVAPTDEVEADAKSVALLRGDP 1062
HSV-1.                      RLAHLTVYYKLMARRAQVPSIKDRIPYVIVAQTREVEETVARLAALRELD 1097
HSV-2.                      RLAHLTVYYKLMARRAQVPSIKDRIPYVIVAQTREVEETVARLAALRELD 1102
VHV.                        RVPHLTVYYKLMFRGEQVPTIKERVPYVVISQTQEAEKEALEVAKLRGDL 1088
MDV-2.                      RIAHLTVYHKLAMRSEQLPMVKDRISYVIAAATPEVLRDAERVAEARGER 1051
MDV-1_                      RIPHLTVYYKLAMRSEQLPVVKDRISYVIAAATPEVVRDSARVAEFRGEL 1078
HVT.                        RIPHLTVYYKLLMRSEQVPSVKDRIAYVIAAATPTVRRDAERVAEYRNDP 1064
Humancytomegalovirus.       NLPHIAVIKRLAARSEELPSVGDRVFYVLTAPGVRTAPQGSSDNGDSVTA 1122
Murinecytomegalovirus.      NLPHLAVIRRLAARKEELPAVGDRVEYVLTLP------DGCKKN------ 991
Humanherpesvirus            QMPHLAVYQKFVERNEELPQIHDRIQYVFVEPKGGV--KGARKT------ 958
Equineherpesvirus           TLPHLVVYHKIMQRNEELPQIHDRIAYVFVQSP-----KGKLRS------ 949
                             :.*:.*  :        * : :*: **.                     

Psittacid                   -----------------------------------------TDLVSSLAE 1010
ILTV                        -----------------------------------------PN------- 1007
PRV.                        ------------------------------------GLAPGKLLVSDLAE 957
Bovineherpesvirus           PSAPPGG-----------------------------GARPGRLLISDMAE 1152
VZV.                        LQNTAGKRC---------------------------GEAKRKLIISDLAE 1085
HSV-1.                      AAAPGDEPAPPAALPSPA---KRPRETPSPADPPGGASKPRKLLVSELAE 1144
HSV-2.                      AAAPGDEPAPPAALPSPA---KRPRETPSHADPPGGASKPRKLLVSELAE 1149
VHV.                        KRPHPGDDEP-------------------DLAPGRRQPKKRKMLVSELAE 1119
MDV-2.                      KFRF--SEVSVPEVP-----------GTFSNSAKTRAVQKPKVLISDMAE 1088
MDV-1_                      DLCHQNSNTSCPGDS-----------VMTNKETYVRHSPRNKLLISDMAE 1117
HVT.                        LATSTNTDASFLESL-----------DCVDTSNRCERAMRNKLLISDMAE 1103
Humancytomegalovirus.       GVVSRSDAIDGTDDDADGGGVEESNRRGGEPAKKRARKPPSAVCNYEVAE 1172
Murinecytomegalovirus.      ------------------------------------------VPNYEIAE 999
Humanherpesvirus            ----------------------------------------------EMAE 962
Equineherpesvirus           ----------------------------------------------EMAE 953
                                                                              

Psittacid                   DPNWVTAHKLRLNADYYFSALLQTLSVTFNAVFG-DAKTAHIVMRSFIPD 1059
ILTV                        --------------------------------------------------
PRV.                        DPAYVVAHGVPLNTEYYFSHLLSTLSVTFKALFGNDTKITERLLKRFIPE 1007
Bovineherpesvirus           DPGYARAHAVPLNTDYYFSHLLGTVGATFKALFGNDTRTTENLLKRFIPE 1202
VZV.                        DPIHVTSHGLSLNIDYYFSHLIGTASVTFKALFGNDTKLTERLLKRFIPE 1135
HSV-1.                      DPAYAIAHGVALNTDYYFSHLLGAACVTFKALFGNNAKITESLLKRFIPE 1194
HSV-2.                      DPGYAIARGVPLNTDYYFSHLLGAACVTFKALFGNNAKITESLLKRFIPE 1199
VHV.                        DPVYVTSHSIPLNTDYYFSHLLSTLSVTFKALFNNDVKTTEILLRRFIPE 1169
MDV-2.                      DPTYLIENNIPLNTDYYLSHLLGTLCVIFKALFGNDTKTTDTVLKRFIPE 1138
MDV-1_                      DPKYLLANNIPLNTDYYLSHLLGTLCVTFKALFGNDVKITETVLRRFIPE 1167
HVT.                        DPSYLTTHKIPLNTDYYLSHLLGTLCVIFKALFGNDLKTTETVLKRFIPE 1153
Humancytomegalovirus.       DPSYVREHGVPIHADKYFEQVLKAVTNVLSPVFPGGETARKDKFLHMVLP 1222
Murinecytomegalovirus.      DPRHVVEAKLSINAEKYYEQVVKAVTNTLMPVFPR-DMPKREKFFSLVVP 1048
Humanherpesvirus            DPAYAERHGVPVAVDHYFDKLLQGAANILQCLFDNNSGAALSVLQNFTAR 1012
Equineherpesvirus           DPAYAAQHNIPPAVDLYFDKVIHGAANILQCLFENDSDKAARVLYNFADL 1003
                                                                              

Psittacid                   TLRYPAAVRKILAENTKTLTPM---------------------------- 1081
ILTV                        --------------------------------------------------
PRV.                        TAPGD----APFEHEAFAALTGE--------------GGESLQTLRTIFC 1039
Bovineherpesvirus           TRACDRRLQGRLAAAGFAALTP---------------AAQSRQTLRTAFG 1237
VZV.                        TRVVNVKMLNRLQAAGFVCIHAPCWDNKMNTEAEITEEEQSHQIMRRVFC 1185
HSV-1.                      VWHPPDDVAARLRTAGFGAVGAG------------ATAEETRRMLHRAFD 1232
HSV-2.                      TWHPPDDVAARLRAAGFGPAGAG------------ATAEETRRMLHRAFD 1237
VHV.                        SHNSTEEVRERLVRAGFDVLTFP---------ETSVMEEENLQKLSTAFC 1210
MDV-2.                      TYTEDRAYATRVARAVFAEIRSG-------AGLSSSEEEETLQRLNRAFR 1181
MDV-1_                      TFTEDVVTRN-VSSEMFTTIRNG-------IGLQVNEEEETRRKLNIAFR 1209
HVT.                        TYTDDMDCAERLPSAIFTTIKSG-------AGVPVNEEEENHRKLRKAFR 1196
Humancytomegalovirus.       RRLHLEPAFLPYSVKAHECC------------------------------ 1242
Murinecytomegalovirus.      QRIYIPDQFLHLCGNVNELARGGDDSDGGDSEKENMDTERSSSHEAMET- 1097
Humanherpesvirus            PPF----------------------------------------------- 1015
Equineherpesvirus           PPDDL--------------------------------------------- 1008
                                                                              

Psittacid                   ---------
ILTV                        ---------
PRV.                        TPTAAPRRS 1048
Bovineherpesvirus           ILAAAPHQS 1246
VZV.                        IPKAILHQS 1194
HSV-1.                      TLA------ 1235
HSV-2.                      TLA------ 1240
VHV.                        ILAGALRPA 1219
MDV-2.                      ILTEVRRRY 1190
MDV-1_                      ILTATPHRY 1218
HVT.                        ILTKAPHQC 1205
Humancytomegalovirus.       ---------
Murinecytomegalovirus.      ---------
Humanherpesvirus            ---------
Equineherpesvirus           ---------
                                     
PLEASE NOTE: Showing colors on large alignments is slow.




Guide Tree

(
(
(
(
(
Psittacid:0.19772,
ILTV:0.23426)
:0.04896,
(
(
Humancytomegalovirus.:0.24712,
Murinecytomegalovirus.:0.24148)
:0.09591,
(
Humanherpesvirus:0.22341,
Equineherpesvirus:0.22500)
:0.06314)
:0.09602)
:0.02704,
(
(
MDV-2.:0.12618,
MDV-1_:0.12004)
:0.02956,
HVT.:0.14216)
:0.08918)
:0.00740,
VHV.:0.20748)
:0.00708,
(
HSV-1.:0.04750,
HSV-2.:0.04561)
:0.18455,
(
VZV.:0.21485,
(
PRV.:0.15243,
Bovineherpesvirus:0.18058)
:0.02495)
:0.00723);


Cladogram

Right-click on the above tree to see display options.
Problems printing? Read how to print a Phylogram or Cladogram.
spacer
spacer