NCBI Nucleotide banner
My NCBI
[Sign In]  [Register]
PubMed Nucleotide Protein Genome Structure PMC Taxonomy OMIM Books
 Search  for    
  Limits Preview/Index History Clipboard Details
 Display   Show    Hide:     
  Range: from   to  Features:  
1:  AF282130Reports  Meleagrid herpesv...[gi:11095830] Links
LOCUS       AF282130              151102 bp    DNA     linear   VRL 04-NOV-2004
DEFINITION  Meleagrid herpesvirus 1 unique long region, IRL region, IRS region,
            unique short region, complete sequences and IRS partial sequence.
ACCESSION   AF282130
VERSION     AF282130.1  GI:11095830
KEYWORDS    .
SOURCE      Meleagrid herpesvirus 1 (MeHV-1)
  ORGANISM  Meleagrid herpesvirus 1
            Viruses; dsDNA viruses, no RNA stage; Herpesviridae;
            Alphaherpesvirinae; Mardivirus.
REFERENCE   1  (bases 1 to 151102)
  AUTHORS   Kingham,B.F., Zelnik,V., Kopacek,J., Majerciak,V., Ney,E. and
            Schmidt,C.J.
  TITLE     The genome of herpesvirus of turkeys: comparative analysis with
            Marek's disease viruses
  JOURNAL   J. Gen. Virol. 82 (Pt 5), 1123-1135 (2001)
   PUBMED   11297687
REFERENCE   2  (bases 118855 to 120011)
  AUTHORS   Aouacheria,A., Banyai,M., Rigal,D., Schmidt,C.J. and Gillet,G.
  TITLE     Characterization of vnr-13, the first alphaherpesvirus gene of the
            bcl-2 family
  JOURNAL   Virology 316 (2), 256-266 (2003)
   PUBMED   14644608
REFERENCE   3  (bases 1 to 151102)
  AUTHORS   Schmidt,C.J., Zelnik,V., Kingham,B., Kopacek,J., Majerciak,V.,
            Ney,E. and Chen,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUN-2000) Animal and Food Sciences, University of
            Delaware, Townsend Hall, 531 S. College Ave., Newark, DE 19717, USA
REFERENCE   4  (bases 1 to 151102)
  AUTHORS   Aouacheria,A.J., Banyai,M., Rigal,D., Schmidt,C.J. and Gillet,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-NOV-2004) UMR 5558, CNRS, 43 Bld du 11 Nov 1918,
            Villeurbanne 69622, France
  REMARK    Amino acid sequence updated by submitter
FEATURES             Location/Qualifiers
     source          1..151102
                     /organism="Meleagrid herpesvirus 1"
                     /mol_type="genomic DNA"
                     /strain="FC126"
                     /db_xref="taxon:37108"
     repeat_region   <1..97
                     /note="terminal repeat long; TRL"
     misc_feature    98..110792
                     /note="long unique region; UL"
     gene            527..2788
                     /gene="LORF1"
     CDS             join(527..622,698..2788)
                     /gene="LORF1"
                     /codon_start=1
                     /product="phospholipase-like protein"
                     /protein_id="AAG30038.1"
                     /db_xref="GI:11095831"
                     /translation="MPAKGEVEHHAGYGVALAILALLLIHATALIMIFSDVNLRTGQH
                     GDDVHLRYPLTFDGATPPRAGDHGHSELWTDIKNNTDSTYSSQPPTMLFPKPTTVSHY
                     PEHNSTTIIIPASEMPAMQDIVSIVVSKRHSGSRDAWHVSEYGPNIIRMPHTHKDIPK
                     PFNSILSNQFALLTMWDNLVGMFKTFWGNAMGFHQMIREGLVDLRLHTDVIFLVHGWH
                     GRTNDTEFFLSANRLLTRMIPSAAVVYVSWDPQGAMEPAADAILLARRINVTQFLYAV
                     PSNMGIQCIGHSLGSYVCGSICRQYYYTGKGRCKRILGINAYEILSTDSSLISRIQSD
                     TIRSDAEYVSIFSMGERYIRTVYKDADEYIVAKGISRGVSTCVNPFAWKFSLCTRGVK
                     GREYCENFGANNVTFTSGLREDGSEICERLIPVMAVLQTLDVSSTYALLQLDPKRPSG
                     MTAHISSVWNVYVLEKDYRYATYAKNEPVWYSTVLSVGPNGFTPAAVFAVLSRSDTPV
                     IIRDAIQQRYSLWGNISMHSAFIEDSPTHFPSIGIRIQSPILGAFAWKGRVYSGPRIQ
                     IPVPEQAVVDYNCLPKDADHLCVSTKNVSSITIWRKLLLANYSFSILSIDDCLPYIPH
                     MAVIWKHPAIEVATWRNITVTFHPSVQLMAMRFENVLTPRNYTLMTFHDVCRADEINS
                     GIFFEYDWLGANMTIAVSKAGSYVLRWFFEMGIYEIPIAVYENERE"
     gene            3543..4778
                     /gene="LORF2"
     CDS             3543..4778
                     /gene="LORF2"
                     /codon_start=1
                     /product="LORF2"
                     /protein_id="AAG30039.1"
                     /db_xref="GI:11095832"
                     /translation="MFSAGFKQPAAVAIVDGLFAACRGLAVECMCNGYATVELMEKLA
                     TSWLTSVSAMVTWIPMFAREAEPPNQPEKNNRDARAYIIKLSGKINVNHATWPFWKLM
                     GKCLDWCCSFHAPNDTSCTHGSPRIGIRQRGNNPTFTPALDLYSSIMTWTPMPCFAET
                     REYQDSGDDDGPSTSRGSGVARVKPTVIRHRVDKTSPSRYENHNARTFAMANQDKRSI
                     PSWVHETDAAAQRPGQASPSRDNGRGSVATNSRSSSSPTISNVRTLDAAAATNLGWEA
                     PSPPRTPTLDPEPAIAGPSRAVNRSPSPRPLSPPPYQPLSWDMNAQTWDSSAGSDDDG
                     SAIDSTGGLHHTMRIVPHSTSGDRSGRDRNRSRSRSRSRSRSGSTERARRYRRRTGRG
                     VPRDQSESTVIVSSPEASD"
     gene            5078..5632
                     /gene="UL1"
     CDS             5078..5632
                     /gene="UL1"
                     /codon_start=1
                     /product="UL1 glycoprotein gL precursor"
                     /protein_id="AAG30040.1"
                     /db_xref="GI:11095833"
                     /translation="MFTAFFLQSAEAFMNWSDRDLTYGFVRAPNVTTIVHLECIPTSK
                     LTSMRYAEPSSDEVPSGIIIKTNCSLPEFILWYERVGVAAWVNPIIGTSLLLEDVLRS
                     RLDDSVKAGIGTLLSKIAYLIPTSHLRNRGAGCINLYASHDGTCYGSVHFDRFERSAD
                     DDNRGSFCRNKTPRLRNGGRPRET"
     gene            5505..6452
                     /gene="UL2"
     CDS             5505..6452
                     /gene="UL2"
                     /codon_start=1
                     /product="UL2 uracil-DNA glycosylase"
                     /protein_id="AAG30041.1"
                     /db_xref="GI:11095834"
                     /translation="MARVMARCTSIDSSEAPMTTIGDLSAETKHPDLEMVEGLGRPRK
                     RRRPEGLPPGFIPARTKSDKSCDGGEESSHVCNVETESKKAWEHFSSVYNIDCRWKEI
                     LGPELCSPTGTKILAEYERRLRYEEVYPSKSDVFAWTRYCAPEHVKVVIVGQDPYANE
                     GQAHGLAFSVPPGSPAPPSLKNILAAVRACFPSIEIGSSGCLEDWARRGVLLLNSVLT
                     VKRGDPGSHRAVVWQILVRSVLRKLSQSNAGLVFMLWGAQAQTMYYQNDNDGRHLVLK
                     YSHPSPLSKKPFVHCTHFRDANEFLCKMGKEAIDWSLTA"
     gene            6527..7168
                     /gene="UL3"
     CDS             6527..7168
                     /gene="UL3"
                     /codon_start=1
                     /product="UL3"
                     /protein_id="AAG30042.1"
                     /db_xref="GI:11095835"
                     /translation="MACNAPSVMAVLADWGWSCSTSGAAGYEQASLGRGCAREGIDYQ
                     GCGDPSSAGHELPATSADASDGVVANPEYTHFDTLFMVSSIDELGRRQLTDTIRRDLR
                     HSLAKFTIACTKTSSFSSSNATRKTRGRISHRNFQSNKSLQMFILGRRAHAKHIRAQL
                     QSVIQARKPRKYYTRAVDGSTRPVVPVFVYEFTAIDTVSLHRDNVIEIDAPNP"
     gene            complement(7445..8275)
                     /gene="UL4"
     CDS             complement(7445..8275)
                     /gene="UL4"
                     /codon_start=1
                     /product="UL4"
                     /protein_id="AAG30043.1"
                     /db_xref="GI:11095836"
                     /translation="MASTFIAYTLENARMSPICNTPPYEQIICSCETGTRSIAVGRMT
                     RCDHIPPSNFIIQRGPVGTLIVVDSGSIIYSYLLRVEEYTAEHHSASLSSLPEALCVI
                     PFATCTVMGTDAYVYNNSGGILTILGMGNSIYVTITIYGQSGILAKPCDNFQMSQQMG
                     PRRTDDEIVQKNDGSQNIDDVETITLESEYPGWRTTFTIAGHTNNIPGTAEVSDARED
                     LLAEAIREARLYISNPSCISDAGTEYEMHDGSLTNLHVPESIAKCYEPCIDQSPVYRK"
     gene            complement(8349..10925)
                     /gene="UL5"
     CDS             complement(8349..10925)
                     /gene="UL5"
                     /codon_start=1
                     /product="UL5 DNA helicase/primase associated protein"
                     /protein_id="AAG30044.1"
                     /db_xref="GI:11095837"
                     /translation="MARSSTDRFDESMYLNFTAMHGIHSIISRVRVLANATLPYELIP
                     PLSYFIEASNVEDPSTLSLRDLPFSAYLISGNAGSGKSTCIQTLSEIMDCIITGTTKV
                     ASQNIYGKLSNSYTSSHINTIFQEFGFKGHHVQATLGKWHYACTSNPPTIKELQKRDL
                     VYYWEVLSDITKCTLKLLETDAGPRKFDMVYMLEEVLGRDRGSLAWTAFGVNGSLPSF
                     TRSNIIVIDEAGLIGKHLLTAIVYCWWLINATYRTPQYIKGRRPVLVCVGSPTQTSSL
                     ETTFEHSKLRCNVRTSENILTYIICNPTLRSYLDLSKNWSIFINNKRCTEPEFGDLLK
                     VLEYGLPITEEHARIVDSFVVPESYINNPANLPGWTRLYSSHKEVSAYMSRLHDYLKT
                     SGDNMFVVFTLPAYTFINLEAFEKYCTAANQTSITIEKWLVANASRLSNWSQSRDQDS
                     TRSKCEIRSQLGLAISCSDITYVLNSQVAVTTRLRKWVFGFCGTFESFLSVLKDDSFI
                     KTHGEGSIEYAYRFLSQLLFNGMINFYNYLQQRGLQENVVKVAYERLATLTTSILFPG
                     GQTQTHDITDVHESAILTGINCREYSQSASAPFESHWGEADDVIFSALDGQMIDLLYC
                     NYEFTRLESSSEIYAQFSMLKNIFTGRYAIMTDLFGDKFSKHRFDSYVDNVSTKGCQI
                     FINNMRGGMSSLALQTDSYTLMGYTYARVNAFADEPIRRKIDTCVAEVLCELNMPTVV
                     LKDQHGFMAALNSNITDFVEMVDENELKMAVTADYGISSKLAMTIARSQGLSLERAAI
                     CFPQSGLKLSSVYVAMSRVTSSKFLRMNINPLRETHTRDDNNISEHLLAALRDPNVHI
                     VY"
     gene            10962..13151
                     /gene="UL6"
     CDS             10962..13151
                     /gene="UL6"
                     /codon_start=1
                     /product="UL6 minor capsid protein"
                     /protein_id="AAG30045.1"
                     /db_xref="GI:11095838"
                     /translation="MMRRHTAHGRCDILRAIGDGNMDYDPHRDKIRRPESESVTKPAV
                     LSNAPSEPCVENEWILVHPTKQTCLFKEILSGQWGYTEGQGVYNSIRSAEAVSRQLQS
                     TIITLTLEAARYDELHRDWMKHIHARGMSAKKIAKRYGRDEAEATRVARRVFETWHKT
                     LQRTLVNLFRRLMADLVAHDPNICSFAKYIDWMCCLGIVPVIRRRRAAHSILQSKDNS
                     RNMLGGEFDSAACRLLTAQSIMDHGRQITDHISASMQAVTIIEYDRAIIEYNFLKRQL
                     RVRDAMSGERGECIVIWRPVMSDNGVVFDSPMQRICKEIVECHDLRIHAALCRLINTP
                     PVRVLIAKRDPEKKGVSGAQRAVEQVLGDQVENAAGSAASRLVKLIIGLKGMRHVGEI
                     TDTVRDYLEETNGHLLDTSSVDTSQPGFGRLNRTPNTRAADGSHSNNANIRDAFHASV
                     VSNINEMLEGYVTKLFSTVEGLKATNKDLVTRLSSKELELDRIRMESIQAKQARADMA
                     YHSQYSPNLEMLARDLKHDIIDVGANMDDDSYVANSFQSRYIPCCDTDLRRLSDLWEQ
                     ELMRCFKMNRVMNSQAKEIAILYSNSSITSMLAPYFFNVLNIYDIGLWVDCEDVYKSE
                     EDLCNSLFQKTRVHTYLQDLATFFEVDVRRAVAKLSDVFYWGRPDTLEIAPDLSYGRR
                     HKHRSPPTRFKLHSGRFNYRRSKRRRRSGSNYRRTDPTAYGENDDGD"
     gene            12997..13935
                     /gene="UL7"
     CDS             12997..13935
                     /gene="UL7"
                     /codon_start=1
                     /product="UL7"
                     /protein_id="AAG30046.1"
                     /db_xref="GI:11095839"
                     /translation="MEDDTNIVPHPLDSSCTLDALIIDALREGEGQEAIIEELIRQPM
                     ARMMMEIREIRGVSTRFTGISVNKLRVDQGSKRLCLTLAGADAGSEIDSHVYYQQCMT
                     NTAFKGFVFIVLTAAEDIVKSIGVPPSLLKFRLALFRPRDHLDFALCLLVAFLENRVG
                     DASDVSLYVQIQSFLKYAWTRVTSINKMRRFLCVTITWLLNTSMELGSICPFDRGYVL
                     PHYSIYKHLNGTWSMCANVIRAIYLQDVPSTMSQAQSALRGRDSIVLKNEGLLNGAFQ
                     KDWIGDVIYDWWKCDGDKLWGEEGLFGTYVGKGDNK"
     gene            complement(13963..16227)
                     /gene="UL8"
     CDS             complement(13963..16227)
                     /gene="UL8"
                     /codon_start=1
                     /product="UL8 DNA helicase/primase associated protein"
                     /protein_id="AAG30047.1"
                     /db_xref="GI:11095840"
                     /translation="MNDISAVELQGCICYATLYRLWTSSNHDEGLTALCYLLFRDVGG
                     NYAAHYATVNFSGKSLARAWGWNPETITDATLASMANAAATNDRLPFLNADQNTLWKA
                     LLAFTLSNLRHRLGYNAYYTPINMHVDKITGLVLSCTPLNSEHYKPRPGLLKTDGTIN
                     IDESSLLSAAMKFTNGTTLARVKLSAMSNIELADFDAKIEIQTKNDIFYREYTSRSSR
                     TKKTKLHVSDNAFHVAEKPLIIDGASVRTLTLVPASFDILVTTPSEFSLSALMIIYTK
                     WRETLFSTAGGPEKILTPIFTYIGPETNPEGEDLDYACIVGFPGWPMVKSSTASHLAI
                     KEVIDSYAATDGLWPMAGARTFHLLAPWRPDNHPSPTIDICHYLAESNVAQGRIATDW
                     GEGRLTCFFREPTLIENAAIAKLDFSAFFATLYLGLFPCHTRLRDAVLARLRRESDWL
                     KRPIVEFGGLLKHFREDIYKAIVGIGNLISLEIESAASTLMFAPCIYVRDGMWGAFID
                     KANGTIVSPEGNGNIFETLRVLCNESANRLTTSIGLRFPDGINLQMRLEGVYTHAMSW
                     NVNCYWLWNRNTRESNFVGFPKQPEFATHAKEAMSTVLEEICLCADTEDALLTIQEKV
                     QKMYHDLLYMAFKKRGDASFWCCATDSYNDSLYAVALGSKAASRCDTSAFRREMVQAV
                     TTNGNVVPVVCSLFGDTHFIVPAISCVDHMKPVLSALSRLLGSVIAFKWPNVDQGSLM
                     FDVDHYRFMFIRNK"
     gene            complement(16248..18767)
                     /gene="UL9"
     CDS             complement(16248..18767)
                     /gene="UL9"
                     /codon_start=1
                     /product="origin of replication binding protein"
                     /protein_id="AAG30048.1"
                     /db_xref="GI:11095841"
                     /translation="MIDYASSASLSRMLYGKDLIEWIAKNRPAITVERQSDGPVAFPS
                     PLCTGARSTLVVRAPMGSGKTTALLCWLRSLLCNSLTSVLIVSCRRSFTETLSGRLNN
                     SGIAGFVTYLTAGDYIMKGKQFYRLLVQIESLHRIDHKLLHSYDIVILDEIMSTIGQL
                     FSPTMKHLRKVDSMLTSLLRKCPQIVAMDATINAQLVDMLAFLRGEENIHVIIGEYAS
                     RGFSMRCCKILRSLGTDTLLNVLNPTNSKGTPQIQNTSDLIRSTSRSYLQQSTFFYEL
                     GRRLEGGLNVCIFSSTISFSEIAARFCLAYTNAVLVLNSTRDEPVDMNLWSNYRVVIY
                     TTVVTVGLSFNTTHFHSMMAYVKPTINGPDMVSVYQSLGRIRSLRLNEVLIYMDASGA
                     RSDPIFTPMLLNHVIDKNGGWATGFYQVTNMLCRNFRRDCFPTFGLSELLFLFPRFKY
                     KHLFERCTLNNISDSLNIIHALLESNLMQVTFDGCDHGFDSDTFFSFLMALRTDSLAS
                     QKDLKLVRGQAVCNIPLEVDILDSDVVAVFVRKYIKPTISFQSLSTFLTKLSEPIARD
                     QFINITMLDACRATSAALYSEAVFRRIYDFYASGSIPIIGSNGKLDTVSLTPDFNTSG
                     RWDLYRLCCKWADSLHINPLEGNNCSIDPSLLLQLVNTDYSTYARAVLEVARCYLLDA
                     QTATKRPVITTKNVLSGLNNKHCNQLSNIEHAVSLLKATWEILFGLRVVKSTSTFPGG
                     KKVKNLRKAEIEALLDGVGINRTLVKTHKDLYRLLMKNKVAFQNPRYEIRRPKWYDLI
                     RSRLDTELGIYHDIMELETVLAEVPASYWPAIDGAIDFHRL"
     gene            18835..20106
                     /gene="UL10"
     CDS             18835..20106
                     /gene="UL10"
                     /codon_start=1
                     /product="UL10 glycoprotein gM precursor"
                     /protein_id="AAG30049.1"
                     /db_xref="GI:11095842"
                     /translation="MDGQTKLRKPRGGSKQMDYVYKKIWAIQAACFTIAVLAFLGTLM
                     SASIHLAEGFPCFFAAVVDYAIVNTSTIHTGLTNPRLGGVVPVLFFQTKSTVFFFYAI
                     SIVFMVLMFYIIVGAVIANKSHVGVAYMERGMFAYSLIISPTTLLLGTVSMWLLQAIV
                     IVLAHKLIVLAAAIYLVYFSAITFFYGYFCGRGVDSKVYAEDVATTKYIDRTLHRIVG
                     SVRAVVINLLSIVYSLILIMAGLMFGMLLANSFTLKFFHVIVVILVTTSILTLMYLLI
                     VEFLIARYVHMIMGTYLGLIIGYGMLWMTSCDYVNRFYYAMDNASSLRAACHGVLAVF
                     TILILLGMIVRLVRAGLYHRRRSTHAYASAIKLQKSVKERLKRWNRGRTRYDSVAEDE
                     HALTQTPYTETSDDETIYDRVYSGSDSEWDD"
     gene            complement(20170..20415)
                     /gene="UL11"
     CDS             complement(20170..20415)
                     /gene="UL11"
                     /codon_start=1
                     /product="UL11 myristoylated tegument protein"
                     /protein_id="AAG30050.1"
                     /db_xref="GI:11095843"
                     /translation="MGQTTSYLTDTFRRCCKRNILLTKSGQTIAIDRENYDSFNLDEL
                     RYTDYVEEAKIALLDRPSGIGKRINKNERDYTKHPIL"
     gene            complement(20391..21956)
                     /gene="UL12"
     CDS             complement(20391..21956)
                     /gene="UL12"
                     /codon_start=1
                     /product="UL12 alkaline exonuclease"
                     /protein_id="AAG30051.1"
                     /db_xref="GI:11095844"
                     /translation="MELEPVGKKYRPEREDSSKGRKILTVSVNSQLQGASPTLGTRAH
                     PPHSELTDYTFSRYILYHLAPSELKEAIHPLYHRLNYIADVIKRGTSEGRWLGYPYSC
                     ILDTEDELRNESRRNTSSPSDHALRWCLLVESFTIEQANCDLWHIFRQSLLTASSVKW
                     TDDGKLDTVGIMSDNSTAYVETCSVAFGKHNEPLAKSLVTMFCLNHSRHVHNTSPRRE
                     NVFVFEDVSDRTIQSESDYSCGLMIDTRTGMVGASLDMLVCERDPFGLLQPDSENQAI
                     ETYEIKCRAKYAFCPDKRSELSQCYERLLNVRTMGSLRLFISAIQRPCVDYFQPGNVP
                     RSKEALITSNEEWKVGNSAYHAAQSRIRCNAFDKCHLELNSNVQSRVWLFGEPDLETD
                     TIYPLPWDTGKLSLDVPIFSNPRHPNFKQIYLQTYVAAGYFGERRTTPFLVTFIGRWR
                     KRREFGKKFSLIADSGLGKPISTVHADQAIPVLLIVTPVIVDEAFYGEIESAGCRAFG
                     ELVKQLWAKQPHT"
     gene            complement(21938..23482)
                     /gene="UL13"
     CDS             complement(21938..23482)
                     /gene="UL13"
                     /codon_start=1
                     /product="UL13 serine/threonine protein kinase"
                     /protein_id="AAG30052.1"
                     /db_xref="GI:11095845"
                     /translation="MDLGTETATASAHQIGCAPPRSRWNSDDGKSAGSHGRSDDKQPS
                     DRPEFAPPNHFHAFDIEAGNPPERTVSRSRCCRRRISCNIRRCLKRLCGTREQSQQRS
                     GTLASIPSSPKHIFTLSRIKTITSLVFDTTPGLHYIRLDLGEAPIYAGSGSYGEVKIF
                     KRANIAVKKVLECFRTELVMTLIAGECAARAKSALAIENIIPLLAFSIPSKELVFPAY
                     HMDMESYSYKLARMNKGVRHWRAVEKAFTGLGRAVIYLNVSCGLTHLDIKCGNIFVNV
                     SEDDDPILVHAVLGDFSLALLNTNSSLTRARFNVDLGSNNVHTVRVHKGNVVPVFDLV
                     LGHGQTQPCEIIIKALNKTELGRRSSPLTSEAGLSIDMYALGQSLLEVLLTAGMNLTL
                     EFGIPGNPVHYYYHRMMKADYLLDILAYRCLLYAYLFPITPLTIRDDIPWERAEKIRP
                     QLQCSRHRCVFDNYLGNYEVTHRKLFDSLKVPSYLNNLFELAALYCHSNPQARSATLL
                     LWSSSQ"
     gene            complement(23218..23931)
                     /gene="UL14"
     CDS             complement(23218..23931)
                     /gene="UL14"
                     /codon_start=1
                     /product="UL14"
                     /protein_id="AAG30053.1"
                     /db_xref="GI:11095846"
                     /translation="MFAAAAMRRRRRQLLAECRVRETIYKERTLELLSEGVGTDDPAF
                     IATFTSARNAHTDHKAQLRSNILLENTERKLRLIERRIEDQVDRKLILETNRRFLSPE
                     LHSHLEQAEEDLIDKEAILTEACEELTLADSSEDIEEFSETAEALLTKWILEQKPRPL
                     LPTKSAAPPHARDGTRMTEKARVPTGVQTTNSQATDQNLPPPTTSTPSISKQVIHRNA
                     LSPEVDAVEDASRATLGDV"
     gene            23968..29680
                     /gene="UL15"
     CDS             join(23968..25011,28508..29680)
                     /gene="UL15"
                     /note="DNA packing protein"
                     /codon_start=1
                     /product="UL15 terminase"
                     /protein_id="AAG30054.1"
                     /db_xref="GI:11095847"
                     /translation="MFGGQLGSETRRHFEKLLRERNNRLGAAGRPEKNLRNGDIIDAP
                     FLNFAIPIPRRHQTVIPAIGILHDSCDSAGIYSDVAARMLYTNMVYSEFDRANNESPS
                     SGRSLVKEAGAFLSPKMIDCASALKFKEYDDTECASHRNAYYSVMNSFVVMRTSDAFK
                     QLVSFMDRFARLLSASFRDVKDLDGKPTDKRMKIDIPPYGKTHGTLELFQKMILMHAT
                     YFVTSVLLGDHTERAERLLRIAFDTPNFSDAATRHFRQRVSVFLVPRRHGKTWFLVPL
                     IALVMASFEGIRIGYTSHIRKAIEPVFEEIGDRLRKWFGGHRVDHVKGETITFSFPSG
                     SRSTVTFASSHNTNSIRGQDFNLLFVDEANFIRPDAVQTIIGFLNQSNCKIIFVSSTN
                     SGKASTSFLYGLKGSADALLNVVTYICDEHIKHVTDYTNATSCSCYVLNKPVFITMDG
                     TMRRTAEKFLPDSFMQEIIGGGDIHKITCSGDRGIFTSSAIDRFLIYRPSTVHCQTNT
                     YPDLYVYVDPAFTANAKASGTGVAVIGRSGLDYILFGLEHFFLRALTGDSVDAIGDCV
                     AQCIIQICAIHTKRFRMIKIAVEGNSNQDSAVAIATRIALELTSYIKSGVAPTPHDFS
                     FYHSSPAGTDVAYPFFLLQRQKTAAFDFFIAQFNSGRVLASQDIVSTTVSLNMDPVEY
                     LTKQLVNLSEVVTGSACNRTFSGKKGGSDDTLVALTMAVYISTHASDGAFAHLTVV"
     gene            complement(25064..26119)
                     /gene="UL16"
     CDS             complement(25064..26119)
                     /gene="UL16"
                     /codon_start=1
                     /product="UL16"
                     /protein_id="AAG30055.1"
                     /db_xref="GI:11095848"
                     /translation="MDKARRPSDTCDQGFETFCGDMAVNFVNTLNDRACVWRTLRADS
                     RLAVMSTVLALDRSFCMHAPPNAQEHKTKWVEIFMYLTRPKSLCLCRKAFYILFVING
                     VRLYSITSTLHIVPLRHKEGSADIIHFSGVSPADLPLVLPDVANEPLPPPPAMGPDID
                     ALAERDRPPEDPDVCITVSIGAWWSISQRKFYYLRMEESLLAICPAGWQQRSLGATLA
                     KFLDHENGCRQCNSHDSSHMDVYGGSWGCGTVGHACLCKGPCMWMKARQTELPVEGDT
                     SLYCVLFMGMVKSVKLMIAENSKITDRLEDIIVAGGACCNTPVNSCGWHLVSLPTNWS
                     MLMIQGCIKLPRLCYIS"
     gene            complement(26188..28374)
                     /gene="UL17"
     CDS             complement(26188..28374)
                     /gene="UL17"
                     /codon_start=1
                     /product="UL17"
                     /protein_id="AAG30056.1"
                     /db_xref="GI:11095849"
                     /translation="MEAHIESETLYSLTNHGSSHKRLSHIIIPDDCLSAAGINIADIK
                     APAPILTFDGYQTKFISVSLQTRFNGTGKCSRWVSSPAIYVPCDALHTLLIPHVRNHE
                     KIFSLPKYEDQGGLFISLPIECDSQNRYDPFTRVAVRILSKTQHAGEYISYKDLLFTQ
                     DELVPRGTRYNLDEERLKMLFLQLLHYIKKNGNDLPYTVLELGANLETCLPDITGPDN
                     HIRMDFNLTQMLTNSDKSFDSPAVDARIDASHMEITNLLKKAVGAISKTAPVSANAVT
                     SHILPSTSPGTICSVVSGLRQGATACLENNAYAQKGTANQDAVIDGLEPVGKGRFFGG
                     YNTRNGRSGDSNNCQRHTIPSNLEDILMLDTPSQSTLSPKQIFSMTIAILSDGIAPAN
                     LWRCGNVSIVLRTHSNTNVPFYLIAYEHSSAIGGKADNTASLPTSLDNLLTTACMDEG
                     VNHPSNLSLQRKRALATAAPILHNPLLNETGNQIRAFSSSAETELMINFKIVTSNCII
                     TAIGEKLKTGPRLHQLIGYRIYARDVEYITEISNRIPNCTRAVMHAIGNVSWEIFSSG
                     ALFSAVATYMAAYVKKYTGAIYLSTTTANAADILGCGFLSMKQAMPDLVLFDYYSSGG
                     ECVRLNKRPVPVIINGRMGLWDKRMRVRSSLECVFPEWFVPQATCEKFLPGESYGYIC
                     VGYDEHMHVIIVFPGGFVLTAIAAERFDWPNARIEAILSRICNSKA"
     gene            complement(29788..30750)
                     /gene="UL18"
     CDS             complement(29788..30750)
                     /gene="UL18"
                     /codon_start=1
                     /product="UL18 capsid protein VP23"
                     /protein_id="AAG30057.1"
                     /db_xref="GI:11095850"
                     /translation="MASFNGTTVEIELPCRLSTCDANLLKKCEGRILFLPTVRSRLSL
                     TDVDYKSFYVAGTEPDTLNLLSIFKTRFAAVITRVLPGRLSTSVLGIGPIPCGLALQN
                     TGPFDLCNGDAICFMPPVFPNICCRMRLESVDVDLLFPATVPSRLAREIFAKILSRAI
                     ETIASSAERNPPASRGPETVTYNGKSYTITPALQSLDAAESAARTLLLNMLFAVTEGN
                     MILYTMIPTLLTLGVSDGYINALIGLETATRAVGQLVRIPRPPALQDAWRKYPIYEAL
                     SSWINMATHLGDILSLRSLLRACTFDGPSNVKVGDMCPVISNWN"
     gene            complement(30859..35088)
                     /gene="UL19"
     CDS             complement(30859..35088)
                     /gene="UL19"
                     /codon_start=1
                     /product="UL19 major capsid protein VP5"
                     /protein_id="AAG30058.1"
                     /db_xref="GI:11095851"
                     /translation="MKFVFCLNVSHRTDSIGDYGMPISPAQDCPPTGVVCFSPPFNIG
                     STLAPTGRLLTTIEMSSHRCMFDYFKQFSSDDDGRYTAQFDILLGTYCNTLSLIRFLE
                     TGLSVACICTRAPDLMYMREGTVQFEIQQPMIAREGPHPADQPVHNYMVKRVCRRSLN
                     AAFVVAAEALALLSEVSLDGTAISKHLRMRAIQQLARNVRTILDSFERGTVDQMLRIL
                     LEKAPPATLLIPLSHALSEGRTNSQVMRANLVSELKRRVCVETFIMSKTGISRESILS
                     FLARMVNSTQQTISMPRLTHADSKGRLVDGVLVTTAMVRQKLLSGILNVSDTSARVPV
                     TYGEMIISGTNLVTAVVMGKAVRNMDDVARYILNLREDEVMNSTDKVIEGDSDRLQMA
                     DVPAELVVVGDKLIFLEALERRVYQATQVRYPLIGYVDLTFIIPLGIYQRISERYARH
                     AGDYAPGVGSGGDIRNFAPRDIYFYNKDNQLICLTLADAIGTVCHPSFLDIEATVNHL
                     RSGRYELTCTLGAYVTNPPALPLMDAARQFFENVGEMMREFPRWVEECQMTTEQFMST
                     GNENLFMELHPAFDFFVIPGDVDLPGPHNIPQVMASAEASWRVCNGNIPLPLCNTDFR
                     DALGRELSSTRYKLSDSTVSALSDTFADSSYPTAFYIIEAVIHGSERNFGLLMRLVIQ
                     CIRSYWDNSKRVAFINNFHMVAYIEAYLCSGELPEECMNIYKELMRHVRALRSLVQDY
                     TEQTDSLYEQSHDELNHVLIDRTVLPPLLWDCDPLIYRTRGIRDRELYLNVGGEENYT
                     VRPWLELQDADFNRTGNVLVHNRPVRDIDRQAFVPHHSQEWTILSKIYYYVVVPAFSR
                     GQCCTMGIRFDNIYATSQAVIIPEVHSDEEPPIDPEDPRHPLNGRNLIPNTFNVLLHN
                     ARISADADALLTLQETVNNMAERTTAILYATTPDIGGASASTRRMRTFDGALHHGLLM
                     MAYPCNDETIVAGTYFYPVPVNALFACSDHLAAMRALPGNIRTICERAPPVPSFLGAN
                     YYSTFRQPLAQYVKRSRCGPNEMSYALMSGYFKLSPLGLYHQLRTGLHPGIAFTVIRQ
                     DRFLADMGLFAERASESYFLGQVSVTKRPHAGGVQFSLTQPRANVDLGVGYTAVCTPL
                     MLRNAVTDMGNTAQSLHLTRGSPPLLNPEADEFLRKVATRGQRTAPQRPVPFLGTLMP
                     SLPSGLEHGQMSICEFIPTPVSSDLEYFKTPCNPRGRAAGPIHSGEDMQDVDNIMYDH
                     KQGDPAYPFRATNNPWASQRYSYADRLYNGTYNLSGASPLFSPSYKFFTPAEVCSKTR
                     CLDKLITEAGSAPSASTSDGEIQFKRPVGSTELTEDPCSLFQEAYPILCATDKALLLS
                     YTKGTTDGSESHLAQYLIRDSSPIGGCLPTC"
     gene            complement(35311..36003)
                     /gene="UL20"
     CDS             complement(35311..36003)
                     /gene="UL20"
                     /codon_start=1
                     /product="UL20 integral membrane protein"
                     /protein_id="AAG30059.1"
                     /db_xref="GI:11095852"
                     /translation="MVKYDFYNTEETDDCAVLLLDQATGEPLDASKMHVGALLTSIAD
                     ELDCDAIQYATISSYLGDYAFNSDKCESYPRFTRDVVLFWLSAFGLRPLCCAIFFMYY
                     LYFYDSRLIILGSIITTVFYGTLVLEIYLMYRNMKRDEMPLNKIQQIIVGILATLGPI
                     IFVVISYMVVFTDAWILDKLLSAHNESRGYIVYLAMIACLVYGILSISDAIGFVFPRL
                     WVKAVFKTIVPF"
     gene            36101..37846
                     /gene="UL21"
     CDS             36101..37846
                     /gene="UL21"
                     /codon_start=1
                     /product="UL21 tegument protein"
                     /protein_id="AAG30060.1"
                     /db_xref="GI:11095853"
                     /translation="MGGACEAKCASVIWHRVSALASAQLYFLNTSLPIYSEDRIRYLA
                     MDIKYEQMILYKNVKFYVAPGGHQAYFFCGGSLIAMERPVYGSTCVAEFAKFGLVLGG
                     GECKPLAAYIRRELSRRGMKWALPSEGEDIFVDCLAMLSRDGICSERELCGDLSLETY
                     DPAITNYIVSESGVSGLLLCMADDSSEENTIHLSETPTVTDLHTDCTYDCNRNVFTLA
                     YARLTELPNSLHYLVEGLFDGIPVPRLPLSPNTRKTRIDIVITAKTAAKTTAVKCTSW
                     QRDRSQNGMALNGNSTQHALKKTRFCTFVQVKYIPRTIRIWARESSQSRSPPPLNKLW
                     ELFCTIDLVFRNESRMIAGMEVAMGALVDEVAIISDVLFGRHAPVFIGHGSGYKTVSP
                     TQKFLLLQYVNKLNGMPNCFGLLSEICHQYQPGVEKESPQSMLDSVLVDMVNSMYKTA
                     VFVGIAAEVVGAWMPASPDELEMQSPSAVAFGDSTVLLDITDNTAVSDDTRKIKVHKL
                     ALILDQIYRGADIVATAWKESSYMDTSNLLCAAIDVSLLTAFEKSEGYSEYMRHIISL
                     IDVRLKDAGCDTICL"
     gene            complement(37944..40370)
                     /gene="UL22"
     CDS             complement(37944..40370)
                     /gene="UL22"
                     /codon_start=1
                     /product="UL22 glycoprotein gH precursor"
                     /protein_id="AAG30061.1"
                     /db_xref="GI:11095854"
                     /translation="MKFYCIIRFMIIANIYSSYQISLPGTYPSQILLDMKNSPLVRFN
                     ISTRDYKDETLWIRKNSTFVYIDTAVTTANVIFYLPIGQVRQMVFFKRPISRLLTSNN
                     LVKFINTGSYANHTFKTELSPYLSKTNTPLKKYEIVVDQPTGENPPAGFGSLKPADFL
                     NPGYKFVLTSELVGAYTKRSCFVDPMDSLVPIDYDHVRTIIFGSAGMEILMKMGITLA
                     SMTISTKYNPPIELIISAKYRNLSLLWPPRQQYEPVNKGTGRPHWIYLLGVYRNVSDS
                     ERDSYMNMIKSLDDSMDYHFLISRAHAQMLILAAEDRLVDEMHSFRNVIARLFVSLFA
                     FIRNAFQSGYTSLNDIIEIEADLRLIVEGISSAAFRKDASTHFLISGTPIKDSKADLI
                     KSLLSKVIRPISGHTRPLSAIQHLFLLRSAYALDIPRQNGSLSEQVSTVALSFIENIH
                     IEAMRDILSWNTTTKHALYYAFASILQRPLTEWGASRNARRAILLASSMCTEEHVIAT
                     ELAIQELYVKIRSNADPIHLLDVYTPCLSSLRLDLSEHHRIYAMADVVFYPDIQQYLK
                     KKSHEGNMKEDDLETKAEYILTKLRSPLIRTLSAYASEVLSCSDQDLLEINAILILPV
                     SGIGSYVVSRRAGMQGIVYTVDGVDVNNQLFITYTRMPCTTTIGNIVPTVLSRPSGKT
                     CPYCGCVLLRYSADGNIRYSIYISSPKLQSELIAFGNSSIRRFNPTTAQIYGNSLLLY
                     PNGTIVRILAFESERVTIISATYIATAVAGSIIALTVIVITVRMIIINMRYNYQGYNK
                     VIDVDDDIRN"
     gene            complement(40552..41604)
                     /gene="UL23"
     CDS             complement(40552..41604)
                     /gene="UL23"
                     /codon_start=1
                     /product="UL23 thymidine kinase"
                     /protein_id="AAG30062.1"
                     /db_xref="GI:11095855"
                     /translation="MALPRRPPTLTRVYLDGPFGIGKTSILNAMPDHTPDGAPILKVY
                     EPMKYWRCQSTDLVVAANETPERRRGGALSRFQSDMIMASIQARFADPYLLFHERLSS
                     KCRGKIEMCDTPAIILMLDRHPVAAILCFPITRYLLGEYSLEMLISSIIRLPLESPGC
                     NLTATILPDEKEHVNRICSRDRPGETADRNMLRTLNAVYASLVDTVKYANLTCPYEKE
                     SWEMEWLGLPWFEESLLEEFISRPRPVICSRTRMPLDRTLLAIFKRKELCSENGELLT
                     QYSWILWGLLTKLHTINVELFDISGMSRRECASAIMHTMPERLSTLASWNDLCELEDD
                     VISYNKGMCNEVGASR"
     gene            41598..42476
                     /gene="UL24"
     CDS             41598..42476
                     /gene="UL24"
                     /codon_start=1
                     /product="UL24"
                     /protein_id="AAG30063.1"
                     /db_xref="GI:11095856"
                     /translation="MPSTRRSKCKPRKYGNAGLAGNCLRGKHAGNHLMAGLLKAGVRG
                     HNRFYKKLAAENFDQSSAGNTVGRTLQKILSKILPSELLKGASAFRLAFEVDLGRRRP
                     DCICMFTLSGGLLVEGCNNVCVIIELKTCRFYRNLKTASKNEQRATGTKQLLESKTLI
                     ERMAPKGSDHTIICPVLVFVARRGLVVIRSTPLKKKAICTDFHRLASMMYLRSEYRLY
                     DSGMCKPMRKICHRNKRTVSTVRRMRCGISDTGVLPIEKQHVDARGKDCGTSGIQGEP
                     IMQRMRNIISHLSRRH"
     gene            42616..44376
                     /gene="UL25"
     CDS             42616..44376
                     /gene="UL25"
                     /codon_start=1
                     /product="UL25 capsid associated tegument protein"
                     /protein_id="AAG30064.1"
                     /db_xref="GI:11095857"
                     /translation="MSRDMVNFIWGARIMGNDHLESHPADTKNFIAPRWPIQFWKDPV
                     FTDECGALEKQLALVTARNKAAAAALDDLDGRTNTIAVEVDRRLRPLEDKLKEMASTL
                     ADLEQAASAAELADAAADAELPASVSSEPRKDDSCAENRIVKIAKNDPALRYVSNLPV
                     DLLNIIYASRGAASAGVLFGTWYRALQNMVITERPHVARKIDYHGGRMSRTFMTTVVT
                     ILQSCGRLYVGKRQYSSFECAVLCLYAFFVKTGHVDSHPSNFTTAIESVPTYLDHLAS
                     KIVEVDYKPKYGFDAKRLPKDYFEPPSGKYERDALIDHSVLKVLVKYRVLPPAMGSIP
                     RGCIIEDVDKNQTAYDDDVNSAAAALLGRAQPLFLMEDQTLLRSTLNTIASMLFLRRL
                     LWNTNIYSAKINNLFQLGSFVPGTVSSVAVGASVATPESAIRSDGRNLLFLFQKYVAP
                     IYNAIKGVELTQLFPGLVALCLDVPFFVTGMSDHKQPPARIIDTSLSKYQTTVAKLVS
                     LELENRNRGNVASIKEVIAAHDSVTLQYEHGLELLMQIQQPRARLFESRKLIAFNVQT
                     DYDLLYFACLGYIPKLVSAP"
     gene            44430..46346
                     /gene="UL26"
     CDS             44430..46346
                     /gene="UL26"
                     /codon_start=1
                     /product="UL26"
                     /protein_id="AAG30065.1"
                     /db_xref="GI:11095858"
                     /translation="MKTNDHPAVYVAGYLTLYGAKDNNDLVIDRNDIRAAIPTPSPLP
                     INIDHRQDCVVGAVLALADDDHGLFFVGRINCPLMTQTLEAAASQEIFSELENISKDE
                     KLLYLVTNYLPSVSLSSRRLEPGERADETFFSHVALCLLGKRIGTIVTYDFDVDHAIQ
                     PFTKLSDVCKSSLISEAIETEKKIGPTVWNPSKSAITKALLATAINNMLLRDKWRIIS
                     ERRRLAGIVGQKYLQASALTALDGFMTSDNGSKSIPSCESVNPETVQREGIQECDTPM
                     LSGNETIENTLGGKYIGRPPICSSTSELRDRFCEIPSENLPIMSSQSPRPPGDDFIWV
                     PIKSYNQLVSRYAQHSANNPDPVTNTNQQLYIPPTMPSTGQSPFYSGYGQYGHPLPSY
                     SSPFSSGCVQYSGIQPHPVHSGQTSLEAKLSALLDCMNKDKRQMDEGYRYDGVYSGQE
                     RRARKRPYAFDKYDESDLCYPGELSRHEPHYEGEGKNVGPSENRRDSIQTKTVLSGLM
                     GAVTSLQREVERLNGERQYTQPYAAVSNVGSGLPARYYCPTIQQLPHPVTSDTGYRAG
                     GDDGTSTSGKAVSTVRHDTGTDTPVSGPAPAIKEQITDPNMGCGVPQDTVDASAIAGL
                     GGSEIQAAMFLLAT"
     gene            45384..46346
                     /gene="UL26.5"
     CDS             45384..46346
                     /gene="UL26.5"
                     /codon_start=1
                     /product="UL26.5"
                     /protein_id="AAG30066.1"
                     /db_xref="GI:11095859"
                     /translation="MSSQSPRPPGDDFIWVPIKSYNQLVSRYAQHSANNPDPVTNTNQ
                     QLYIPPTMPSTGQSPFYSGYGQYGHPLPSYSSPFSSGCVQYSGIQPHPVHSGQTSLEA
                     KLSALLDCMNKDKRQMDEGYRYDGVYSGQERRARKRPYAFDKYDESDLCYPGELSRHE
                     PHYEGEGKNVGPSENRRDSIQTKTVLSGLMGAVTSLQREVERLNGERQYTQPYAAVSN
                     VGSGLPARYYCPTIQQLPHPVTSDTGYRAGGDDGTSTSGKAVSTVRHDTGTDTPVSGP
                     APAIKEQITDPNMGCGVPQDTVDASAIAGLGGSEIQAAMFLLAT"
     gene            complement(46489..49101)
                     /gene="UL27"
     CDS             complement(46489..49101)
                     /gene="UL27"
                     /codon_start=1
                     /product="UL27 glycoprotein gB precursor"
                     /protein_id="AAG30067.1"
                     /db_xref="GI:11095860"
                     /translation="MPMTPTMKYFNRSLFIFLTPILSIATSEIKLPNVTAREIVSGIQ
                     LSEDETTFYVCPPPVGSTIVRLEPPRKCPEPLKSTEWGEGIAILFKENISPYKFKVTL
                     YYKNVIQTTTWTGTTYRQITNRYTDRTPVSIDEITDLIDGKGKCSSKARYLRNNVYVD
                     AYDRDENEKQVLLRPSKFSTAESRAWHTTNETYTVWGSPWVYRTGTSVNCIVEEMDAR
                     SAFPYTYFAMANGDIANMSPFYGTTPTDAAAEPMSYPQDRFRQFDSYFPMDLDTRRKL
                     VTPVKRNFLVTQHFTVGWTWAPKISRVCSMAKWKEVTEMLRARVGKKFRFMARELSAT
                     FISNTTEFNPDRIILGQCVKRDAEAEIDKIFKRKYNDTHVKMGHVQYFLTLGGFVVAY
                     QPILSKSLAHMYLRELLRDNRTDEMLDLVNNKHAIISNNATSVSRLRRDLHRASSGKA
                     ILNDSVIIRSTASVQFAMLQFLYDHIQAHINEMFSRIATAWCELQNKELVLWREAIKI
                     NPSVTASATLGKRVGAKMLGDVAAVSSCIEIDSDSVTLQNSMRVVTSTNTCYSRPLVL
                     FSYGDRQDKIQGQLGENNELIPTLEAIEPCSANHRRYFLFGDGYAFYENYNFVKMVDA
                     ADIQLASTFVELNLTLLEDREILPLSVYTKEELRDVGVLDYAEVARRNQLHELKFYDI
                     NRVMEVDTNYAFMNGLAELFNGMGQVGQAIGKVVVGAAGAIVSTVSGISAFMSNPFGA
                     LAIGLIVIAGIIAAFLAYRYVNKLKSNPMKALYPMTTEELKDQATRKPHTDGSDSELM
                     SIDERKLEAAREMIKYMALVSAEERHQKKLRKKKRGTTAILSDHLSNMRLMNGHRKYD
                     KLNDTDSETDDEIV"
     gene            complement(49158..51521)
                     /gene="UL28"
     CDS             complement(49158..51521)
                     /gene="UL28"
                     /codon_start=1
                     /product="UL28 processing and transport protein"
                     /protein_id="AAG30068.1"
                     /db_xref="GI:11095861"
                     /translation="MEHGPHQPSELEYEGSIARQKLLAVWGQIQSYLFQIEILKRCDP
                     VVGMRMINRLKLNVLMIRYLEKKLLPGWKEQEDISITPITYGVWSAIRRARLEGEVLL
                     SALCDYVVEGNTRNFFVKSMSLQGVCPYHVVAELDTYGGPVTTEIKFLHDVENVLKQL
                     NYCHLIINSRSVGRFMASIDKYLLKTLGSGSIVPPELYDPSQPCSVCFEELCVTANSG
                     DSAHKRIVGKMCDHVTKQMILRVDPDDMVAHLPHATYILPDKLAVATTALNHINNPNI
                     NDTVSTNVSPDSVSQAAMVALDAHNVFLPASGDLYAISELQFWTASSGRKASHPQGNT
                     IDSFADNLEQVVAKERLFDLRSSVIETALFDKRMNHFERIFSDEIEQMNTADRLLLGG
                     RTAAPDDIIEALIKACYDHHLSAPLLKRLLYPDEAAHDALKSTLETLTSRSVRQDSAP
                     KTSESTGDTTQVTPRDAHRSLSDARGDVEWLELVRAASADAARRRKMYAERLTKRSLA
                     SLDKCITEQRKELEKILRVNVYGEVLIDSYVAIFNGFRSRRGLLEAVQTRFANVIDNR
                     RGDEAFDAYRFMQTALLKHKIDPAMLPSLTHKFFQLVNGPLFNHDVHRFAQPSNTALY
                     FSVENVGLLPHLKEEMARFMLQCNNTSSWIISKFRGFYDFGGVDNITTAHRMAWKYIR
                     ELILATALFASVFKCGDLQVCRADGLQLTLGGEYIWEDGVYLTYETDCPLVALIGCRA
                     YLTHNQSPTVLVDTDVFSLLYSILQFMAPATADQLRSDRFSNSHTHN"
     gene            complement(51674..55246)
                     /gene="UL29"
     CDS             complement(51674..55246)
                     /gene="UL29"
                     /codon_start=1
                     /product="UL29 major DNA binding protein"
                     /protein_id="AAG30069.1"
                     /db_xref="GI:11095862"
                     /translation="MDGVGKSVKLVGGPIGYVYSMSKDAVPVDELSTFAAKCIDSEES
                     ILPLIAGLTVESEFVRNVAAVAGTKTTGLVNGGITLKLVPTHYHPNVFVFYGGDCIKP
                     CSKAPNLTKACEYARERFGYCPYSAPGSVETSGKQICEQLGLDAQKTMLYLVVTELFK
                     EAIYLCNSFLYYGGSDSVTINDAEVRRIPLYPLHLVLPDFNRVSNEPFSERPRALGDG
                     AVMPEAFFNDALCRLLYGYVLGTDAVGLRVRNIDAVARGAAHLCFDENHEGILLPADT
                     TFTAFTPTADTGGKGQPKAGKRDGAETQGGGYERRTASLMASDATLAIENVIASSVYE
                     EPIPDVKKWPIFCNPVGYTDRVEALSAYMGRVAGLVGAMVFSSNSVIYMTEVGEASSS
                     DGKESGVPAPSFYRFFQIAAPHLAANPLVDRDGKPISGDALPKLAPSTSSEYSLDYLI
                     LACGFCPQLLARFLFYLERCDGGANACHHDLDTVKLVSSAIDADMPCELCDKTSRVYC
                     AHTTVKRLEYRLPKFGYQMRGAMGLFGAMTNNYCDVNALGSYAQFSTLKRSEGEASRS
                     VMQDTYRLTVERVMKALEKEGLLACDDPMNMAPADASIKDGASFIHAVSTMRNIIEGE
                     ASQLMRNLTEIRESNIREGLCDANHTLSLTIEPYSSGFCPVLSFLARRTTIAVIQDMA
                     LSQCSMLMHGQQVEARNFRTQFQSVLRRRVLELQNAGFITSKDITATLEDQHVAVPDP
                     SRSQYDPTVINMEGDLTRVTIEIIRELKVKNRVIFGGGVIGTASDAAKSRLANMIEAY
                     QRPTKTMNVLNGPLGFAIKRYHSALFPNVKMPNGAVPNAHWFWTLLQRNQLPDTMLSK
                     EDQEKALFIKKFTNVYADMNYINISPTGFGDLAQFFLANTILKYCSHKHFFINTISAL
                     VAASKKPRDPAIVLPWIDKTITQGRDVSLAAQQLIGTIADRKDAWCATFSATNLVGSV
                     MSTKPLIVIGVSISKYHGMAGSTKVFQSGNWGNIMGGRNVCSLMSFDRTHRYVMACPR
                     VGFVAEHTGFSSGLKEATLMDRARAILSEEGGAPHAEVYMLALKMVGERVRQMELEDW
                     IEITGDDYISSLIADLNEQAEQSEGGWSIDVAMGLAKETAAASAFIPSNGPTFNYEEW
                     DDGVEKRSDGHSLSEGGTKRPNLSVFDLDPVPEKRAAVLSVDML"
     gene            55529..59146
                     /gene="UL30"
     CDS             55529..59146
                     /gene="UL30"
                     /codon_start=1
                     /product="UL30 DNA polymerase"
                     /protein_id="AAG30070.1"
                     /db_xref="GI:11095863"
                     /translation="MSIVGTTFFNPCLERRKRKHDEQNALRYRIGQGRGAKHNLKTYI
                     TDLGEFKYISPKCLDVGNSQQKGTHVGRLKRSPILYKNGDVYEFLDFDACTGIWPRRC
                     SVWNGRSFLPSDFDPRFSRFHVYDMLETVDFADGAIDRDKNRFCDLLRPMGTIVTMLG
                     ITECGKRVAVHVYGIKPYFYMRKVEVDAACGCKCPRDLAENLATTIRSSLMETTDGKR
                     PCLFAARSVSADCFEIDIVRRRDVYYYGTELEEYYRVKCQSGKYMSFICDNFHPSITK
                     YEGNVDSITRMVLDNAGFGTFGWYSLKVGDCGEKVQVRSPLHHVTSCDIEINCTVDNL
                     IGHPEDGIWPDYKLLCFDIECKSGGSNEYAFPTATNEEDVVIQISCLLYSIGHKRLEH
                     AILFSLGSCDLPQSCEDVFRDTYNTTPTVLEFDSEFELLLAFMTFIKQYAPEFVTGYN
                     IINFDWAFIVNKLTVVYDMKLDGYGIVNQKGMFRVWDAGANQFQKKGKFKATGIIALD
                     MYSIATEKMKLQSYKLDVVAEAALGERKKDLSYKEIPRYFASGANTRGIIGEYCLQDS
                     LLVGKLFFKYVPHLELSAIAKLAGILLTKAIFDGQQIRVYTCLLRLAGLHGFILPQKK
                     NGLVNDAGDNVANGISEDITRSAARSGKSIQTGRNVGYQGAKVLDPKAGFHIDPVVVF
                     DFASLYPSIIQAHNLCFTTLLPAGTIINDLRRGDDYIEIDVQGSILRFVKPHIRESLL
                     GILLKDWLAMRKAIRAKIPHSPDDLAVLLDKQQAAIKVVCNSVYGFCGVANGMLPCID
                     VAASVTTIGRNMLLTVRDYIHDQWGDKSSIMCKFPELENFMQNKEYSVDVIYGDTDSV
                     FIKFTGVHIDGLVKIGDDMAQKVSSVLFPKPIKLECEKTFDRLLLITKKKYMGTIYGG
                     KMLMKGVEIVRKNNCRFINTYARRLTDLLFRNDAVADAAATIASKPPTFWTSSPLPDG
                     LKPFGDVLAEAYGQMLSKNLIDVGDFSMSAELSRPPDAYANKRIPHLTVYYKLLMRSE
                     QVPSVKDRIAYVIAAATPTVRRDAERVAEYRNDPLATSTNTDASFLESLDCVDTSNRC
                     ERAMRNKLLISDMAEDPSYLTTHKIPLNTDYYLSHLLGTLCVIFKALFGNDLKTTETV
                     LKRFIPETYTDDMDCAERLPSAIFTTIKSGAGVPVNEEEENHRKLRKAFRILTKAPHQ
                     C"
     gene            complement(59070..59987)
                     /gene="UL31"
     CDS             complement(59070..59987)
                     /gene="UL31"
                     /codon_start=1
                     /product="UL31"
                     /protein_id="AAG30071.1"
                     /db_xref="GI:11095864"
                     /translation="MTGYSALPRRKSARRSVRSARWTRRQGRDSRTSVNSSKIDARKT
                     YVNTYRAYFEFIAESPSEELMVVKDLIIPLIKTTSISLPFNLAEAVADNCLSLSGMGY
                     YIGVGGCCPTCISNGEPRLGRNDRAALILAYVQQINDIYKYRVFFASIIAVREKMGNG
                     EEKCRGAETALTRIISIPELFFAYYVLLDSGVKNVKVLFYKDHEAGDNEYMMYVVFPG
                     KSLHLHHRLIDCLKTACNNYYIIAHVWRTNFVLIIRKDYTRHADLNDVPAINADDIYC
                     KLCDLNIDGELLLEYGKLYATFDDFLPPR"
     gene            complement(60011..61909)
                     /gene="UL32"
     CDS             complement(60011..61909)
                     /gene="UL32"
                     /codon_start=1
                     /product="UL32"
                     /protein_id="AAG30072.1"
                     /db_xref="GI:11095865"
                     /translation="MSNCEFDLAPFARASAENDGWAADAFKDPYVAFNPDLLICNDML
                     FSELLFSAHAIKTKVRDTLNDVSENLEEHEDSIIQSELVTFVETCADTFALDRPCLVC
                     RVLDTYRRRLGLSAMWMADYAFLCSKCLGAPPCSTATFIAAFEFVYIMDKHFLVEYGF
                     TLVGSFAKKLLTLEDIQRHFFLHGCFRTDGGVPGRRHDEIISSRGRQGRSSRGNIKGP
                     TFGDAKVLYSNYSYLAQSATRAMLMTLSDLNDPSINTSDTPNKFLPNGAPSAVAKENQ
                     RKSTSTNPHIGQTNSCPTALSVALAGWKDCARNVECNSFQNESCTSRAASDDDAYERE
                     LDLHSDDASKTYDTEPLPAAVHTADVGGLVKKDFTVGYNNLILLLLSGTGSLPTDTSE
                     LARMASKVRKETVDKFWKTCRHELAPNVTPSYSACYTEDSEPDLELGPLMATQLKHAM
                     SKGGTSAECLLCNLLIIRTYWQAMRKFKRQVIVYSSNNIGLFHSIEPVLDAWGSVEEN
                     VDLGDDGCFLNLMKATGAEAIYKHLFCDPMCAARIAQTNPRTLFTHPTTVDDDLPLYK
                     ARLASQNHFEGRVCAGFWALAYAFKTYQVFPPRPTALSAFVKDAGALLQRHSISLISL
                     AHSLGDYV"
     gene            61908..62315
                     /gene="UL33"
     CDS             61908..62315
                     /gene="UL33"
                     /codon_start=1
                     /product="UL33"
                     /protein_id="AAG30073.1"
                     /db_xref="GI:11095866"
                     /translation="MSNDGNYTRRQSVGLLKDVIPEVELTSSQIDRLEERYLRDDAEY
                     RIWFEYLIPDEIDIIFPTTDSKLNYLSFTRRLASGIRYNTARNTLRDDGAKNTFGQTM
                     QVCEHGAALNGRSERFASVINRFLDLHQILKDC"
     gene            62423..63256
                     /gene="UL34"
     CDS             62423..63256
                     /gene="UL34"
                     /codon_start=1
                     /product="UL34 virion associated phosphoprotein"
                     /protein_id="AAG30074.1"
                     /db_xref="GI:11095867"
                     /translation="MDNPPTVNNRRGGLIARIKLVVGGHLSTGNYDHVIAEPFSGYVP
                     SRCVFQFSGADGVESAFPVEYIMRMMSDWAENECDPYIKIQNTGVSVLIEGFFNPPIN
                     AAKAPLVDKINILLNTTDSTGIALSDINRIKQFTGVDCRPFQACLNVNCFVRLPSVQL
                     AFRFVGPSDPSRTSRLLDSAVGAFDNKRRLRRNGLPCAENRPEYNTSQGCVPIPLIDD
                     IQKSNMATSNAARRILNMFKAFSSTEYVTTVRISRCMIILLLVGVILTATVWAIYVYR
                     V"
     gene            63229..63942
                     /gene="UL35"
     CDS             63229..63942
                     /gene="UL35"
                     /codon_start=1
                     /product="UL35 capsid protein VP26"
                     /protein_id="AAG30075.1"
                     /db_xref="GI:11095868"
                     /translation="MGHLCLSSLKVVEAPGHRQSRPATAEFGFNSSIPEMSQSPSRRA
                     SLPTRPFDASDLGTYTLDILHRYSLVDLVQLLNDLPRNITSTPASNVETMAKINVLRA
                     ICVGFAEVRRHNDARTLQRTAMFAADDVASRIRPSIGLKRTYPPGIFSTAITVSNSED
                     EERNSYCKNKKYKIVHKFLLSLIHEEHFYFKNVSRQPYNPRSQLIPSLRYLSCNLFAR
                     LCECIQCPPARFSEIASGH"
     gene            complement(63772..73110)
                     /gene="UL36"
     CDS             complement(63772..73110)
                     /gene="UL36"
                     /codon_start=1
                     /product="UL36 major tegument protein"
                     /protein_id="AAG30076.1"
                     /db_xref="GI:11095869"
                     /translation="MEAVRANMYKRNSLLESTAGDSELMLDRWTKRVVDTTDFSIVAV
                     GIRNQFAAELSPGSSVSCLRSSLAFLRIVFTYGLDTALSADAIDGFLLQGKDWTIHTS
                     DRGVYTTCVPHDLPNRILSKDPGGNLCVAFSSSYGESEFYLDDSTPIILDTQMSARTF
                     VERVWKQKRGDIYCLIVIGVLGIGVFKTEDSVYIFDPHGHGHIGQACIVRVSDMYFYQ
                     YLTSYADPSGMPDWSATFVYFVSTAVSAPPKEEIISAVSRLYGTADIVLDIGRADEND
                     NLKIVSADFDPSSRPRPRQTKIVVGTPKLVSEPEPADSHADSSPKLHSESTHLTPHEH
                     GEYDPSTLVGGDSTNINISDPPARTDCRRYSEGSVIHESVNSHIEDVSEATSVPAVWS
                     DASEISEEYSHLGAVAHDPSKNGHDHKPDRRSRGSNSRQKRRRPSWTPPSSSENVSSE
                     LPTFHQARRPPRKSKRALDLDYGHLSNEPPDVDGHNSDSPAGAISNISDSIEHLSLRN
                     RAVFNPHTVTGNLDNTLRDSFWNDDYSGSYPLSTISDMIDSITESIADGMRLVVPTSH
                     RDGGVLDVCIMDVFTKLFNYIIENGAQTVTDRASIVEPEMLALTRAFATSSHFSTFLS
                     STRLSLAEASESANLIESVITEGSRIGKLALSKLTMVALEVEEATITLNKSLDAIERE
                     ASTMEPDRIYERMATVLVDTFYRSGKLYSETTSYNSDQTLTNRVVSLCEFIRDRENMA
                     TRKAELILAEIEALDEGIRWMNTKFDAFVMGGGGGMSPAKGLSAIDMTATDAVAKKLE
                     SLGKAAIDIVGNALREYYSKCALYSAKVMRADMKETSKFKIVHTEQLERMTRLLSSLS
                     IIDDIILLISSRCDARVHVSVSKALESQLLKDLMEIGPHLDVADNLVTWKGLMVSVQT
                     NGWISRRELDLLLEEVDAVNDNAARRETAFTELERLHEIESKIASYTDIETVVDPTKL
                     DEALKLANSIVSITKGLDGAKLASSLSADIREKIRQKRSETELLIARLSAKYAEVKAA
                     VDGIYAAMRKLLRPLQNFAGLRVISSTIKTISDSIIPGMGSFESLLASAPPDVMGALR
                     SDLWVLITQYKTLLARPSTGTASQLSCLGGAFALAIKVILGHESEYHSASVFFGKHAD
                     VLSAALTSAASEPTSIEKTSAAVSVLKEAIADINTVDETISQQDIVLSTERADMFSFL
                     HALLTDAEGAADLASRGAYLSTLIRTTRDSSEAVIDAITKIKSLDPKTYTYNTDAEII
                     VNAKAAVSAATKQAGDCKDALTALDNEPLTYNSHIQRRITELNKLIESVNNRVGDFDI
                     ALQSYQRNRVDVERSRGEELWTSSVTSVLVNAEIKSEFDAVRINSLAETARDAEYDTV
                     RFKSRAEKIVSAHARVVENAIVTVLQFNPYSTTNIIHGLKPPIVALKNITWGDAFFAA
                     APYYTMLFGVNCDVLISLLKVLFAILRYASAHPENLDYYFLVGTIESDLRAIPSLAKY
                     VDFYRRGHDSFEGLLTRLEHMRVNALHASGRVSIEISDSLETLARTHRSEGARRALEY
                     GISIVIPSATTIMSIADALQQEKITELEGTAYAEYSAYILRRDNDAIKAITQRVEAAI
                     EAAKSRGESILKDLAEASYAVDSETAEQLANLKNLLRLVAMPAHIAKAIDKAETAQDI
                     VTQAALLLTKVEESKELDTQTVDWLKHAESVIDSHDLTVRIDGSGPMTMYAERIEALV
                     RLENRLAELKSELALAEAAWDETWSAFIHNRDRIDKSSEGFSAAQESATRAKASTNAI
                     NSIRNSMEYNRLPSKIIGSIDSKYKDRTVMLDNFLDSMKEIEDTIRQVEIICSKVPLT
                     FSLNDLRAMSSMYDDIAKRLPKWYVKQVGRYVKLIKIRLALYTAYANASTESIGDPPL
                     LPFDTGRADIAPDTAPSVRLADKYLKHRVAAWMKPKVVATLREAFSEIDMPGLTTFLD
                     STDTPLRYSICYRTACDKLAACLCETSAVNIKPRAPTNLISTVEMESAAGILNDLMIL
                     RLGYVQACADRFQLFRKYVYTGIHDWSPDYCIKAHGTIYCALIATTLTRMTGSNLSDI
                     YFIPGQYGATIEKGEVKKFMANDRRRQVVRLDPADILVTVMACTPGHVVAFSKLDLRN
                     QYGFMAQTLINVLTDAISNVLFVNCLSTRVVDGGKVDPNCRPLSLAGGEKDPSGGALF
                     AIRYSDWKRGRLSDHDPLAPWGDISGDEGAGFAKIRAVVPTDSLLLTTTVLARMCLPP
                     TALAAMWSSMLPDGIEPTCKTYDDVVMARGDGAATLCVTASTIDHTGVINGQTNLDCP
                     SLYEYTGTATTFTVVSTPPSRKLKVNAMDIAACATIFGARIVVAAECPEAFSPDSGLS
                     LCIRLFDSRSGSKGCFVEPGAVSSDITSWGAKLLAADSNPIENACLGQQLELLSHLIA
                     SKPLSEAPPCLVIVDAGMVPVKVLWAKEELEPAPIIRMTCADDALIAELPYIDSDVYG
                     EDFQHMHVLDAQEASRFFTDDSRIYPTPIYHTGVDQHNTTDGGESINFFKINPGVCPL
                     TGSEELPVYSDGEQDGYIGGGIEGNAAPDSVEYSALDIDDEGEMTPVNTNMTADVYAR
                     DIEPGVLVESHTLKPDYDPANPTSKTMTADSDLATQGDQDGFVSDVGSAMHYKPIVGM
                     EFKPEPTPPIVYEPPAPETSRMESAPLKKLGALDKNVTAMAQSIVQPDNSSIKKNTDI
                     RLAGRRTMPADNNGLRHKPKTGMSETTIKNVESYPSPPRWVRTAASQKRHGEIAGCVS
                     PPIITLQNATPVNMKEGMGIRLEKHSELYDRLDEHQTAPEALEMPPIISAPLISPTPI
                     YKELSGNWHKNIERMGRKQINSRSKERMASKASNSPLKSKISSSTADILVGMASTTSS
                     HDHSERLSPPPIITPQLRRADDMYVNIKNIPVPEVKEEGNWKECPERNNHVPEVETRT
                     LENESPPPPPNVIASWKQILPHTPRGNAHRKAVSQTTHKPPNLSSYRGPVLTEAESER
                     KFNNVRVDPIHKRSESESVSFTDSDSDDSRSTIYNPNSTDTDMSSTSRIVIADTLMTR
                     RDFRKASRGALYALTKACEKIARQITQTRDQLRSRVIGLAADIFKIKMLLMD"
     gene            complement(73329..76454)
                     /gene="UL37"
     CDS             complement(73329..76454)
                     /gene="UL37"
                     /codon_start=1
                     /product="UL37"
                     /protein_id="AAG30077.1"
                     /db_xref="GI:11095870"
                     /translation="MSALGKGDNYPLNALLDTLQTLCAENSPTEPWPVTVISEARAAI
                     GTFFLSSTQMSIQQVESTWRDVFSVILEVYQRTKSPEAAMLAQNFTGLILWRVSVRWD
                     KTSWRDESIRLRKLVGEMTGEEPISWLSRNNLRISASFGPNVMGPLITDWFAEFEDTA
                     TSAVSYTPEFLLSDRERIPNVWNLTDSLAHKRFELIYDFPFVQEGIRLIARTVGWVVP
                     FVILYRCTTNRAFTPLTRILFTIAFIDQYFRGKGASQHSVLKERFAEDCNALGSEELM
                     SASQANLTKRTSYEVRASAAIAYGDPFIYGIQPGMVAERLRSGEDIIVSSTSLTEDSL
                     AIHISAVLQLISSDGSDHSTSVIDEARTKLSESVRRAWDAIQYSSSPKQLLEALIDNG
                     FVRQSCQAYESALKTYMAKNYRNSVETIFNDLQQVIGCVAVIGNIVFGLIESYGPGMN
                     YLENYVDGSLPPESDSEFIFALGLEHGLISQILGRCIPPDTHDDYVKTTRSVLLAEMD
                     LIARKMDVGGSARALSSARESLLLWFDHRAEVIWGLSLQENSNSTDSLRDTYESAHNN
                     TPDLVDADNSEMDMVHIAINIRYPQSMPIMSQTTSTQFRKYIVATACMDALTSTTAAS
                     FSYEHIKTVISVLSWARDYGTPYINSFIDHRAKLNALISAISPFASETPPVPTTDDAY
                     NIETLLTELHEVINAAVLLLPPETRPFVPPRPKISNSVLLVTMHGVAMRHSFHKLTAR
                     TYECVQYIAEKCHELLDLASKFKHFFSCRFVQSMPGGTVAVRSRGSTELTFGSWKIAD
                     IMAAIRDSYNSSNAMLADMRLKVVTFRTVMEETGKKLPLCDSLLEEASMFSDAAARFF
                     SDLGADYAGLVRLQTSMDLHVRMLITCSHPPGMRSISHLLDKWSILSEINSSFRDKSS
                     QDLVTAIENVGNVWQGILDDRVGSNGAEREIDDTDLDDVIQTILHDYSTVYEDEPTFV
                     VELTARHNLLHRDEINFNTLDFDTLPPEDVDLAAFATDFITKPRVSADALVNIVDTVF
                     NTGRSMQGTTS"
     gene            76799..78211
                     /gene="UL38"
     CDS             76799..78211
                     /gene="UL38"
                     /codon_start=1
                     /product="UL38 capsid assembly and DNA maturation protein
                     VP19"
                     /protein_id="AAG30078.1"
                     /db_xref="GI:11095871"
                     /translation="MALPERSRNTKTASRTSEMKYYSAHSNRPYELHSLMRSIGKNIR
                     TSVGGRINLGYMNVGDRSSVNDLNVLWTADTLGMYKMDRTPAFKDSTAKTTAIIAQSI
                     RSNSEIREWGGDRAVITRQVTLTDFCFPDAEFPGSILLSMRHPLDINSEALYATPGGR
                     DPRALETAWYDLSELAAVSVNRRDGGGVRPSLVSLFFLVASRAGDYSDKNGAEAVRAH
                     VISNYGRRRMEERLDRFGICQMAMLRSHVFPHRFFQLLGGMISWVSQREIASITAVMR
                     GSQESIKTEQTTLPRSSVYVPACAYIDLDSSIRVIYEDKSASLIYLVFVYTQRLGRES
                     IRVYVMRSRLGEGTVQECLGYLYSELRANNTIHGTDGTLTPHGANVNTEFPLNSSFET
                     QSQPAKFTRKVEKAEWKVDLRGRPTQESCMYAAYCRMGYLDGSCTPLKKSERYGSVDV
                     PIVWLPGMHWDVGDWTECYC"
     gene            78408..80870
                     /gene="UL39"
     CDS             78408..80870
                     /gene="UL39"
                     /codon_start=1
                     /product="UL39 ribonucleotide reductase large subunit"
                     /protein_id="AAG30079.1"
                     /db_xref="GI:11095872"
                     /translation="MFDESDGYSGPGKIHARGIEAPGTGQIHVVDASTASRKLNDMQM
                     SSSVATELYSIERQLLSMDYLSDSDLYMIDVRKYPETIPSISDMRAHITRLVNKMKPI
                     CRFDERLYSVCGELVHLRIASSETTFDAWLTSKKLNLKADVLDNLRRYRAHIEMDMLR
                     FYGNIYPQLKRLGLQSALKYEEYLVELEGGKKESLCQFFIRLAAAAATEALHRKPLIA
                     SLTNGSANWRTAFTSFFLALAHQLFVPSTPCMLFLGREGYSTASCYLMDPRTTTTQDT
                     IKVITNDVVPHLLARGGIGISLQHVNQKSGLMHVLKLIDSLIVATNVNESRPTGVCVY
                     LEPWHSDIMSALTMRGMMAAEESRRCDNVFLALWACDLLFKRYLRYVNGEKNVMWTLF
                     DSRASILSKLYGDKFEVEYERLEKEGIGVAQIPIRDMMFAIIKSAASTGSPFILFKDA
                     CNRHYITDTQGDAIAGSNLCTEIIQKTNESTNGVCTLASINLARCVRRVNGECKFDFD
                     ALRHAVRLATVFTNAIMDGSDVPTVKSQSGRDRNRSIGIGVQGFHTAMLSLGLDLEDG
                     AVRALNKQIFELMLLEAMTVSCEFCERGLPPFPDFSDSYYAQGRLHFDGWDSVELTAP
                     EEWGVLRGRIMSSGLYNAQFIALMPTAASAQVTEVSEGFAPLFSNMFSKVTSAGELLR
                     PNSQLMRELRQIYPDNEQRRLSAITALESTAWCVKEALGDRPECTRLLKYKTAFEYDQ
                     SLLIDLCADRAPFVDQSQSMTLFVTETADGTLLASRVMNLLLHAYKAGLKTGMYYCKI
                     RKATNTGIFSGDGELTCSSCVL"
     gene            80903..81970
                     /gene="UL40"
     CDS             80903..81970
                     /gene="UL40"
                     /codon_start=1
                     /product="UL40 ribonucleotide reductase small subunit"
                     /protein_id="AAG30080.1"
                     /db_xref="GI:11095873"
                     /translation="MNNPVHAAGNPPNNYFSLDGTDLHLSERGATSPKGSDGGDLASP
                     YVNNCHITTAQYFYVPECPDIGNLRSLSIMNRWTETEFVIADDLEDVGKLSEDEKNFY
                     RFLFTFLSAADDLVNLNIDSLLSLFTQKDIHHYYFEQECIEAVHSRAYSIIQLMLFSN
                     DQAARQEYVTSTLRSPAILSKLEWLERRVAECTSIAEKYILMILIEGIFFTASFAAIA
                     YLRVNNLFVVTCQINNLISRDEAIHVEASCCIFKNYLAGPKPTTARIHTLFKEAVRLE
                     CEFLRTAAPRTSNIINIDAICSYVRYSADRLLRALDILPIYDEPKPPADFPLVLMSAA
                     SNTNFFERRNTAYSGSVSNDL"
     gene            complement(82056..83342)
                     /gene="UL41"
     CDS             complement(82056..83342)
                     /gene="UL41"
                     /codon_start=1
                     /product="UL41 virion host shutoff tegument protein"
                     /protein_id="AAG30081.1"
                     /db_xref="GI:11095874"
                     /translation="MGMYGCMNFAYANGLVKSQISGTIACGAGTPIAVDLWNVMYGLL
                     EKFYPEKIDGVEDSIITLRCLYCLLRLLHQRSYYPVFVSDRGMYGNVKALYGAKAIAA
                     TCNVVVRGSGRLRAIVHDEDEETEGGSSRKKRPHKRICRWSDKSDTPKIIHRLCMRMI
                     RFMGYPYVDAGTMEADDICANLYHTKTVAYVLSSDTDLILMGCDIIIDLTRIFPPTIH
                     CKDILAALKMDYSTFLLNFVRCHTDLHREPNLKSMQEIVELGSAMRGMGNAIDDHDSA
                     DSTIHAVNEKHIDRSGLKHNLRTTLSENRKNDHNSSTDRLCATYNDVNIIRDARQALT
                     HLRAPRTKCEVLEYKFIKHVIENITPERRTHRVSILKRFPITQETRDDSAIENLVLRS
                     IVDSNEAGSLASAFLRRIPEIPPFNRVLTKYWNRVA"
     gene            83994..85103
                     /gene="UL42"
     CDS             83994..85103
                     /gene="UL42"
                     /codon_start=1
                     /product="UL42 DNA polymerase processivity factor"
                     /protein_id="AAG30082.1"
                     /db_xref="GI:11095875"
                     /translation="MMAGITVACDHTAGEAHTPEDMQKKWRIILAGEKFMTISASLKS
                     IVSCVKNPLLTFGADGLIVQGTVCGQRIFVPIDRDSFSEYEWHGPTAMFLALTDSRRT
                     LLDAFKCEKRRAIDVSFTFAGEPPCRHLIQAVTYMTDGGSVSNTIIKYELWNASTIFP
                     QKTPDVTFSLNKQQLNKILAVASKLQHEELVFSLKPEGGFYVGTVCTVISFEVDGTAM
                     TQYPYNPPTSATLALVVACRKKKANKNTILTAYGSGKPFCVALEDTSAFRNIVNKIKA
                     GTSGVDLGFYTTCDPPMLCIRPHAFGSPTAFLFCNTDCMTIYELEEVSAVDGAIRAKR
                     INEYFPTVSQATSKKRKQSPPPIERERKTTRADTQ"
     gene            85227..86495
                     /gene="UL43"
     CDS             85227..86495
                     /gene="UL43"
                     /codon_start=1
                     /product="UL43"
                     /protein_id="AAG30083.1"
                     /db_xref="GI:11095876"
                     /translation="MPSGASSSPPPAYTSAAPLETYNSWLSAFSCAYPQCTAGRGHRQ
                     NGKKCIRCIVISVCSLVCIAAHLAVTVSGVALIPLIDQNRAYGNCTVCVIAGFIATFA
                     ARLTIRLSETLMLVGKPAQFIFAIIASVAETLINNEALAISNTTYKTALRIIEVTSLA
                     CFVMLGAIITSHNYVCISTAGDLTWKAGFFMLTTGTLLGITIPNIHPIPLAGFLAVYT
                     ILAINIARDASATLLSTCYYRNCRERTILRPSRLGHGYTIPSPGADMLYEEDVYSFDA
                     AKGHYSSIFLCYAMGLTTPLIIALHKYMAGIKNSSDWTATLQGMYGLVLGSLSSLCIP
                     SSNNDALIRPIQILILIIGALAIALAGCGQIIGPTLFAASSAAMSCFTCINIRATNKG
                     VNKLAAASVVKSVLGFIISGMLTCVLLPLS"
     gene            86710..88179
                     /gene="UL44"
     CDS             86710..88179
                     /gene="UL44"
                     /codon_start=1
                     /product="UL44 glycoprotein gC precursor"
                     /protein_id="AAG30084.1"
                     /db_xref="GI:11095877"
                     /translation="MVSNMRVLRVLRLTGWVGIFLVLSLQQTSCAGLPHNVDTHHILT
                     FNPSPISADGVPLSEVPNSPTTELSTTVATKTAVPTTESTSSSEAHRNSSHKIPDIIC
                     DREEVFVFLNNTGRILCDLIVDPPSDDEWSNFALDVTFNPIEYHANEKNVEVARVAGL
                     YGVPGSDYAYPRKSELISSIRRDPQGSFWTSPTPRGNKYFIWINKTMHTMGVEVRNVD
                     YKDNGYFQVILRDRFNRPLVEKHIYMRVCQRPASVDVLAPPVLSGENYKASCIVRHFY
                     PPGSVYVSWRRNGNIATPRKDRDGSFWWFESGRGATLVSTITLGNSGLESPPKVSCLV
                     AWRQGDMISTSNATAVPTVYYHPRISLAFKDGYAICTIECVPSGITVRWLVHDEPQPN
                     TTYDTVVTGLCRTIDRYRNLASRIPVQDNWAKTKYTCRLIGYPFDVDRFQNSEYYDAT
                     PSARGMPMIVTITAVLGLALFLGIGIIITALCFYLPGRN"
     gene            88621..89259
                     /gene="UL45"
     CDS             88621..89259
                     /gene="UL45"
                     /codon_start=1
                     /product="UL45 tegument protein"
                     /protein_id="AAG30085.1"
                     /db_xref="GI:11095878"
                     /translation="MMSPTPEDDRDLVVVRGRLRMMDSGTETDREQRHPRTTWRSICC
                     GCTIGMVFTIFVLVAAVLLGSLFTVSYMAMESGTCPDEWIGLGYSCMRVAGKNATDLE
                     ALDTCARHNSKLIDFANAKVLVEAIAPFGVPNAAYGEVFRLRDSKTTCIRPTMGGPVS
                     ADCPVTCTVICQRPRPLSTMSSIIRDARVYLHLERRDYYEVYASVLSNAMSK"
     gene            complement(89381..90865)
                     /gene="UL46"
     CDS             complement(89381..90865)
                     /gene="UL46"
                     /codon_start=1
                     /product="UL46 tegument protein"
                     /protein_id="AAG30086.1"
                     /db_xref="GI:11095879"
                     /translation="MEKRMESNCTPPFGLDSKFRQSVLRDTTDNGVPEYVVLRLALGD
                     AVGQYMHRYMYNIKRRLKRAKLSRSEVKRHFLAAYNSYFCERHSIPYTETRDPTERGK
                     AALALLFYPTIYRDPLVENPFKCQNHNLIFRNCWTSLRNLFDMIQRYAYYMRPDKIGE
                     ASSDTSARLELLLSYVVMLYKWMLWLVDTLDMTTGSKFIACRYTGDVGESLKEFMEEI
                     SSLPSDKWSSTSLLCRIIGNVIAPLLQTSVLWSQTRLVDFDGDRNSRAILAVVSLVSL
                     LNHHCQYLINLTQRGYVIWLDGNTENTILKEALLQQDQFEHQLGNLFPSMLPVSWGAL
                     ECSINTWFGRAATDDVKLSKNALALLGIKLLPKRISDVNARLMKSIRKQDKNSNKSGS
                     TPTHQLGDRVECGCGDTVPGLTEFAGAGSSSQCANIGNGLTGAIRKTDGSGGPSLASN
                     DPPVSESGRVSTPTTKYFHEKTMRGDIPVSKVEHILRRLKVSSE"
     gene            complement(91140..93506)
                     /gene="UL47"
     CDS             complement(91140..93506)
                     /gene="UL47"
                     /codon_start=1
                     /product="UL47 tegument protein"
                     /protein_id="AAG30087.1"
                     /db_xref="GI:11095880"
                     /translation="MSSKFRYGYSDQDYRRSGEPIRSHFSHRSKSGRRLSRGVYNLAS
                     EHVGASSNMDYNVDKHHYVTGGSRRFLNSSHTYVTLDDPKTRNDISGLKRKSFIGYLR
                     DTFSNRRSQPTAEYHDGGLHMNDAASRSRARSRRRPSSRSRTRHASAHTHYHMRSRHR
                     HSGSGRSTDRSSRKRSYRFHGGSNTSGDYTYAARSGRVRRRGRRSSRRRGPRAGGYGD
                     ASTNLRHDGDSEYTSSDPEYDESQNDRDNHRSTSNSLNEEYPNRLNSTSMIFVDSRDH
                     PPLSSESQNRGFIRKVKGVNIKGTQRKLPFVKSPSPMVDFIHIRLLRLLEPISFSDAM
                     REDELLHNRGKILGNGTLWHSADRPDYDEGKMYTSAPPKSAIAWKRTAKQARALILCL
                     SRDSLRNSIMNSYDLTNVKAVMFLINVGMKIAANVHRDGMARYGNIKLVSSLQFVPEG
                     DAEIFEADVIHAPRGPAASVLRACYGAIAYWPELRCILEQKSRAVVRYAISAMLQAEC
                     VLLARISSHSASLTVEELRILSACVTMICVVATLASHFLYAALGQLLHRNKNNGLYAW
                     LRNNTSSQHLPMHSIDLLHAEGACLGGLEASFYGPKGTPLGMTIVRAYIVARTSFTEL
                     MNEVMSRENAFLEKETDETGEYLISAIIAVTIVLQRLLGYLNIVVAQLTIASEIHDRE
                     VGVWSETFIMYRYLSYVCKCLYRPVTVEEYIKERNEAMDLLDLKFARGDPPMEMSEII
                     SGGGRYSELDTLELIPPPVDYDVLGNIVPLKDALLDAKDVIFEPRPFK"
     gene            complement(93741..95009)
                     /gene="UL48"
     CDS             complement(93741..95009)
                     /gene="UL48"
                     /note="tegument protein"
                     /codon_start=1
                     /product="UL48 alpha trans-inducing protein VP16"
                     /protein_id="AAG30088.1"
                     /db_xref="GI:11095881"
                     /translation="MSISNNFYSPKQLFSEIEAYANAMRCFADPVARESTENFNDAIP
                     PAFGGEAIDYTTPIIAPFSEKLSLPSPEAASPNLLYDRLILELDFAEGPSLLAKLERV
                     NVDLFSCLPLNSHLYKHAKILSTCPREVLDAVYENTWQYTALNLNEHGKSSIPPVPAS
                     KDDLPAYVTAVQEFYLEELEAREQIYAKLFFGYCRALIMHIIKSVLNESRGVRVSDDY
                     VQNKARWYISNNYYRDAVRIAKLLYLHLYLSTTRDVSQRLEAMQTSHQDLFVYLRCEW
                     GQGRQFWCIFQPMIYNHGVPMIEGRALTSLELGSSNYIRSELGLPLIRCELLEELESP
                     VVFPPTFTATAPRSSGYLFHNIRAKMELYSNIHPSVPQLSGLSDHTYVRLTHVPVNYG
                     TTVEVLLVDASDPDSILPGDPVPPLMLTTV"
     gene            complement(95112..95963)
                     /gene="UL49"
     CDS             complement(95112..95963)
                     /gene="UL49"
                     /codon_start=1
                     /product="UL49 tegument protein VP22"
                     /protein_id="AAG30089.1"
                     /db_xref="GI:11095882"
                     /translation="MGDSEGRKYERRRPSVYHSHQDGTGGTDGTTRRKSTRSLQSPPR
                     DDYLHASRVTSNRHARSPPRAELPRSTRRQSAHHAESSPPEERPGPSDHRSLQRRKSV
                     KEVEPANTSKSSSIPLGQRARPGVRAVQKNKFMFSSAPTSRTSHWKSNTVAFNQHVFC
                     CAVAAVARYHAFRGALALWNKEPPRTDEQLEDFLVRAVVKVTVREGPYLLEEAESCTQ
                     RFMEETGLGSADNKPKSRSGRSERDVESGEGSFNSGARRPIAIARLVSSAQSFADSPG
                     ERTSDSE"
     gene            complement(96088..96372)
                     /gene="UL49.5"
     CDS             complement(96088..96372)
                     /gene="UL49.5"
                     /codon_start=1
                     /product="UL49.5 glycoprotein gN precursor"
                     /protein_id="AAG30090.1"
                     /db_xref="GI:11095883"
                     /translation="MGSVGVHHISPSWSVYVIWIVCVHVVLAVDGERSIAGADFWDST
                     CSAVGVSIAFSSGFSVLFYLGLAAAISALLVGSYSACFRLFTADMFREEW"
     gene            96349..97662
                     /gene="UL50"
     CDS             96349..97662
                     /gene="UL50"
                     /codon_start=1
                     /product="UL50 deoxyuridine nucleotidhydrolase"
                     /protein_id="AAG30091.1"
                     /db_xref="GI:11095884"
                     /translation="MMDTNGAHLRIETEPEPAPSHTTRVPWRLKYRVDETLYTLDHER
                     WTCYIEDRDRRCLRVINNQVISLCKSDKREKYQICVLDLGLRVAVPQEYAVVLAKLAD
                     PDPTSRGIPVIGVANGVIDSGYRGTIKAILFYEKSCVIPKNGLAIRLSLVKLVSPNMD
                     SRILFDLSAITTHLECGPSFSSSIATAARSGASELVPIIPASANGIWNGTGCRTLVCL
                     YDSRASNASHFTSSDKNVAFAVRYNDESVVMGLKDIPKPDTQTFVRFYTSGTFGTVIP
                     FDETFTPKRSEDAGYDIPAPRDILLGPLSSTAIVIQQRYTCLDASTIPCIFGRSSLNM
                     RGVIVYPSKWSANSWLILTLCNTTTYEIKIKSGERIAQLLLVDQDCATLLPSENNTTN
                     AFPTVGKCKRPISLSGEPNWRETTMFDKEAPPSQRQHAGFGSTGY"
     gene            complement(97746..98468)
                     /gene="UL51"
     CDS             complement(97746..98468)
                     /gene="UL51"
                     /codon_start=1
                     /product="UL51"
                     /protein_id="AAG30092.1"
                     /db_xref="GI:11095885"
                     /translation="MCTRKRDPEYRHLSEHSTAHRALHRIREAVQTVNIMLPTPITLE
                     MAVLSADGIRKLVRGQSLARTYSQCLRNLDCLSQHVPGNGNPGLDAVVATHRENAQRV
                     ADTCAAALLHMYMSVDAGQTDAFVEHAIQLTAATETAMSDIALVEKALGLRHDRDDRC
                     TSIDYDSDKIVDGNSLADSQNSDAVHGCAIAVVDEVIPENNIPPTTVGKERPTDPTSR
                     VLRGEARKAGKLLTVNSLASDL"
     gene            98467..101703
                     /gene="UL52"
     CDS             98467..101703
                     /gene="UL52"
                     /codon_start=1
                     /product="UL52 DNA helicase/primase complex protein"
                     /protein_id="AAG30093.1"
                     /db_xref="GI:11095886"
                     /translation="MMDQSLKSVDVSSESVSSSIKVLFAVDGCAVSFTLGLLTGQISS
                     TNMVYIIAYWDPDDVLSQNTFLAEVENNSEPRSTGSLTLQANTESLRIEFCLLNQMTS
                     CMGGADMKLRTRPIFICRFKSKSEIGAILSSITHGLPIQADLLASTVCEEDTFMLHDD
                     FNLALHISLSNLARSGRNHKHANKIMSKDTVLSLSQSFRGGKRGLTALYLQHEQKVTA
                     AYRRIYGGSTTTAFWYVSKFGPDEKSLVLALRYYLLQAQDDISGAATDYDLQAIKDVC
                     RTYDIPTKPNPTHFSTADLTSFARLSRFCCSSDYARGAIARAFPTYVEHRIIADVSEV
                     DALREYIERDRPSLKISDLEFVRYIYLAYFECYNRKQLKRHLEDVTVKSPYESIYQKS
                     SLGRRAVENFFTHVRSRLSVHDHITKNVSPEQVELGEELGMAFIDARTYSPCTMTMNS
                     CFMGLCECATLITKRLDRLETKLQKHGWPCSRFDGTNVLSDNSNVPHSSFDDRTGICD
                     SFQEPALATRGGPMIVKRLLAMVSSDGWSGNVGPISMLMGLNVSESGPLPVYRVSMAK
                     GKQAFVTLAAECWERVIPPIGTIRDRLSRLNIAGMPTDDLLSRDRFMNVEMERILGLV
                     GTEMPYIACGPAEEQRYINRNEVFNENLVVCNIVLDVDVHLKQAIPSSRLHAALRGFR
                     SGTLRALSLLLPKANLDLRSYPCYFYKSSCKKSQSVRFARWTHLTSEYTYDYEGSCTQ
                     TWDFDTDISIDDPLLIDQMDESASRWTSDSALSAASDADIPCGCQDKIGMRVCIPVPP
                     PYLLIGSATLGGISRIIQQAVLMERDFVETIGPYLKNYDIIDVGVYGHGRSLRLPFFS
                     KIGDDGLVSGRLMPIYVLPDICENPDTFVLSHFDPRTFHFHSPRMTRLPVSTVIKNLG
                     GEYAIFFEKKLTVNRDAFFGVKRSLSATLRERGIDVNSEDSIIAFVTDFILEDISRYM
                     NEHMPECAVEYRNMGISGCVVRTDRILIHLIPNTTASRGRGFTCMRYKHTRSSRTSAR
                     SYLALNVDAHGRLCVCVIQQCFATKCGNNKLRTLFTVDVDSKCRTDQQ"
     gene            101682..102731
                     /gene="UL53"
     CDS             101682..102731
                     /gene="UL53"
                     /codon_start=1
                     /product="UL53 glycoprotein K precursor"
                     /protein_id="AAG30094.1"
                     /db_xref="GI:11095887"
                     /translation="MSYRPTIGVIAIIISMCMYMTVLIMHLSRLTKGGGDCIYAISTG
                     GKLSTENFTWERYNSTLIYTPLQGKFLMDGENLDDTCRSHLVNSSAVNKLSEYVLIDT
                     KVRFVKEARNCVAYIWKYRIRPLCFALALYVIAFNVRKWRCMFGVVRNDRDSISAIMY
                     TKNYASRVISNLWLKTTYCKIYKLMHEINFFKKALSRAFKEDPITFTFSHKVAACLII
                     LECMIRVCAQCVTISIISIFFVPCETILSTWVLIVTGVFVGIIICIELSLVCSPSPEV
                     SSSFNVNVKEMAGQLNVETRWSVCTIFSNCCAAVVSGIFLKAIYFLFMITAIVIIVRY
                     ERALQIALFGRAYLP"
     gene            102889..104319
                     /gene="UL54"
     CDS             102889..104319
                     /gene="UL54"
                     /codon_start=1
                     /product="UL54 ICP27 regulatory protein"
                     /protein_id="AAG30095.1"
                     /db_xref="GI:11095888"
                     /translation="MSTEAFSCDSEDLMSLLDYDLIKDSSSDESNEVELVETSPTSKI
                     PNTEELFAAPCSQERQQTRPSTVSPASRPTNNSGPLFVGQIREMAMESERRAEQSNSN
                     GAALARQHACGPPIGSPGNNLRVSGGDGSECAPIHKRRRAFNLVPRTRSLKRTGARES
                     SRCKSPKHHRHHDEVCHKRRATGERHDRKRRCRDRSHELSGDHVSRHKQRRSSPGSER
                     FSSQRSSVYEELNLIFSRGKRRLKTLSSDCDFRVSSKNRWASVLAFAANSEYALRGPH
                     ITWHCLLDAGPELRRTFEIRAKISALACAARESVLRGESFIGALGSAEETLSWLKMHA
                     TLHLILVNHDPIFKTAGAVLDNLRLKLAPILMCRYNTEKRSMEDMLRRSSPEDITDSL
                     TMCLIMLSRIRRTMRTAGNKYSYMIDPMNRMSNYTPGECMTGILRHIDEHARRCPDHI
                     CNLYITCTLMPMYVHGRYFYCNSFFC"
     gene            complement(104440..105240)
                     /gene="LORF3"
     CDS             complement(104440..105240)
                     /gene="LORF3"
                     /codon_start=1
                     /product="LORF3"
                     /protein_id="AAG30096.1"
                     /db_xref="GI:11095889"
                     /translation="MHFPFNKKCRENTQPLWMYPRELPRRGAYGVAARPILITDMGPT
                     INILLVGGWKGRLVTAKSSVQHRAVLWISGGQRENASQYSFNREDANTHGWFLTLGAP
                     WIVGRNILPEDRLLFITNHCSGELQSVFAGMPVALKTVLEHLHLKRESGLQPALLMDP
                     RRFLEMRDPRKIICMCELDIRDSPGAHGILVNCCCGRPGGLQCLTFIRIIETLVNHFL
                     SSTDLTCLNLTCRHSDVPTTVASTLSEDGFEHDFEYSISTISEEAEVY"
     gene            105437..105946
                     /gene="UL55"
     CDS             105437..105946
                     /gene="UL55"
                     /codon_start=1
                     /product="UL55"
                     /protein_id="AAG30097.1"
                     /db_xref="GI:11095890"
                     /translation="MAASMGYSSSSSLTSLRVQNVWHVVDPLPIVANYKSDRHDRDKP
                     VPCGIRVTSRSYIIRPTCESSKDLHAFFFGLSTGSSESMPISGVETIVRLMNNKAACH
                     GKEGCRSPFSHATILDAVDDNYTMNIEGVCFHCHCDDKFSPDCWISAFSAAEQTSSLC
                     KEMRVYTRR"
     gene            complement(106145..106702)
                     /gene="LORF4"
     CDS             complement(106145..106702)
                     /gene="LORF4"
                     /codon_start=1
                     /product="LORF4"
                     /protein_id="AAG30098.1"
                     /db_xref="GI:11095891"
                     /translation="MGSRCSKKSACVDKTLVQSLRGRNLDLPHGGYLGIFANAGATTV
                     RFVPSGSSRPMMLTHIGHACTDGLLREFVIFEGQDGSVYGTDNNVSLHFLGRNLHDIL
                     SKRGMSQRDVMVIKGKFFRSEITQLPKQRSRLKEKSDGSIRTCMDSVRINHNRSTVGH
                     FGNSNAKRCTSAITTPTMHIVTPAS"
     gene            complement(107045..107842)
                     /gene="LORF5"
     CDS             complement(107045..107842)
                     /gene="LORF5"
                     /codon_start=1
                     /product="LORF5"
                     /protein_id="AAG30099.1"
                     /db_xref="GI:11095892"
                     /translation="MHRHEETAERHSEAEKVCFAPYPSWLSLRAYSCKTSYGIIARPI
                     LITDIGRPINIMLTGGWKGGFVTATSLVHQQAILWISELQKPHKPRFISEYAPTVTHA
                     WFLALGTPCFIGKNILPKEVLGFLARRCNEEMNSLFLEMPTTLKTVFEHHYFTRGSEV
                     NPALLMEPNRFLQLMDSRKILCLYESAMCDNPGAQGMILSCYCGRPGGLQCLAFIRTL
                     EMLFNDVLSSKEFVHLAFKCKTNDAFTTLVRAISGPGYAYSITEIDT"
     gene            complement(108016..110667)
                     /gene="LORF6"
     CDS             complement(108016..110667)
                     /gene="LORF6"
                     /codon_start=1
                     /product="LORF6"
                     /protein_id="AAG30100.1"
                     /db_xref="GI:11095893"
                     /translation="MSEPVLTRILGRDVDSSVGKQDPDPDRTILLSGAVLFPDQIGKV
                     GREAKYIASIGSAPAERSTVVLLTHSDSCNHSPPTLFNPAKDSNNRLKQQLKPPIPSA
                     AWYPEIRCNSGDFSTPTTSMSSMGDRKRWSLMETMTTDVIILRCIRIKETDCTLSNVI
                     SFQRKTGLRDEIITVTPLRECSDSEELETLRSRYGPNLYTIILLGKGKIPIVRTVVSE
                     PTGSILWLHADMWQKLCKVIQFIRNTTDENFAPSGTYITTFWEQIADGAKREFGIGTV
                     YAGACENIDSMLAETLMYDSLCAAIEHNSPSFDVQHNICFKVMPEQQLKVSEQMNIPR
                     NGQHSRVEYTDKYSTVVSPSRFSILKNQTTPCYRQTRQTITRLYKGKTMGVSDRTVRA
                     LGCHKYNSDGCDCDKDHTYVSQLSVWLVRELKWAIERYCIHSDAGSSEKIRIWLMAFD
                     GLINIECTSEHKFPPIAFFTRTELGWLHRHHTRKKDAWLSSQRDLMVNDLDLQSERVV
                     ARSSMPSLYVTTCGDALAIQPLIIRKRWKTSVGRDNERLLLETQKKLRDLDDGKTGGG
                     SAQEFCFMVFIGPSMSLVIRRFFSADWSTAGKYIRHKFRKTATATVQKITSPPESSNP
                     NMAFMFCVAIAASDRKCGAITCVDTLFSIGGAARDVDSLSDSINMLLGLCDLMAMSGI
                     CRLLTIESIPELGTVPYRFVLQSADINNTQSASRVMRCGDFGAFPFGREDAIVKGSEC
                     LHQIPRQTEFINNIQCYCSSNSHDFKHYLGFFFPLKGFRVVSMRNKMWFAEYTRRFCQ
                     WFQWGEGAIHYDAMRRLVPLCDCYLTPACMTNNFFGCGLLAHLHCIPSASNESKFIAI
                     LARAFEDAQKYEDTSLHANTYVCGSRF"
     repeat_region   110792..117865
                     /note="internal repeat long"
     gene            complement(111257..111511)
                     /gene="RLORF1"
     CDS             complement(111257..111511)
                     /gene="RLORF1"
                     /codon_start=1
                     /product="MDV-1 LORF4 pp38-like protein"
                     /protein_id="AAG30101.1"
                     /db_xref="GI:11095894"
                     /translation="MSPNRQRGLSSTNSGDVVSPSRTVTMLLFTAKNFVLGSSMSFLA
                     GTLIGKAIGGQTSNRHVVGLMAAFCAGATVTGFIGSSSKN"
     repeat_region   117488..118145
                     /note="a-like repeat region"
     repeat_region   117866..131476
                     /note="internal repeat short; IRS"
     gene            complement(118855..120011)
                     /gene="vnr-13"
     CDS             complement(join(118855..118992,119610..120011))
                     /gene="vnr-13"
                     /function="cell cycle inhibitor"
                     /note="Bcl-2 family apoptosis inhibitor; vNr-13L; RSORF1"
                     /codon_start=1
                     /product="vNr-13 long isoform"
                     /protein_id="AAG30102.1"
                     /db_xref="GI:11095895"
                     /translation="MADSLKEETALLLEDYFQHCCGKEGPPPSPTAAELRRAAAELER
                     RERPFFRSCAPLASGGTQAALSALQSVVSELNSGSGFNWGRCLATIVLGGSLATALYE
                     NGCEEGPSRLAAALAAYLAEEQGEWLREHGGWDGFCRFFARFGPGLGEASQTFPLGLI
                     VAAAGIGITVLIVVWQFQS"
     CDS             complement(119523..120011)
                     /gene="vnr-13"
                     /note="Bcl-2 family apoptosis regulator; vNr-13S"
                     /codon_start=1
                     /product="vNr-13 short isoform"
                     /protein_id="AAV50026.1"
                     /db_xref="GI:55380417"
                     /translation="MADSLKEETALLLEDYFQHCCGKEGPPPSPTAAELRRAAAELER
                     RERPFFRSCAPLASGGTQAALSALQSVVSELNSGSGFNWGRCLATIVLGGSLATALYE
                     NGCEEGPSRLAAALAAYLAEEQGEWLREHGGWVSTARAGMSGSFGSPVSARSEEHRAR
                     RW"
     CDS             complement(121144..127629)
                     /codon_start=1
                     /product="RSORF2 ICP4 regulatory protein"
                     /protein_id="AAG30103.1"
                     /db_xref="GI:11095896"
                     /translation="MASPSEYDHVPGGDICNSPDFASLLAALEEGGPFHQNPRTPGDP
                     YQDVSLQTPCVSLLSTAVDPISGHNPQLPPISHHGTASTHDAGEDACSRFEPPDGRSE
                     SPASSPPSSATSCAPPSPFGLHSLYSTISNDNEVSTVSSWHSSVDRPFSSSGSGSDED
                     DNSSSDEGPEASSPPRFLDIEFGRGSRRSDPPYIFEKDAGYKAYYYERDSPEPRPPCV
                     EDIECFYEPPAPYQSHIYAARNAVSEALRASPDSYWFRFDQHHGTQAAGGESPNSCTE
                     MIDTPLPNPPVESPTPEPLESMVFSPISPASVHSVSAPLSSPVPISTQPTRLPPTSHA
                     RNSPFRHGVDDAQPRSGRMSEFSPSQTAGASFVYVRQLAMSVEALTPPHEQLAMITQL
                     PGSHAQLWSKLLEAGEEVRAYSDLVRAGQHDVCAFLLTLSDIKRCPSFWDQLAAEAVI
                     REISHQSRGKGLQKEAPLTDDNYIPFDYQGGASTSSNSSPPFSQHGHKQVVTWPSCKI
                     WLFTKGSRAVLEAMDNAAYQELESGLGSLDCGWGPENECPLPRPGTIDLPTSIMQAIE
                     QLCPTSSPIPKYAFALSALLRFLGLRIPPGVVSAIPRLSYRCLDCLRCVRRMQYMCHV
                     LTRDFSSQLQSARDIPCFPACAPPPGVGTPLDEDWNGIPVGDSPANSAEGEQCGGFYH
                     NNNAPHLSSITWIEGKRGSISPGRSYLEDFKKLHYRYLFYQVRKGLVMAPGHFLPAGS
                     ARPGVELPYEIPVPEETIPPVLSAAVHEAGCALQNIKDHCEDILQGGSEFEETADNAN
                     GFMVQQLAMAMLELGFPAYGPAIEKRIRPLYAAIEKWRAVIEAASRRCFEDMRNDPEM
                     EDCDTPMFPALPKPDWILSPATPLPAENSGGINGSGGSPSSPHSGGERYDGYCDNRPT
                     HSRNESPPHPSGLEKPSSSGESSRQCGFHISPPCSPSPRRARGRPLRRTRPPGTSSTS
                     SASFSRSPSATSSTSSSSSSSSSSSSRSSSATRSSSPSVSPSSRSSSSGTSDSSATSG
                     SERRHRSGLQDNRNSRPHGSARGRAARLCPSEKNLSPSGSPTPGPSCAATRPRSSEPL
                     IEVPDPPRGSCWFGGVGGHRPGLYNAPEVLDAIERFEASPGPVPVYVEEMGNPQKQYE
                     ALIDFLYTREKAIMTWLHHARLTSAESALDCLMNKKFQAAPRVSASAVTGAVHKCVPH
                     IASAMQTDNLLWGLPHAAATVAMTRRYDTAQKAFILRSLRTAYAGMLQSGTRPETGGE
                     TSSDGSPSAGASRRGPADDAFTVYARVLEGVKGIERAVKSGSIDAPDFTLPVGPGAAA
                     GGCSGIPLADLADACVLACDRVIAALMSGPDGFHKIAKMLSACEPRPRRARLAACQWE
                     KCRGLLVSWCNDLKRLERAIYLSNMGTAGDQGLETRTAAARRVASSGTVGPLVGHSAE
                     QWARMSSRDFTNILLEDHATVEPADPALCKAKRLRRVAEWLSPKRGAGARKLPPGVFL
                     PPPKPEQLFRGPGRPRRPRPDNHGQSRTAHKRAPTPSGPGCMVESTLAHGTSASDPVE
                     TAPKRRAGTLVTSSGAKSATHITGRSGKTAQTFASIGDSPSYPQCPPVRARERRESDG
                     PSPHPPQQTPGEAASRKRKSAPASSGSPLTAGHMQPIVLVRDIRAGRRGEIAPRSSAQ
                     IAKLEVVPSPCKKPCHQPYPTRESILNGSLRPLGNLPEDSGGRRCPVGRLVPETTLPT
                     DIRAYCPPAAAAALMDFAKIPGPWRPAMLYAPECLAEIAAVANEVPPRATSTVGGGNA
                     EPSLETLKRHTAWMHHQQHSPEDVKIVVLYKALKGEHLFCVPTPDAAYGWPRFETTKG
                     GLSFLLAAMSNRLCLPSSAAWAGRWKAAPDISPLTQAGVLFLSVGDWGWVGALEYLQH
                     LNIERHHKLIVVDTVDENSRPQGGPQFISEAVRYYRCWIDPLNQCCLRWPDAPGLDTA
                     VMTSKEVLGPVLLTEVALQCTAEFSCPQPKLCCSANVRYVVDTHLGDDMPVPTSAVFY
                     CAATRQASAQPNEHDPFSQPDFLGGEAHSHRAARRWGLGAPLLPIYLTEAGRRAIASP
                     SLISKVVRYMCGNTVLPPDPHGTPVVINVPEGTSETMAELTVAHVGRRSIGWSTSEWH
                     SATILQKDNDSRLVIIRPAASPCAVEDDD"
     gene            complement(130532..131539)
                     /gene="SORF1"
     CDS             complement(130532..131539)
                     /gene="SORF1"
                     /codon_start=1
                     /product="SORF1 C-terminus gE partial homolog"
                     /protein_id="AAG30104.1"
                     /db_xref="GI:11095897"
                     /translation="MPGHLCLYLLPVCTNIYVCTCDLTFKNFNAFLFNAGDTVDASVT
                     AHLTNWAGAFSLEFKLLFLPYNSKCLYLTVYEPCIFHPSESECQMVPEHAECRFAANM
                     DVMQLASARTDGCRVDVRGCTFQTSVDESVQGKLAFLESDVPSFRLANAQPTDAGLYV
                     IVGLYNGRPLAWTYVYLSTLETILNVFEDVHKPGFGYNAVSADTPGNFTAAPTHTSAF
                     KEGPTVIYSLLVSSMAAGVILVLLLFALLIVGLYKRHARHRTNGYFQAYPKYSSLPSN
                     DECVFGDGDFNSPLSNTCEGLSRGLAGNSKSRTPKQKGSRYHAWFADGGPAATIRRRE
                     V"
     misc_feature    131477..140091
                     /note="short unique region; US"
     gene            131813..132310
                     /gene="US1"
     CDS             131813..132310
                     /gene="US1"
                     /codon_start=1
                     /product="US1 ICP22 regulatory protein"
                     /protein_id="AAG30105.1"
                     /db_xref="GI:11095898"
                     /translation="MDGKTTHVNTKRLIYSSGDTTEQECTASEPLNEDCDENVTIDGI
                     GEEYAQFFMSPQWVPNLHRLSEDTKKVYRCMVSNRLNYFPYYEAFRRSLFDMYMLGRL
                     GRRLKRSDWETIMHLSPTQSRRLHRTLRFVERRIIPSNSYIRTSGHVPPSRALPTDTN
                     LKMDE"
     gene            132545..133174
                     /gene="US10"
     CDS             132545..133174
                     /gene="US10"
                     /codon_start=1
                     /product="US10"
                     /protein_id="AAG30106.1"
                     /db_xref="GI:11095899"
                     /translation="MIGEKTMQLADHMANSPSSIWRTPREKSTYHLIYNTSNEHVASL
                     PRSVRPLARIVVNAAETLQVGMRAGRPPSAGVWREVFDRMMTAFRDHEPTATFNAANP
                     IRKMVETVLQNNEEPPRTHAEMGNRLMNIMYWCCLGHAGQCSIWQLYETNQAILSLLD
                     EVVIGTTNPFCTLEQYWKPLCTAIANKGTSSLVEDAKVAEYLVSMRKLI"
     gene            complement(133313..134389)
                     /gene="SORF3"
     CDS             complement(133313..134389)
                     /gene="SORF3"
                     /codon_start=1
                     /product="SORF3"
                     /protein_id="AAG30107.1"
                     /db_xref="GI:11095900"
                     /translation="MIPASLCYSSFTMTRAGAIIFDNLDIPRGRFGQPRGKINDFNYW
                     TLLTDELTCGIIQCMESRERIALVHSATYDHGQFDIQKDMWCQIVLWSAYRFLSTLER
                     SFSIKSVLEFGDTNVNGSANFAINCTPWDLRDSPKMKMFGTLLPALFSFHLENWTTML
                     SIGASKGYSQCNLRQIFMRNPSFKNVIIASLEVARSAIVLTIPICEYRTPPGLPDDYI
                     GNAIKLCCARMQHLRLEHPGQCIDQMCSDPSEEEMYYRYVQRLVTSGNKYSESSENFR
                     MSVDPRVVGPRLRDCQYESIRARYPSGTRAGYGTTGRYPNNGRFKFSRFQVRHYPQYV
                     PRSKLANSKIIQTLNECNDRSHFM"
     gene            complement(134551..135399)
                     /gene="US2"
     CDS             complement(134551..135399)
                     /gene="US2"
                     /codon_start=1
                     /product="US2"
                     /protein_id="AAG30108.1"
                     /db_xref="GI:11095901"
                     /translation="MGVCMITLVTLLDECDRLPGRSRDAASTLWIFLIEQCMEHLKND
                     VGVPILVRTADLCRFAKSTFVLPRRHRPIVRIKSAGGSGMPGSGLAGTRDAFIVRLFE
                     DVAGCATEWQDLLTGYVMLESEASDNVSYSLWILGAADICRTAIESIPLPKRLFAIKV
                     PGTWAGMPWAIPCEIQTLLTSTWEPKFENIEDKAYFNDSNMACVYQIIGSPPDVPQLQ
                     GLGIESTCTPPKRNLCCCLCCRPIHDDDASVPMGVKTVDKNVHDGNMLVEAPKCITDR
                     GKFNSR"
     gene            135548..136732
                     /gene="US3"
     CDS             135548..136732
                     /gene="US3"
                     /codon_start=1
                     /product="US3 serine/threonine protein kinase"
                     /protein_id="AAG30109.1"
                     /db_xref="GI:11095902"
                     /translation="MEVDVESSKVSASNMGIVCENIESGTTVAEPSMSPDTSNNSFDN
                     EDFRGPEYDVEINTRKSANLDRMESSCREQRAACELRKCSCPTSAVRMQYSILSSLAP
                     GSEGHVYICTRYGDADQKKCIVKAVVGGKNPGREVDILKTISHKSIIKLIHAYKWKNV
                     VCMAMRVYRYDLFTYIDGVGPMPLQQMIYIQRGLLEALAYIHERGIIHRDVKTENIFL
                     DNHENAVLGDFGAACQLGDCIDTPQCYGWSGTVETNSPELSALDPYCTKTDIWSAGLV
                     LYEMAIKNVPLFSKQVKSSGSQLRSIIRCMQVHELEFPRNDSTNLCKHFKQYAVRVRP
                     PYTIPRVIRNGGMPMDVEYVISKMLTFDQEFRPSAKEILNMPLFTKAPINLLNITPSD
                     SV"
     gene            137073..138227
                     /gene="US6"
     CDS             137073..138227
                     /gene="US6"
                     /codon_start=1
                     /product="US6 glycoprotein gD precursor"
                     /protein_id="AAG30110.1"
                     /db_xref="GI:11095903"
                     /translation="MIIVTTSKMASTFMMFWCLFGIVIALVSSKSDNKENLKNYITDK
                     STNIRIPTPLFVSTENSYPTKHVIYDENCGFAVLNPISDPKYVLLSQLLMGRRKYDAT
                     VAWFVLGKMCARLIYLREFYNCSTNEPFGTCSMSSPGWWDRRYVSTSFISRDELQLVF
                     AAPSRELDGLYTRVVVVNGDFTTADIMFNVKVACAFSKTGIEDDTLCKPFHFFANATL
                     HNLTMIRSVTLRAHESHLKEWVARRGGNVPAVLLESTMYHASNLPRNFRDFYIKSPDD
                     YKYNHLDGPSVMLITDRPSEDLDGRLVHQSDIFTTTSPIKQVRYEEHQSHTKQYPVNK
                     IQAIIFLIGLGSFIGSIFVVLVVWIIRRYCNGARSGGTPPSPRRYVYTRL"
     gene            138317..139387
                     /gene="US7"
     CDS             138317..139387
                     /gene="US7"
                     /codon_start=1
                     /product="US7 glycoprotein gI precursor"
                     /protein_id="AAG30111.1"
                     /db_xref="GI:11095904"
                     /translation="MCHTGIACMVCVTLILFCIIIKTQCMVYRGSLVSTTVDQSAQIA
                     FFGIDTVVNLYGKVLFMGDQYLEEIYSGTMEILKWNQANRCYSIAHATYYADCPIISS
                     TVFRGCRDAVVYTRPHSRIHPQYRNGLLLTIIEPRMEDSGIYYIRTSIDGFNKSDYAR
                     TSIFVCNGSSGSCSNPRQKVSDEMCIPHVNRIAFERYLTLHVGRLPYGDLTLQQIRKD
                     MTTTAPTYRTIRRTTVNEGLLTAKTSPDIDLNATNLPLPISNYTDYMSVIWRRVALRR
                     IYAYLVIAIIALLIVTVCSAHKRGSCSRRRRIYIGNEPTTLTSITNGNFQEKETKNVP
                     SDISDAELLERLEKKIEMLRTE"
     gene            139540..141036
                     /gene="US8"
     CDS             139540..141036
                     /gene="US8"
                     /codon_start=1
                     /product="US8 glycoprotein gE precursor"
                     /protein_id="AAG30112.1"
                     /db_xref="GI:11095905"
                     /translation="MRACRLSILILLLQTISASMIQHLDLLEGQSVAVDIPRYPPLTN
                     GTIYTETWTWISSICNDTSMGYICLDRATCFQDLLLGTSCVRYGEEKILRVDRFVVNS
                     GSLDRIASSQFHYIPNVIIGTGRGKELTIFNATSQIAGVYTRYTRNDSRPAVMDVLLV
                     WVSVHGQAPDRTMNIYITPPSTRVDLTFKNFNAFLFNAGDTVDASVTAHLTNWAGAFS
                     LEFKLLFLPYNSKCLYLTVYEPCIFHPSESECQMVPEHAECRFAANMDVMQLASARTD
                     GCRVDVRGCTFQTSVDESVQGKLAFLESDVPSFRLANAQPTDAGLYVIVGLYNGRPLA
                     WTYVYLSTLETILNVFEDVHKPGFGYNAVSADTPGNFTAAPTHTSAFKEGPTVIYSLL
                     VSSMAAGVILVLLLFALLIVGLYKRHARHRTNGYFQAYPKYSSLPSNDECVFGDGDFN
                     SPLSNTCEGLSRGLAGNSKSRTPKQKGSRYHAWFADGGPAATIRRREV"
     repeat_region   140092..>151102
                     /note="terminal repeat short; TRS"
     gene            143939..150424
                     /gene="RSORF2"
                     /note="ICP4 regulatory gene"
                     /pseudo
ORIGIN      
        1 ggatccaacc ccgcaccgcc cgtacgacat cgcctcggac gcggtcgcga tagcaatttt
       61 gggcgtcgcg ttcgtcggga cggtactgtc cgtcgtcata tttttgatct agaacagatg
      121 ctcaaccatg cttacataac ctcaccgcga atagggatgt gcagacagtt cattacacgg
      181 ggtaaaaccc cgattcctta tcctagattg catgaagtcc aaatacgcgg gcggaaacgt
      241 aactgtctca aacttactcg agaatgttca atagaacgag acaatcaaaa acatcccgat
      301 catactacta cgaaaacact agcagttagt acatgtgcta caagacaagt gtctatacgt
      361 aatgaatcgc acagaattat ggacatcgat accgtctcga atctttgctg tgtattgtga
      421 attcaaaaac acggttgaat tctatttact tgttgatgtt tatactgtta aaacatgcga
      481 agcattataa ccacatgcgc agtgcactat agtttgagtg ctcgcgatgc cggcgaaagg
      541 cgaagtggaa caccatgcgg gttatggagt cgctcttgca attttggctt tattgcttat
      601 acatgccacg gcattgatta tggtgagtat tgtactatat tctctaaaat ttaattgtat
      661 cacattgcaa ttaatttgtg gtatgtttcc tcattagatt ttttccgatg ttaacttgag
      721 gacgggccaa catggtgacg atgtacatct tagatatcct ctcacatttg atggagctac
      781 tcccccccga gctggagatc atgggcactc ggaactatgg actgacataa aaaataatac
      841 tgactctaca tattcttcac agccacctac tatgctattc ccgaagccaa cgacagtatc
      901 gcactacccg gaacataata gcactacaat aattatacca gcctctgaga tgccggcaat
      961 gcaagatata gtatccattg tagtatccaa gagacattcg ggcagcaggg atgcatggca
     1021 cgtttctgag tacggcccga atatcattcg catgccacat acacataaag atatccccaa
     1081 gccgtttaat tcgatattgt ctaaccaatt tgcactgctc actatgtggg ataatctcgt
     1141 ggggatgttc aagacatttt ggggcaacgc gatgggtttc catcaaatga ttagagaagg
     1201 attggttgac ctaagattgc acactgacgt tatttttctc gtacatggtt ggcacggtag
     1261 aacgaacgac acggaatttt ttctgtcggc caacagactt cttacgagaa tgattccttc
     1321 ggctgctgta gtttacgttt cttgggaccc acagggtgcc atggaacctg cagctgatgc
     1381 tattctattg gctcggcgca ttaatgtcac acagtttctt tatgctgtac cctctaatat
     1441 gggaatacaa tgcataggtc attctttagg atcttacgtc tgcggttcaa tttgtagaca
     1501 atattattat accggcaaag gcagatgcaa gcgtatatta ggcatcaacg catatgaaat
     1561 tttatcaacc gattcaagtt tgatttctcg tatacagtcg gatacaattc gctcagatgc
     1621 agaatatgtt tcaatctttt caatgggtga acggtacata agaactgttt acaaagatgc
     1681 ggacgaatac atagtagcta aaggcatttc ccgaggcgtt tccacttgtg ttaatccctt
     1741 tgcttggaag ttttcacttt gtacgagagg tgtgaaaggt cgtgaatact gtgaaaattt
     1801 cggagcaaat aacgttacat tcacatcggg attgagggag gacggttcag aaatatgcga
     1861 gaggttgata cctgttatgg cagtattgca aacattagac gtctcctcca catatgctct
     1921 attacagcta gatcccaaac gaccttctgg tatgacagct cacatatcat cagtgtggaa
     1981 tgtttatgta ttagaaaagg attataggta cgcgacctat gcaaagaacg aaccggtgtg
     2041 gtattcaact gtattgtctg ttggacccaa tgggtttact cccgcggctg tatttgcagt
     2101 cctatcaaga tcggacactc ccgttataat acgtgatgca atacagcagc gatactctct
     2161 ttggggaaac atatcaatgc attcggcttt tatagaggat agtccgacac attttccatc
     2221 aattggcatt cgaattcaaa gccccatttt aggagcgttt gcttggaaag gtagagtgta
     2281 tagtggcccc cgcattcaaa ttcctgtccc agagcaggca gtagttgact acaactgcct
     2341 ccccaaagat gcagaccacc tgtgtgtgtc gacaaaaaat gtttcatcga ttactatttg
     2401 gcgcaaactg ttactagcaa attactcatt ttcgattcta tcaatagatg attgtttgcc
     2461 ctatattcct catatggcag tcatttggaa gcaccctgct atagaagttg ctacatggag
     2521 gaatattacc gttactttcc acccatccgt acaattaatg gccatgcggt ttgaaaacgt
     2581 cctcacgcca agaaactaca cgctcatgac atttcatgat gtatgtcgtg cagacgagat
     2641 aaactcgggt atattttttg agtatgattg gcttggagcg aatatgacta ttgccgtttc
     2701 aaaagctggg tcgtatgtcc tcagatggtt ctttgagatg ggaatttacg aaatacccat
     2761 tgctgtttat gaaaatgaac gtgaataaac ccgacatggg tgtgtatata tagttgtaat
     2821 ctcaactaga cgggaccttt aataaaccat tataactata tcgtttgcgc gtagtaacat
     2881 ttccattaat gcacgccatc gcgttagacg cacattatgt gtgatagtgt cgcaatagta
     2941 ccacaatcaa tttcatatac tgaatcgtag ggcggcgaaa ccgttctatg gacaagattt
     3001 atacacaagc cacgccctac tatccacaat accacttgta tttcctccac atcctagatg
     3061 gcaaggagat gccgttccgt taacacatca ggttaatgcg ccgggctgca ggcaacttag
     3121 ttgtggtaca ttccacattt gtgaacagtt catactacct atacagctga ctttcttcga
     3181 atcccgcccc tgcattgctc acagttaata aatacacaat cagtgcattg tatgccagac
     3241 aatgactacc gagaaagccc tttcgctagc gcccggtgaa tcggcccgtg tggatatcta
     3301 tgaagcggac ttcaaatgtc gacaacgctc cgtgcgtgag attctgcaac gtaagtttac
     3361 gcacttatgg ttatttcttg gcatagtaga caatagattg cgaattatag ccttttttca
     3421 ctttttaagg attgtttccg aggacgctgg ttaccgtcag ggaatcggaa ggagctgcaa
     3481 gaagagaccc agaatatacg acccgccttc tgcgcctcgt agctcaccat gaaggtgcgc
     3541 atatgttttc agctggattc aagcaaccgg cagctgtggc cattgtggac gggctatttg
     3601 cagcgtgtcg tgggttggcg gtagagtgta tgtgcaatgg ctatgcaact gtggagttga
     3661 tggaaaaatt ggctacgtct tggctaactt cagtgagcgc aatggttaca tggatcccca
     3721 tgtttgctcg ggaggcggaa ccgcccaacc agcccgagaa aaacaatcgc gatgctcgtg
     3781 cctatattat aaaacttagt ggaaagataa atgtcaatca cgcgacgtgg ccgttttgga
     3841 aattgatggg taagtgttta gattggtgtt gttcttttca cgcaccgaat gataccagct
     3901 gcacccatgg atcaccgcgt ataggtatta ggcagagggg gaataatccg acattcacac
     3961 ctgcattaga tctttattct tccattatga catggactcc aatgccttgc ttcgctgaga
     4021 cgcgcgaata tcaagacagt ggcgatgatg atggtccgtc gacatcccgg ggatcgggtg
     4081 tcgcgcgggt taaaccgaca gtaatcaggc accgagtgga taagacatct ccaagcaggt
     4141 acgagaatca taacgccaga acgtttgcaa tggcgaacca agacaaacga tctataccga
     4201 gttgggtaca tgagactgat gctgcagcac aacggccggg acaggcaagc cccagtagag
     4261 ataacggccg agggtccgtt gccacgaatt ctcgtagctc tagctctcca actatctcta
     4321 acgtaagaac tcttgatgcg gcggctgcga caaacctggg atgggaggcc ccctctcctc
     4381 caagaacacc cactttggat cccgaacctg caatcgcagg ccctagcaga gcagtcaacc
     4441 gaagcccaag ccctcgtccc ctaagcccgc caccctacca accgctttcc tgggacatga
     4501 atgcacagac ctgggacagc tccgctggaa gcgacgacga tggaagcgcg atagactcta
     4561 caggcggttt acatcacaca atgagaattg taccgcatag tacgtccgga gatagatctg
     4621 gaagagatag gaataggagt aggagcagga gcaggagtag gagcagaagc gggtctacag
     4681 aacgtgcgcg gagataccgt cggcgtacgg gacgtggggt acctcgcgat caatccgaat
     4741 caacggtaat tgtgtcgtcg ccggaggcgt ctgattagtt ttaagatgga tgtatatttg
     4801 cgcaggggat taagcggtga tcggccactt ttacacgagt agtcaggttt tgaacgcgat
     4861 cctgcactca gggtagagtt tattattaac aatattgcag atacaactca tgtatcattc
     4921 attacatgct ttggtcataa ttgatacata ttccggaact taactgttgc atacgtaata
     4981 ataaagatga tatttgaagt gatgagtcgg acatttgttt ttaatcgccg gggcaacatg
     5041 aaagtgtcaa tgtctgtcgc atgcatactg ttagtatatg tttaccgcgt tttttttgca
     5101 atccgcggaa gcattcatga attggtcgga tcgcgatctt acatacggat tcgtgcgagc
     5161 gcccaacgtg accactattg tacatttgga atgcattcca acttctaaat taaccagcat
     5221 gcgttatgcc gagccgtcga gtgacgaagt cccatccggt ataataataa aaactaattg
     5281 cagtttgccg gaatttattt tatggtacga acgagtgggt gtggctgcat gggttaaccc
     5341 catcataggc acttcattgc tgttggaaga tgttctgaga agcagattgg acgactccgt
     5401 gaaggcgggt attggcacat tattgtcgaa gatagcgtac ttaatcccca cgtcgcattt
     5461 gcggaatagg ggagctggct gcatcaactt atacgcatcc cacgatggca cgtgttatgg
     5521 ctcggtgcac ttcgatagat tcgagcgaag cgccgatgac gacaatcggg gatctttctg
     5581 cagaaacaaa acacccagac ttagaaatgg tggaaggcct cgggagacct agaaaacgtc
     5641 ggcggcctga ggggctcccc cccggcttca ttcccgcgcg cacgaaaagt gataagtctt
     5701 gcgatggggg cgaggaatca tctcatgttt gtaacgtcga aacagagtct aaaaaggcgt
     5761 gggaacattt ttctagtgtt tataacatag attgtcgttg gaaggaaatc ttaggcccag
     5821 aactctgcag tcctactgga acgaaaatac tcgccgagta tgagcgcagg cttcgttacg
     5881 aagaggtata tccctctaaa tctgatgttt ttgcatggac gaggtattgt gcccccgaac
     5941 atgtaaaagt tgtgattgta ggtcaggatc catatgccaa cgagggccag gcccatggtt
     6001 tggcattcag cgttccgccc ggctctccag ccccaccaag tctaaagaat atactggccg
     6061 ctgtgcgggc atgtttcccg tctatagaaa ttggcagtag tggttgtcta gaagactggg
     6121 ctcggcgtgg ggtgttgctg cttaattctg ttctaactgt taagagaggc gatccgggat
     6181 cccatcgcgc agtggtatgg caaattctgg tgagaagtgt acttcggaag ctatcacagt
     6241 ctaacgccgg tctggttttt atgttatggg gagcccaagc acaaactatg tattatcaaa
     6301 acgacaatga tggtcggcat ttggttttaa aatatagcca cccctctcca ctttctaaaa
     6361 agccgttcgt gcattgcaca cattttaggg atgccaatga gtttctttgc aaaatgggta
     6421 aggaagctat agattggagt cttaccgcgt aagtgacgaa tgggttaatc atcgaacatg
     6481 tacaaaaggc gctacgttac acgctttgca tactaagctt tgtaaaatgg cttgcaatgc
     6541 accttccgtt atggctgtgt tggctgattg gggatggagc tgttcaactt cgggcgcggc
     6601 tggatatgaa caagccagtc tggggagggg atgtgcacgt gagggtatag attaccaggg
     6661 atgtggcgac ccttcaagtg ccggacatga gttgcccgct acatcggcag acgcgtccga
     6721 tggggtcgta gcgaatccag aatataccca cttcgataca ttatttatgg tgtcttccat
     6781 cgatgaattg ggtaggcgtc aactgacaga tacaatacgg agagatttga ggcattcgct
     6841 ggcaaagttt accatcgcct gtactaagac gtcttctttt tcatcatcga atgctactag
     6901 aaaaactcga ggtagaattt cgcataggaa ttttcagagt aataagagct tacaaatgtt
     6961 tatattgggt aggcgtgcac atgccaaaca cattcgagct caattgcagt ctgtaatcca
     7021 agcccgcaaa ccccgtaaat attacactcg cgcagtagat ggtagtacac gtccagtagt
     7081 accggtcttc gtatacgagt ttacagctat agacactgtt agtttacaca gagataacgt
     7141 gatagagata gacgccccga acccttgatt tcaacttgtg ggatgttcgt cgtatcggca
     7201 acattggcat ccgctgcgga ttatgtggac tttgcacgta ccaaccagaa cgttgcacga
     7261 aagctgcgga atatgctccg gtacaaggcc gggcgaatgg agatggtcga cgggaataaa
     7321 tgcaatagcg ttcgagaaaa atcgttgcaa ttagcaacga gggatatgtt acccgccctt
     7381 gactgtagca gacgttcgag tcaataaatt tgaaacaaaa tctacaaacc tgcgtatgtg
     7441 cgatttattt tcggtatacg ggagattggt caatgcaagg ctcataacat ttagctatag
     7501 attcgggtac atgcaaattc gttagtgatc cgtcatgcat ttcatattct gttccggcat
     7561 ctgaaatgca tgacggatta ctaatataca atctcgcctc acgaattgct tcagcgagaa
     7621 ggtcttccct cgcatccgag acctcagcag ttccgggaat attgtttgta tgcccggcaa
     7681 ttgtgaacgt cgttcgccat cctggatatt ccgactctaa ggtaatagtc tctacgtcat
     7741 caatgttctg cgagccatcg tttttctgta ctatttcatc atcggtcctt cgagggccca
     7801 tctgttggga catctgaaaa ttatcacacg gttttgcaag tatacctgat tgtccataaa
     7861 ttgtaattgt tacgtatata gaatttccca tccccaaaat agttaagatg cctccagaat
     7921 tattatacac gtaggcatca gttcccatca cggtacatgt agcgaatgga ataacacaga
     7981 gcgcttcggg taatgatgat aatgaggctg agtggtgttc ggcggtatat tcttcaacac
     8041 gtagtaaata agagtatata attgatccgc tgtcgacaac aatgagggta cctaccggcc
     8101 cgcgctgtat tatgaaatta gacgggggta tgtggtcgca tcgggtcatc ctgccgacgg
     8161 caatagatcg ggtaccggtt tcacaagagc atatgatttg ctcgtaagga ggcgtattac
     8221 atatcggcga cattctggcg ttttctaacg tgtaagcgat gaacgtggag gccatatgga
     8281 aattggaggc gtaccggtca ggtgcgcggt cccgaagatg tgccaataaa aattgaccgt
     8341 tgcgtgtatt agtatacaat atggacgttg ggatctctca gggctgctaa taagtgctca
     8401 ctaatattat tatcatctct cgtatgagtt tctcttagag ggttgatgtt cattctcaag
     8461 aattttgatg aagtcactct agacatagca acgtaaacgc tgctaagttt cagtcccgac
     8521 tgagggaaac atatggcagc ccgttctagg ctgagacctt gggatctggc gatggtcatt
     8581 gctagttttg aacttattcc atagtccgca gtgacggcca tttttaattc attttcgtct
     8641 accatttcta caaaatctgt gatgttgcta ttcagggcag ccatgaaacc gtgttggtct
     8701 tttagaacga cggtcggcat gttaagttcg cagagtactt cggcgacgca tgtatctatc
     8761 ttgcgcctga tgggctcgtc tgcaaaagcg ttgacccgag catatgtata acccatgagc
     8821 gtataactgt ctgtctgaag agcaagcgat gacattccac cgcgcatatt attgatgaaa
     8881 atttgacagc ctttcgtgct tacgttatct acgtagctat cgaatctatg tttagaaaat
     8941 ttatcgccaa aaaggtctgt cataatggca tacctgcccg tgaatatatt ctttagcatg
     9001 ctgaattgtg cgtatatttc cgaagatgac tcgagtcggg taaactcgta attgcaatac
     9061 aacagatcga tcatctgtcc atccaatgca gaaaaaatta catcatccgc ttctccccaa
     9121 tggctttcga atggggcgga ggccgattgg gaatattcgc gacaattgat gccagtgagt
     9181 atagccgatt catgaacatc ggtgatatcg tgggtttggg tttggccccc aggaaataaa
     9241 atcgatgttg tcagtgttgc caatcgctca tacgctacct taacaacatt ttcttgaagt
     9301 ccccgttgtt ggagataatt atagaaattt atcattccat taaatagcaa ttgagataaa
     9361 aatcggtatg cgtattctat agagccttct ccgtgtgttt ttataaatga gtcatctttt
     9421 agtacagata gaaatgactc gaatgtcccg caaaacccaa acacccattt tctgagacgt
     9481 gtggtgacgg caacctggct atttaaaacg taggttatat cagaacatga tatagcaagt
     9541 cctaactgac ttcgaatttc gcatttgctt ctcgtggaat cttgatctcg gctctgtgac
     9601 cagttactca gacgcgatgc atttgcaact agccattttt caatagtgat gcttgtctga
     9661 tttgcggcgg tacaatattt ttcgaaagct tccaaattaa taaaggtgta tgctggcagc
     9721 gtgaacacaa caaacatatt atctcctgac gtttttagat aatcgtgcaa tctagacatg
     9781 taggcactaa cttctttatg agatgaatat agtcgggtcc atccgggaag attggctgga
     9841 ttattaatat aagactcagg cactacaaaa gagtccacaa ttctcgcgtg ttcttccgta
     9901 attggaagac catattctaa tactttgaga agatccccaa attccggttc ggtgcatctc
     9961 ttattgttaa tgaaaattga ccagttttta gatagatcca gatatgatct aagcgtcgga
    10021 ttacaaataa tgtatgtaag aatgttttca ctcgtccgaa cattgcatct taatttgctg
    10081 tgttcgaacg tcgtttctag tgaactggtc tgagtagggg agccgacaca aaccaataca
    10141 ggtcggcgcc ctttgatata ctgcggagtc cgatacgtag cgtttataag ccaccagcag
    10201 tatacaatgg cagtaagcaa gtgcttaccg atcaggccgg cctcgtcaat aactattatg
    10261 ttactgcgtg taaatgaagg tagcgagccg tttacaccaa acgctgtcca agctaagctt
    10321 cctctatccc tgcccaacac ttcctctaac atataaacca tatcaaattt tcgcggcccc
    10381 gcatcagtct ccaacaactt caaagtacat tttgtaatgt cggacaatac ttcccagtaa
    10441 tacacaagat ctcttttttg caattctttg atcgtaggag ggttgctggt acatgcatag
    10501 tgccatttac ccaatgttgc ctgaacgtga tgccccttaa atccaaattc ctgaaatatc
    10561 gtgtttatgt gagaagatgt gtaagaatta ctgagcttgc cataaatgtt ttgtgacgca
    10621 acctttgtag tgcccgtgat tatacagtcc ataatttccg acaatgtctg aatacatgta
    10681 cttttccccg atccggcatt cccactaatc aaatatgcgg aaaagggtag gtcccgtagt
    10741 gatagtgtcg atggatcttc aacgtttgat gcttcgatga agtatgacag cggggggatg
    10801 agctcatagg gcaacgttgc attcgctaat actctcacgc gtgagatgat ggaatgtatt
    10861 ccgtgcattg ccgtaaaatt taagtacatc gattcatcaa acctgtcagt tgaactacga
    10921 gccatggtgt aacggcaaaa tgctctccga gtcttatagt gatgatgaga cggcacactg
    10981 cacacggccg atgtgatatc ctgcgagcga taggcgacgg aaatatggac tacgatccgc
    11041 accgtgacaa aattcgccga cccgagtccg aatccgttac gaagccagca gtgctttcca
    11101 atgccccatc agaaccgtgt gttgagaacg agtggatctt ggttcaccct acaaagcaaa
    11161 cttgcttgtt caaagaaata ctttcaggtc agtggggata tacagaaggt cagggtgtgt
    11221 ataattctat aaggtctgca gaagctgtct cccgccagct gcaaagcacc attattaccc
    11281 ttactttaga agcggccaga tatgacgaac ttcataggga ttggatgaaa cacatccatg
    11341 cgcgtggaat gtcggccaag aagatcgcaa aacgatatgg gcgcgatgaa gccgaagcta
    11401 ctagagtagc tagaagagtg tttgagacct ggcacaaaac tttacaaagg actctcgtta
    11461 atttgttcag gcgattgatg gcagaccttg ttgcacacga tccgaatata tgcagcttcg
    11521 ccaaatatat tgactggatg tgttgtttag gtatagttcc tgttataagg cgtaggcggg
    11581 ctgctcattc gatactccaa agtaaggaca actctcgtaa catgttgggc ggggagttcg
    11641 acagtgcggc ttgcagactt ttaacggcac agagtatcat ggatcatggc aggcaaatta
    11701 cagatcacat atctgcttct atgcaagcag taactattat cgagtatgat agagctataa
    11761 tagaatataa ttttttgaag cgacagttga gggttaggga tgcaatgagc ggagaacgtg
    11821 gagagtgtat tgttatttgg agacctgtca tgagcgacaa cggcgtagtg tttgattcac
    11881 ctatgcagcg gatatgtaag gagattgtcg aatgtcacga tttgcgcata cacgcggcac
    11941 tgtgtcgcct aataaacact ccccccgtta gagttctcat tgccaagcgc gatccggaaa
    12001 aaaaaggagt atccggggcg caaagggctg tcgaacaggt tctcggggac caggtagaga
    12061 acgcagctgg ttctgccgca tctagactag taaaattgat tattggattg aagggtatgc
    12121 gtcatgtggg ggaaattact gacacggtta gagattactt ggaggaaacg aacggacatt
    12181 tattagatac atcatctgta gacacgtccc agccgggatt cggtcgatta aatagaacac
    12241 ctaatacaag ggctgcggat ggatctcact ccaacaatgc taatatccgc gatgcatttc
    12301 atgcatccgt tgtatctaat atcaacgaga tgctagaagg ctatgtaacc aaattattca
    12361 gcaccgtaga ggggttgaaa gccacaaata aagacctagt cactagactt agttctaagg
    12421 agctagaact agataggatt cggatggagt ctatacaagc caaacaggca cgtgcagaca
    12481 tggcgtacca ttcgcaatat agcccgaact tggaaatgct agcacgtgac ttaaaacatg
    12541 acataattga cgttggtgcc aatatggatg atgattcgta tgttgccaat agtttccagt
    12601 ctagatatat cccgtgttgt gatacggatc tgagaagatt gtctgatctt tgggaacagg
    12661 aattgatgcg ctgctttaaa atgaatcgag tgatgaatag ccaggcgaag gaaattgcaa
    12721 tactctattc gaacagttcc attacttcca tgctagctcc atattttttt aatgttctta
    12781 atatttacga cataggatta tgggttgatt gcgaagacgt ttataaatca gaggaggatt
    12841 tgtgcaactc attgtttcaa aagacgcggg tgcatactta tcttcaggat ttggccacct
    12901 tctttgaggt ggatgtgaga agagctgtcg cgaagctttc ggacgtattt tattgggggc
    12961 gtcccgacac attggaaatt gctcctgacc tttcctatgg aagacgacac aaacatcgtt
    13021 ccccacccac tcgattcaag ttgcactctg gacgctttaa ttatagacgc tctaagagaa
    13081 ggagaaggtc aggaagcaat tatagaagaa ctgatccgac agcctatggc gagaatgatg
    13141 atggagatta gagaaatacg cggagtttcc actcggttta ctggcatttc cgtaaacaag
    13201 cttagagtgg atcaaggctc taaacggttg tgtttgacat tagcgggggc tgatgccgga
    13261 tcggaaatag acagccatgt gtattatcag caatgtatga cgaatactgc gttcaagggt
    13321 tttgttttta ttgtgctcac tgctgcagaa gatattgtta agagcattgg ggtaccgccc
    13381 tcgctattaa aatttaggct ggctttattc aggcccagag accatttgga ttttgcgtta
    13441 tgcttactcg tggccttttt ggaaaataga gttggagatg catccgatgt atcattgtat
    13501 gtgcagatac agagcttttt aaaatatgcc tggacacgcg taacgtcgat aaacaaaatg
    13561 cgtcggtttt tgtgtgtcac tattacgtgg ttattgaata cttccatgga gttgggatct
    13621 atatgtccat ttgacagggg atatgtcctc cctcattaca gcatatataa acacttgaat
    13681 gggacatgga gtatgtgtgc aaatgtgata agagctatat atctccagga tgtaccatcg
    13741 actatgtcgc aagcacaatc agctttacgt gggagagact ctatagtatt gaagaatgaa
    13801 ggtctattga acggtgcttt ccaaaaagac tggatagggg acgtcatata tgattggtgg
    13861 aaatgtgacg gagataaatt gtggggtgaa gaaggattgt tcggaacgta tgtgggaaag
    13921 ggggacaata aataaaaggt ttttgtctaa aatattttaa cgtcatttat tgcgaatgaa
    13981 cataaatcga tagtggtcga catcgaacat gagtgagcct tgatcaacgt ttggccattt
    14041 gaatgctatc acactgccca acaatctaga aagcgcggac aatacaggct tcatgtgatc
    14101 tacacaggag atcgcgggaa ctatgaaatg agtatcaccg aatagcgagc acacaacggg
    14161 gactacattt ccgttggttg taactgcttg aaccatctcc cgcctaaaag cactagtatc
    14221 acatctagac gcggctttcg atcctagtgc tacagcatag agcgaatcgt tataagaatc
    14281 cgtggcgcag caccaaaaag atgcgtcgcc gcgctttttg aaggccatgt acaagaggtc
    14341 gtggtacatt ttctgaactt tctcttggat tgttaataac gcatcttctg tatcggcgca
    14401 gagacaaatt tcttctaaga ccgtgctcat ggcttcctta gcgtgcgttg caaattctgg
    14461 ctgttttgga aatcccacaa agttcgattc gcgggtattt ctgttccaca gccaataaca
    14521 attaacattc catgacatgg cgtgtgtgta aacaccttca aggcgcatct ggagatttat
    14581 cccatctggg aaacgcagcc caattgatgt ggtcagtcta ttagcgcttt cattacacag
    14641 aacacgcaga gtttcaaaaa tattaccatt accctctggc gacactatag taccatttgc
    14701 cttgtctata aatgcccccc acatcccatc tctgacgtat atacacgggg cgaacattag
    14761 ggttgatgca gcggactcta tttccaaact aattagattt cctattccaa caatcgcctt
    14821 ataaatatct tcgcgaaagt gcttcagcag tccgccaaat tctacaatgg gtctcttgag
    14881 ccagtcgctt tcgcgcctca ggcgagccaa aacggcgtcg cggagacgtg tatgacaagg
    14941 gaaaagtccg agataaagag tcgcgaaaaa agcactaaag tctaattttg cgatcgcagc
    15001 attctctatc agagtgggtt cgcgaaaaaa acaagttaat ctcccctccc cccagtcggt
    15061 cgcaattctc ccttgagcaa cattactctc cgctaaataa tgacatatat ctattgtcgg
    15121 agacggatgg ttatcggggc gccacggagc tagtaaatga aacgttctag cccccgccat
    15181 aggccatagt ccatctgtgg ctgcataaga atctatgact tcttttattg ccagatgaga
    15241 ggccgtcgag gatttgacca tcggccatcc aggaaatcca acgatgcaag cataatcaag
    15301 gtcctcgcct tctgggttag tttcaggacc aatgtatgtg aatatgggcg ttaaaatctt
    15361 ttcgggacca cccgctgtag agaacagcgt ctcgcgccac ttggtgtata taatcatcag
    15421 ggcggacaga gaaaattcgc taggagttgt gaccaggatg tcaaaagatg caggcactaa
    15481 tgttaatgtc cgtaccgaag ccccatctat gatcagaggt ttttctgcca cgtggaatgc
    15541 attatcggac acatgcaatt tggttttctt tgtcctggac gaacgggatg tatattcacg
    15601 ataaaatatg tcattttttg tctgtatttc aatcttggca tcaaaatccg cgagttcgat
    15661 gtttgacatg gccgagagtt taacacgtgc tagagttgtt ccatttgtaa atttcatggc
    15721 ggcggacaag aggctagatt cgtctatatt tatagtacca tctgttttca ataatccagg
    15781 gcgaggttta taatgttcgg agtttaatgg agtacacgat aaaactaatc ctgtaatttt
    15841 atctacgtgc atattaatgg gcgtatagta tgcattgtag cccaggcgat gtcttaaatt
    15901 tgacagtgtg aaagctagga gagctttcca caatgtattt tggtcggcat tgagaaacgg
    15961 tagtcggtca ttcgttgctg cagcatttgc catactcgcc aatgtagcat ccgttatcgt
    16021 ttcgggattc catccccaag ctctcgctag agatttccca gagaagttga ccgttgcata
    16081 gtgagcagcg tagtttccgc cgacgtctcg gaaaagcaaa tagcacagcg cggtgagacc
    16141 ttcgtcatga ttactactag tccacagtct atacaaagtt gcataacaaa tacatccttg
    16201 cagttcgact gcactgatgt cgttcatctc aagcgtttac gttcagatta taaacggtga
    16261 aagtcgatcg caccgtctat agctggccaa tacgacgcgg gcacctcagc caaaaccgtt
    16321 tctagttcca taatgtcatg atatatccct aactcggtgt ctaggcgaga tcttattagg
    16381 tcataccact tggggcggcg aatttcgtaa cgcggatttt ggaacgctac cttgtttttc
    16441 atcagaagtc tatacagatc cttgtgcgtc ttaactaatg ttctgtttat ccccacccca
    16501 tctagcaatg cttcaatttc cgctttgcgt aagttcttta ctttcttccc acccggaaac
    16561 gtgctggtgc tttttacaac acgcagtcca aaaagaattt cccatgtggc tttgagcaaa
    16621 gaaaccgcat gttcgatgtt agatagctga ttgcagtgct tgttgttcaa gccgctcaat
    16681 acatttttag tcgttatcac gggtcgcttc gtagccgtct gggcgtcaag tagataacac
    16741 cgcgcaactt ctagaacagc cctggcatat gtgctgtaat cagtgtttac aagctgtagc
    16801 aatagtgaag gatctatact gcaattattc ccctccagtg ggtttatatg tagagaatct
    16861 gcccatttgc aacaaagcct gtacaaatcc catctcccag atgtattgaa gtcgggtgta
    16921 agagaaactg tatctagttt tccgttggat ccaattatcg gtatacttcc agaggcgtaa
    16981 aagtcgtata ttcgccggaa tacagcttcg ctgtagagag cggctgaagt tgcgcgacat
    17041 gcgtccaaca ttgttatatt tataaactga tctctagcaa taggttcgga caacttcgtt
    17101 agaaacgttg ataaactttg aaaggatatt gtgggtttaa tgtatttgcg cacgaacact
    17161 gcaacaacat cactgtcgag aatgtcaacc tctaatggta tattacaaac agcttgcccg
    17221 cggacgagtt ttaagtcttt ctgggaggcc aaggaatcgg tccgcagcgc cattaagaac
    17281 gagaaaaacg tgtcactgtc gaatccatga tcacacccat caaaagtcac ttgcattagg
    17341 ttggactcca gaagtgcgtg gataatattt aaactatcgc ttatattatt gagcgtgcat
    17401 cgctcgaata gatgtttgta cttgaatcgg ggaaacaaga aaagaagttc tgataatccg
    17461 aacgtcggaa agcaatccct cctaaaatta cgacacagca tattagttac ttgataaaat
    17521 cccgtggccc atccaccatt tttatctata acatgattca gcagcatagg tgtaaatatg
    17581 gggtctgacc tagcacccga tgcatccatg tatattaaaa cttcattaag ccttaaagaa
    17641 cggattcgtc ccaaagactg ataaaccgaa accatatcag gtccattaat tgtcggtttg
    17701 acatatgcca tcatactatg gaaatgagtt gtattaaaac tgagaccaac agtcacaacc
    17761 gttgtgtaaa tgacgactcg ataattggac cataaattca tatccaccgg ctcatcgcgg
    17821 gtagaattta aaacgagaac tgcattggta tatgcgagac agaaacgtgc ggctatctcg
    17881 gaaaacgata ttgtggatga aaaaatgcat acattcaacc ccccttcgag ccgtctacct
    17941 agttcataga agaaagtact ttgttgtaga tatgagcgtg atgtgcttct tatcaaatct
    18001 gatgtatttt gaatttgggg agtgccttta ctgttggtcg gatttaggac gttgagtaaa
    18061 gtgtccgtac ctaaactccg caatatttta cagcatctca tggaaaatcc ccgggatgca
    18121 tattcgccaa taataacgtg tatattttcc tctcccctca aaaaggccaa catgtctaca
    18181 agctgagcat taatcgtagc gtccattgct acgatttggg gacattttcg caaaagagaa
    18241 gttaacatag aatcgacctt acggaggtgt ttcattgtag gcgaaaaaag ttgccctatc
    18301 gtagacatta tttcatccaa tatcacgatg tcgtaactgt gtaataattt atgatctatt
    18361 ctatggagag attcaatttg tactaataat ctataaaatt gtttcccctt cataatatag
    18421 tcgccggcag taaggtaggt gacaaatcca gctattccgc tattatttaa tcttccggat
    18481 agtgtctcgg taaaactacg tctacaagaa acaattaata cactcgttag agagttgcat
    18541 aaaagacttc gaagccagca gagcagcgct gttgttttac cggaacccat cggtgcgcgt
    18601 acgacaagtg tactgcgtgc ccctgtgcat agcggtgacg gaaaagcaac ggggccgtcg
    18661 gattggcgct ctactgttat cgctggtctg tttttagcga tccactctat cagatccttc
    18721 ccatatagca ttcttgacaa cgaggcgctg gatgcgtagt caatcatttt agtaatatcc
    18781 ttgtcgacga cgccgctaaa gggacgatat cttcataggc acgatcgata cgtcatggat
    18841 ggccaaacaa aactgaggaa accccgcggg ggatcaaaac agatggacta tgtttacaaa
    18901 aagatctggg cgattcaagc ggcgtgtttt acgatagccg tgttggcatt cctaggaacg
    18961 ctgatgtccg catctataca tctggcggaa ggtttcccgt gcttttttgc agctgtagtc
    19021 gactatgcaa tagtcaacac tagtacgata catactggtc ttaccaatcc caggctggga
    19081 ggtgtggttc cagtactttt ttttcaaaca aaatcaacag tgttcttttt ttatgcaatt
    19141 agtattgttt ttatggttct gatgttctac ataatagtgg gtgcggtcat agctaataaa
    19201 agtcatgtgg gcgtggcata tatggaaagg ggcatgtttg catattcgct cataatatcc
    19261 ccaacaactc tgttgttggg gacagtgtcc atgtggttgc ttcaagcaat agttattgtt
    19321 ctagcccata aattaattgt gctggcagct gctatttacc ttgtatattt ctcggccatt
    19381 acattttttt atggatattt ctgtggacgg ggggtagata gcaaggtata tgcggaggat
    19441 gtagcgacga ccaaatatat tgatagaaca ttgcatagaa tagtaggcag tgtaagagcg
    19501 gttgtaataa acctgctgtc gatcgtatat agtttaatcc ttattatggc aggtcttatg
    19561 tttggaatgc ttctggcgaa tagtttcact ttaaaatttt ttcatgttat cgtggtaatt
    19621 cttgtcacta cttctatatt gactctcatg tatcttttaa tagtcgaatt tttaattgcg
    19681 cgatatgtac atatgataat gggtacttat ttggggctga taataggcta tggaatgctc
    19741 tggatgacat cttgcgatta tgtgaaccgg ttttactatg ccatggataa tgccagcagc
    19801 ttgcgggcgg cttgtcacgg agtattagca gttttcacga tactaatttt gttaggaatg
    19861 attgtacggc tcgttagagc aggtttatat caccgccgac gatcaactca cgcatatgcc
    19921 agcgctataa aactacaaaa gagtgttaaa gaacggctga agcgatggaa cagaggacgt
    19981 acacgttacg atagcgtggc tgaagatgaa cacgcgctaa cgcaaactcc ttacacagaa
    20041 acttcagacg atgagacaat atacgataga gtttattcag gatcggatag tgagtgggat
    20101 gattaacatt atctggaaaa gtaaataaag atcgagaaaa cggacatgcg cgttttggaa
    20161 ttacagactt tatagtatgg ggtgttttgt atagtccctc tcatttttgt ttatcctttt
    20221 cccgatgccg ctagggcggt caagtaatgc aattttggct tcttcgacat agtccgtata
    20281 tcttaattcg tccaagttaa atgaatcgta attctctcta tctatagcga tggtctgtcc
    20341 tgatttggtc agcagtatat ttcgtttgca acaacgcctg aacgtgtccg ttaagtatga
    20401 ggttgtttgg cccataactg ctttacaagt tcgccgaatg ctcggcagcc ggcgctttct
    20461 atctcaccgt agaatgcttc gtccacgatt acgggcgtga caattagaag taccggtatg
    20521 gcttggtccg catgcactgt agaaatgggt tttcctaaac cgctatcggc tataagtgaa
    20581 aatttttttc caaattctcg gcgtttcctc caacggccta taaatgtcac caggaatgga
    20641 gttgttcgtc tttccccgaa gtatcccgcg gcaacatatg tttgaagata aatttgcttg
    20701 aagttaggat gtcgggggtt tgaaaatata ggaacatcga gactcaattt tccagtatcc
    20761 caagggaggg ggtagatggt gtctgtttca aggtcgggct caccgaatag ccatacgcga
    20821 gattgaacgt tgctgttcag ctccaagtgg catttatcga atgcattgca gcgaatacgt
    20881 gattgggctg cgtggtacgc cgagttcccc accttccatt cttcgttgga tgtaatcaat
    20941 gcttctttcg atctaggaac gttgcctggt tgaaaatagt ctacacatgg acgttgtatt
    21001 gcagatatga atagtctgag agaacccata gttcgcacat tcaataacct ttcataacat
    21061 tgggaaagct cacttcgttt gtcaggacaa aatgcatatt tcgccctgca tttaatctcg
    21121 tacgtctcta tcgcctgatt ttcagaatcg ggttgtaata atccaaatgg atcgcgctcg
    21181 cataccaaca tatctaggga ggcccccacc atgccggtcc tggtatctat catcaatcca
    21241 cacgagtagt cgctttctga ttgtattgtg cgatcgctca catcttcaaa tacaaataca
    21301 ttttctctcc gaggtgaggt attatgtacg tgccgggaat ggttcaggca aaacatagtt
    21361 accaatgact tcgccaaggg ttcgttgtgt tttccgaaag caacactaca ggtttctaca
    21421 tacgcggtgc tattatccga cataattcca acagtatcga gtttgccgtc atcggtccat
    21481 ttaacagacg aagccgtcaa tagcgactgt ctgaatatat gccacagatc acagttggcc
    21541 tgctctatgg taaacgattc cactagtaga caccatcgaa gagcatggtc ggacggcgag
    21601 gatgtatttc ttcgtgattc atttcttagt tcgtcttcag tatcgagtat acacgaatag
    21661 gggtatccta accaacgccc ctccgatgtt ccacgcttga tcacgtcagc gatatagttt
    21721 aggcgatggt acaacgggtg aatcgcctcc ttcaattccg acggggcgag gtgatataat
    21781 atatagcggc tgaaagtata atctgtcaat tctgaatggg ggggatgggc gcgagtaccc
    21841 agtgtagggc ttgccccttg caattgggaa ttaaccgaaa cggttaatat ttttcgcccc
    21901 ttggatgagt cttcgcgctc cgggcggtat ttttttccta ctggctcgag ctccatagca
    21961 gaagtgtggc agatctcgcc tgaggatttg aatgacaata tagtgctgct agttcaaaaa
    22021 ggttgtttaa gtaggacggc actttcaggg aatcaaataa cttcctatga gtgacttcat
    22081 aatttcccag atagttatca aagacgcagc ggtgacgaga acattgtaat tggggtctta
    22141 ttttttcggc ccgttcccac ggtatatcat ctctaatagt taggggtgtg attggaaata
    22201 aatatgcata tagaaggcat ctgtatgcca atatgtctaa gagatagtct gctttcatca
    22261 tacgatggta atagtaatga acgggattgc cgggtatgcc gaactcgagc gtcaagttca
    22321 tgccggcggt gaggaggact tctaatagag attgtccaag agcatacatg tctatagaca
    22381 gacccgcctc gctggtaaga ggactagacc gtcgacccaa ctctgtcttg tttagagcct
    22441 ttattatgat ctcacatggt tgcgtctggc cgtggcctaa aactaaatcg aacacaggga
    22501 caacgtttcc tttgtgaact cttacggtgt gcacattatt tgaacccaag tcaacgttaa
    22561 atcgtgccct tgtaagggaa gagtttgtat taagtagagc cagactaaaa tcaccgagaa
    22621 ctgcgtgtac caaaatagga tcgtcatctt ccgaaacgtt aacgaaaata tttccacatt
    22681 taatatccag atgggttagc ccgcatgata cattcaaata aatgacagct ctcccaagcc
    22741 cagtaaaggc tttctccact gccctccaat gccgaacgcc tttattcatt ctagccaatt
    22801 tataagaata tgattccata tccatatgat atgctggaaa tacgagctct ttggaaggaa
    22861 ttgaaaatgc caatagcggt atgatattct ctattgcgag agcggatttg gctcttgcgg
    22921 cacattcgcc ggcgatcaac gtcataacta actcagttct gaagcattcc aatacttttt
    22981 taacagctat attcgcccgt ttaaatattt taacttcgcc gtagcttcca ctgccggcat
    23041 atatgggagc ctcacccaga tcgagacgga tatagtgcag accgggcgtt gtatcaaata
    23101 cgagtgatgt gatagtcttt atccgcgaca acgtaaatat atgtttcggc gaagaaggta
    23161 ttgacgccag agtgccactt ctttgttggg actgttcgcg cgttccacaa agacgtttta
    23221 aacatctcct aatgttgcac gagatgcgtc ttctacagca tctacttctg gagacagtgc
    23281 gttccggtgg attacctgct tcgatatcga aggcgtggaa gtggttgggg ggggcaaatt
    23341 ctggtcggtc gcttggctgt ttgtcgtctg aacgcccgtg ggaacccgcg ctttttccgt
    23401 catccgagtt ccatctcgag cgtggggggg cgcagccgat ttggtgggca gaagcggtcg
    23461 cggtttctgt tccaagatcc atttagttaa tagcgcctct gcagtttcac taaactcttc
    23521 tatatcttcg ctagaatcgg ccagcgttaa ttcttcgcaa gcttccgtca atattgcttc
    23581 tttgtcgata agatcctctt cggcctgctc taagtggctg tgtagctcgg ggctcaagaa
    23641 acgcctattt gtttctagaa tgagtttacg gtctacctga tcctctatgc gacgctctat
    23701 aagtcttaat tttctttccg tgttctctaa tagtatgttt gagcgaagtt gggctttgtg
    23761 atctgtatgg gcgtttctag ctgacgtgaa tgtcgcgatg aatgccggat catcagtccc
    23821 cactccttca gacaagagtt cgagtgttcg ttctttatag atggtttctc gtacccggca
    23881 ttctgccaaa agctgccgcc gtcgtctccg cattgccgct gcggcgaaca ttctctagtc
    23941 agatcgccca gtgtattacc tggcgaaatg ttcggcggcc aacttggttc ggagacgagg
    24001 aggcacttcg aaaagttact gagagaaaga aacaatcgtc taggggcggc aggtagaccc
    24061 gaaaagaatc tcaggaacgg tgatattatc gatgccccgt ttttgaattt tgctatacca
    24121 atacctcgaa gacatcaaac ggtgataccg gctattggca ttctacatga tagttgcgat
    24181 agcgcgggga tttattctga tgttgccgcg cgcatgttat acacgaatat ggtatactcg
    24241 gaatttgata gagcgaataa tgaatctcca tccagcggga gatcgttagt taaggaagcg
    24301 ggagcatttc tttctcctaa gatgatagac tgtgcaagcg cattaaaatt taaagagtat
    24361 gatgatacgg agtgcgcatc tcatcgcaat gcgtactata gtgtaatgaa ttccttcgtt
    24421 gtcatgcgaa catccgatgc ctttaagcaa ctggtttcct ttatggatcg gtttgcgaga
    24481 ttattgtcgg catcgtttag agatgtgaag gatttggatg gcaagcccac agataagagg
    24541 atgaaaattg atattccacc gtacggcaaa acacatggaa ctttagagct gtttcaaaaa
    24601 atgatattga tgcatgctac ctatttcgta acgtcagtct tgctaggaga ccacacagag
    24661 cgtgcagaac gactgctccg tatagcattc gataccccca atttttccga tgcggcaaca
    24721 cggcattttc gacagagggt gagcgtattt ttggttccaa gacgccacgg gaaaacgtgg
    24781 ttcttggtac ctttgatcgc tcttgtcatg gcctcgttcg aagggatacg gatcgggtat
    24841 acatcgcaca tccgcaaggc gatagaaccc gtttttgaag aaattggaga tcgtttgagg
    24901 aagtggttcg gtggtcaccg tgtggaccat gtcaaaggag agactattac gttttccttt
    24961 ccaagtggct cgaggagtac agttaccttt gcatccagcc ataataccaa tgtaagtagt
    25021 tacttagcca cgtggcgtgc ttcatgtatt ggcaaatgag tacttatgat atataacata
    25081 gtctcggtag tttgatgcat ccttgaatca taagcatgct ccagtttgta ggcagggaaa
    25141 ctaaatgcca accgcatgaa ttgacaggcg tgttgcagca agctcctcct gcaacaatta
    25201 tatcttcgag gcggtcggtt attttcgagt tctctgcgat cattagcttg accgacttta
    25261 ccatacccat aaataataca caataaagac ttgtatcgcc ttcaactggc agttctgttt
    25321 ggcgggcctt catccacatg catggacctt tacataggca tgcatgtcca acagtcccac
    25381 atccccaact cccaccatac acgtccatgt gtgacgaatc gtgggaatta cattgtctac
    25441 agccgttttc gtgatctaga aattttgcaa gagtagcacc caagcttcgt tgttgccatc
    25501 cagccgggca tattgccaat aggctttctt ccattcttag gtaataaaat ttgcgttggg
    25561 aaatggacca ccaggcacct atggatacag ttatacacac gtccgggtct tctggcggtc
    25621 gatcgcgttc ggctaaggca tcaatgtcgg gtcccatagc cggtggtggc ggtaaaggct
    25681 cgtttgccac atctgggagc actaatggaa ggtccgccgg cgatacaccg gaaaaatgta
    25741 tgatgtccgc agacccttct ttatgacgaa ggggaactat atgtaaagtc gatgtgatgg
    25801 aatataaacg tactccattt atgacgaata atatgtagaa agcttttcgg cataggcata
    25861 gactcttagg tcgcgtaaga tacatgaaga tttctaccca tttagtttta tgttcttgcg
    25921 cattaggagg cgcgtgcata caaaatgatc gatccagcgc gagtacagta ctcatcactg
    25981 ccagcctcga gtcggctcgt aatgtacgcc aaacacaagc acggtcgttt aacgtattga
    26041 caaagttcac agccatgtcg ccacagaacg tttcaaagcc ctgatcacat gtatccgatg
    26101 gtcgtcgcgc cttgtccata tttatgtcca agagatcggc tgtcgtctag caaagatatg
    26161 ggcgcgggtt tgtatccgca aaattactca tgctttgctg ttgcatatcc tggaaagaat
    26221 tgcctctata cgtgcattcg gccaatcgaa ccgttcggcg gcaatcgctg tcaacacaaa
    26281 ccctccgggg aatacgatga tcacgtgcat gtgttcatca tagccaacgc agatgtaccc
    26341 gtaactttcc cccgggagga atttctcaca tgtagcttgc gggacaaacc attcgggaaa
    26401 cacgcactcc aggctcgacc gaacgcgcat ccgtttgtcc cataacccca tccgaccgtt
    26461 tataatgact gggacgggtc ttttatttaa ccttacacac tcgccgccac tactgtagta
    26521 atcgaataaa acgaggtcgg gcatcgcctg tttcatagac agaaatccac accctaagat
    26581 atctgcagcg tttgcagtcg ttgttgacaa gtagatggcc cccgtgtatt tctttacata
    26641 tgcggccata tatgtggcta cagcagaaaa tagtgctcca gaggaaaaaa tttcccatga
    26701 tacattccca attgcgtgca tgacagcgcg cgtgcaatta ggaattctat tcgatatctc
    26761 ggttatatat tccacatcgc gcgcgtatat acggtagccg atcagctgat gcaatctagg
    26821 tccagttttt aatttctccc cgattgcagt gataatgcaa tttgaggtca ctatcttgaa
    26881 gtttatcatc aattccgttt cagcgctgga tgagaatgct cgaatctggt tccctgtctc
    26941 attcaacaga gggttgtgta aaataggggc cgctgtagcc agggcgcgtt ttcgttggag
    27001 ggataaatta gacgggtgat ttactccttc gtccatacac gcagttgtca gcaaattatc
    27061 aagagatgtt ggcaatgatg ctgtattgtc tgctttgcca ccaatggcgc ttgaatgttc
    27121 gtaggcgatt aggtaaaacg ggacgttagt attagaatgt gttctgagta ctatcgatac
    27181 gttgccacat ctccatagat ttgcgggtgc tattccatcc gataagatgg caattgtcat
    27241 agaaaatatt tgtttgggac tcaatgtact ttgggacggg gtatccaaca tgagaatatc
    27301 ttctaaattt gatggaattg tatgcctctg acaattatta gaatcgcctg agcgtccatt
    27361 cctcgtatta tagccgccga aaaatctacc ctttcccacg ggctccagtc catcaatgac
    27421 cgcgtcctgg tttgctgtac ccttttgcgc ataagcatta ttttccaggc aagcagttgc
    27481 tccttggcgc agccctgaga ctacactaca gatagtaccg ggggatgtgg atggcagtat
    27541 gtgtgatgtc acagcgtttg cactaacagg cgctgttttg ctaattgccc ccactgcctt
    27601 tttaagtaag ttggttatct ccatatgact cgcatctatt cgtgcatcta ccgcagggga
    27661 atcaaaactt ttatccgagt ttgttagcat ttgtgttaaa ttaaaatcca tgcggatatg
    27721 attgtctggc ccagtaatat caggtaaaca cgtttccagg ttcgccccaa gctctaatac
    27781 ggtatagggt aagtcgtttc cgtttttctt gatataatgc aacaactgca gaaacaacat
    27841 ttttaaccgc tcttcgtcaa ggttataccg agtacctcta ggtaccaatt catcctgcgt
    27901 aaataataaa tctttatatg atatgtattc gccggcatgt tgcgttttac ttagaattcg
    27961 aactgccaca cgcgtgaaag ggtcgtagcg attttgcgaa tcacactcaa ttggcaaact
    28021 aatgaatagt cctccttggt cttcatattt aggcaatgag aaaatcttct catgattacg
    28081 aacatggggt atcaaaaggg tatgcaatgc gtcacaagga acatatatgg ctggagaaga
    28141 gacccagcgg gaacattttc ccgtgccgtt aaaccgtgtc tgaagagata ctgagataaa
    28201 cttcgtttgg taaccatcga atgttagtat gggcgcgggt gctttaatat ctgctatatt
    28261 tattcccgca gctgatagac aatcatctgg tataataatg tgggataacc ttttatgaga
    28321 agagccatgg ttcgttaatg agtataaagt ttcgctctct atatgagctt ccatgtgtgc
    28381 agcatacctc aataacgtcg ggcttgttcg gttatagatg cagtgctggg tatgggaagt
    28441 atccgattat cggcccggtg gacgtttttg gttgtattgt tcaccgaatc ttcttatatt
    28501 cccgcagagt attcgaggac aagacttcaa tttactgttt gtcgacgagg ccaatttcat
    28561 acgcccggat gcagtgcaaa ctattatagg atttctaaac caatctaatt gcaaaataat
    28621 attcgtctct tctaccaata gtggtaaggc aagtacgagt tttttatatg gattaaaagg
    28681 atcggccgac gctcttctca atgtagtcac ctatatatgc gatgagcata taaagcatgt
    28741 gactgattat acgaacgcaa cgtcatgttc ctgttacgtt ttgaacaagc cagttttcat
    28801 taccatggat gggacaatga gacgtacggc cgaaaagttt ctacccgact cattcatgca
    28861 agaaataata ggagggggtg acatacacaa gataacatgt tcgggtgatc gggggatctt
    28921 tacctcatcg gctatagata gatttttgat ctacagacca tccacagtac attgccaaac
    28981 taacacgtat cctgatttgt acgtttacgt agaccctgca ttcactgcca atgcaaaagc
    29041 ttcggggacg ggcgtagcgg ttattggtag aagcggattg gattatatcc tttttggatt
    29101 ggagcatttt tttttgaggg ctcttacggg agattctgtg gacgctatag gagattgtgt
    29161 cgcacaatgc atcatacaaa tttgtgcaat tcacaccaaa cggttcagaa tgataaaaat
    29221 tgccgtcgag gggaatagca accaggattc tgcggttgcc atagcaacgc gaattgctct
    29281 tgaactgaca tcgtatataa agtctggagt tgcccccacc ccacacgact tttcatttta
    29341 ccacagtagc ccagccggaa ccgatgttgc atatccgttc tttttactgc aacgccaaaa
    29401 aactgcagcg tttgatttct ttatcgcaca atttaattcg ggcagggttt tagcttccca
    29461 ggatatcgtt tctactacag taagtttgaa catggacccc gttgagtatc taacgaaaca
    29521 gcttgtgaat ctttctgaag tggtgactgg atctgcgtgc aacagaacgt tctccggaaa
    29581 aaaggggggt tctgacgata cacttgtagc attgactatg gctgtgtata tatctaccca
    29641 cgcttctgat ggtgcgtttg ctcacctcac agtcgtgtga aagtatgcag taaacattag
    29701 gtcgctatac atgcatttta taccattagt acaaattaga ctttttacat gtaattatct
    29761 gtaataaaca cactttatta tcaatattta attccagttt gatataacag ggcacatatc
    29821 tccgaccttt acgtttgagg gtccatcaaa tgtacaagct ctcagaagtg atcgtaagga
    29881 taatatgtct ccaaggtgag ttgccatgtt aatccacgac gaaagcgctt cgtatatggg
    29941 atacttgcgc caagcatctt gcaaagcggg tgggcgtgga attcggacga gttgtcctac
    30001 tgccctcgtg gcagtttcca gacctatgag tgcgttaata tatccatccg aaactcccag
    30061 tgtcagtagc gtcggtatca tagtatatag aatcatgttt ccttcggtaa cggcaaagag
    30121 catgtttagt aacaatgtcc tggccgcaga ttctgcggca tccaggcttt gaagagccgg
    30181 ggtgattgta tatgatttgc cgttataggt tacagtttcc ggtcctctac tggctggagg
    30241 gttacgttca gcgctagatg caatagtttc tatcgccctg gagagtatct ttgcgaatat
    30301 ttctctcgcg agtctagatg gaacagtggc tgggaataat aaatctacat caaccgattc
    30361 tagtcgcatg cggcagcaga tgtttggaaa aacgggcggc atgaagcaaa tggcatctcc
    30421 gttgcatagg tcaaacgggc cggtgttttg caatgccagc ccacatggta taggcccaat
    30481 tccaaggacc gacgtgctca atcttcctgg caaaacccgt gttatgacag cggcgaatcg
    30541 agttttaaag atagatagta gatttaaggt atctggttcg gttccggcaa cataaaatga
    30601 tttgtagtct acatctgtta acgatagtct ggatcgcacg gtcggtagga atagtattct
    30661 accttcacat ttcttcagca ggttcgcatc acatgttgac aatctgcagg ggagctctat
    30721 ttcaactgtc gtaccgttga acgaggccat ggcaagaccg cgatggcgtg tgttcctccc
    30781 gagtctcaga ccagttttgg gtaggggtcg ggaggaattg ccttagtcac ggatcggggt
    30841 ggtaatatgg gcggttgatt agcatgtggg tagacacccg ccaatgggcg aggaatcgcg
    30901 aattagatat tgcgctaagt gagactccga cccatctgtc gtacctttag tatatgaaag
    30961 tagcagagct ttatccgtcg cgcagaggat tgggtatgct tcttgaaaca gcgaacacgg
    31021 gtcttcggtg agttccgtgg atcccaccgg ccgtttaaac tggatctcac cgtcacttgt
    31081 ggaggcggac ggggcagacc ccgcttcagt aatcaatttg tccaagcatc tggttttaga
    31141 acacacttcc gctggagtaa agaacttata tgacgggcta aaaagcggag aagctccgct
    31201 taaattgtat gtgccattat atagcctgtc tgcataagaa tatctctgcg acgcccatgg
    31261 attattggtc gctctgaacg ggtatgcggg atccccttgt ttatgatcgt acataatgtt
    31321 atccacatct tgcatgtctt cacccgagtg tattggccca gctgcccgcc ctcgtgggtt
    31381 gcaaggtgtt ttgaaatact ccaaatcaga tgaaactggc gtagggataa attcgcagat
    31441 agacatctga ccatgttcca aaccactagg taaactgggc attaatgtac ccaaaaaagg
    31501 aacgggtctt tgcggcgccg ttctttggcc acgggttgct actttacgca aaaactcatc
    31561 ggcttctgga ttcaaaagcg ggggggatcc gcgtgtcaga tgtaaactct gagcagtgtt
    31621 tcccatatcc gtcacggcat tgcgtaacat caatggggtg cagacagccg tatatccaac
    31681 tcccaagtcg acatttgctc taggctgtgt aagagaaaat tgcacccctc cggcatgagg
    31741 cctcttagta acggaaactt gcccaagaaa ataggattct gatgcgcgtt cggcaaacaa
    31801 acccatatct gccaagaatc tatcttgtcg tataacggta aaagctatac cgggatgtag
    31861 gcccgttcgc agctgatggt acaagcccag cgggctcaat ttaaaatatc ccgacatcaa
    31921 tgcatacgac atttcatttg ggccgcacct acttcgtttt acatattgcg ctaatggctg
    31981 gcggaaggtt gaataataat ttgctcccaa aaatgatggc acgggcggag ctctctcgca
    32041 tattgttctt atattaccgg gtaaggcgcg cattgccgcc agatgatcag agcatgcgaa
    32101 gagagcattg acgggcacgg gataaaaata tgttcccgcc acgatcgtct cgtcgttgca
    32161 cggataagcc atcataagaa ggccatggtg caatgcacca tcgaacgttc tcatgcgtct
    32221 ggtggatgca gatgcgccgc ctatatccgg ggtggtggca tagagtatag ccgttgtccg
    32281 ctccgccata ttgtttacgg tttcttgtaa tgtaaggagc gcatctgcat cggcagatat
    32341 cctagcattg tgaagtagaa cattaaatgt attggggatc agattcctac catttagtgg
    32401 atgcctggga tcttcgggat caatgggcgg ttcctcatcc gagtgaactt cagggatgat
    32461 gaccgcttgg gatgttgcat agatgttatc aaaccttata cccatggtac aacattggcc
    32521 tctagaaaat gctggaacta ccacgtaata atatattttt gagagtattg tccattcttg
    32581 gctatgatgt ggaacaaatg cttgccgatc tatgtcacgt acaggcctgt tgtgaactaa
    32641 aacgttgcct gtgcgattga agtctgcatc ttgcaattcc agccaagggc ggacggtgta
    32701 attttcttcc ccacctacgt ttaaatataa ctctctatca cggataccac gggtccgata
    32761 tatcaaaggg tcgcaatccc aaagcagagg aggtagaacc gtccggtcga tgagcacgtg
    32821 attcaattca tcgtggctct gttcatataa agaatcggtt tgctccgtat agtcctgtac
    32881 aagcgatctc aacgcccgga cgtggcgcat tagctcctta tatatattca tacactcttc
    32941 tggaagttct ccactacaca aataagcttc tatgtacgcc accatatgaa agttgttgat
    33001 gaatgcaacc cgtttagagt tgtcccaata gcttcgtatg cattgaatta ccaatcgcat
    33061 gagcagccca aagttacgtt cgctgccatg aattacggct tcgatgatat agaaagcagt
    33121 agggtaacta ctgtcagcaa aggtgtcgga caaggcgctg acggtactgt cgctcaattt
    33181 ataccgggtc gacgaaagct ctctgccaag agcatctcta aaatctgtgt tgcatagagg
    33241 caggggaatg ttgccgttgc atacacgcca agaagcctca gcggaggcca ttacttgcgg
    33301 aatattatgc ggaccgggga gatccacatc tccagggatg acaaaaaaat caaatgcagg
    33361 gtgcaattcc atgaacaggt tttcatttcc tgtagacatg aactgttctg ttgtcatctg
    33421 acactcttct acccatcttg gaaattcgcg catcatctct cccacatttt cgaagaactg
    33481 gcgcgcagca tccatcaaag gtagcgctgg cgggtttgtt acatatgctc ctaaagtgca
    33541 agtcaattcg tatctgccac tacgcaaatg attcactgtt gcctcaatgt ccaaaaagga
    33601 tgggtgacat acggttccga tggcgtctgc caatgtcaaa catataagct ggttgtcctt
    33661 gttataaaaa tatatgtctc gaggagcaaa attacgtata tccccaccag atcctacccc
    33721 tggtgcgtaa tctcctgcat ggcgggcata tctctcggaa attctttgat aaatacctaa
    33781 cggaattata aatgtcagat ctacataacc gattagtgga tatctaactt gggtggcttg
    33841 atatacacgt cgctctaggg cttctagaaa aatgagctta tcaccaacca cgacaagttc
    33901 tgctggtaca tctgccattt gtaggcgatc actgtcgcct tctattactt tgtccgtgct
    33961 gttcataact tcgtcttccc ttaggtttag gatgtaacga gcgacgtcgt ccatatttcg
    34021 tactgctttg cccatgacca cagccgttac tagattcgtt cccgatatta tcatttcacc
    34081 ataagtgacc ggtactctgg cggatgtgtc tgacacattt agaattccgg ataatagttt
    34141 ttgcctcacc attgcggtgg tcaccaacac accgtctact agtctgccct ttgaatcggc
    34201 atgggttagt ctcggcatag agattgtctg ttgggtagag tttaccattc gtgcgagaaa
    34261 cgacaggata ctttctcggc ttatcccggt tttactcata atgaaggttt cgacacatac
    34321 gcgacgttta agctccgaga ctagattggc acgcataacc tggctatttg ttctcccttc
    34381 tgacaaagcg tgcgatagag ggatcagcag cgtagccggc ggggccttct ccaatagaat
    34441 cctaagcatt tgatcaacgg tcccccgttc gaaggagtca aggatcgttc tcacatttcg
    34501 agctagttgt tgtatggccc tcattctaag atgttttgat atagctgtgc catccaacga
    34561 gacttcagat aataatgcga gggcttccgc agctacaaca aaggcagcgt tcagggatct
    34621 cctacacact cgcttcacca tgtaattgtg aacaggctga tctgcgggat gtggtccctc
    34681 gcgcgcaatc attggttgtt gtatttcaaa ttgaactgtt ccttctcgca tgtacatcaa
    34741 gtcgggagca cgcgtgcata tgcatgctac agataggccg gtttcgagaa atcgtataag
    34801 tgatagggta ttgcagtacg ttccgagcag aatgtcgaat tgggctgtat agcgcccgtc
    34861 atcgtctgag ctgaattgct taaaatagtc aaacatgcat cgatgtgacg acatttcgat
    34921 agttgttaaa agtctgcccg tgggggctaa agtagaacct atgttgaaag gcggcgaaaa
    34981 acacacgacg cctgttggtg gacaatcctg agccggggaa attggcatgc cataatcgcc
    35041 gatactgtcc gttcgatgtg agacgttcaa gcaaaaaaca aatttcatta agatgcgctg
    35101 gacgcgagaa ctaattatgg caccgtggag gtcgttctat cgcatgcgat tgtgcgaatg
    35161 tgccaactgc gaatgccgtt attacaataa aaatgtgact tgaaaaatcc gcgaagcata
    35221 ctctcaaaac cggaacagct attgttttgt ggctagcctt tatggatggt gagatgtcat
    35281 gtgtacccaa ttttcatgcc ccgccttcta ttaaaacggg acaatcgtct tgaatactgc
    35341 ctttacccat aaacgaggga aaacgaatcc gatcgcgtct gatatggaca gtattccgta
    35401 gactagacat gcgatcatgg cgaggtatac tatgtatcca cgtgattcgt tgtgggctga
    35461 taaaagttta tccaaaatcc acgcgtctgt aaaaaccacc atataagata taaccacaaa
    35521 aattatcggc cctaacgtag ccaggattcc cacaataatt tgctggattt tatttagggg
    35581 catttcatct cgcttcatat ttctatacat caaatatatt tctagaacta acgtaccgta
    35641 gaagaccgtg gttataatcg aacctagaat aataaggcga ctgtcgtaaa agtataagta
    35701 gtacatgaag aaaattgcgc agcataacgg tcgtagtccg aaagcggata accagaacaa
    35761 tacgacgtct cgagtaaatc tgggatagct ttcacacttg tctgagttga aagcataatc
    35821 tcccaagtaa gacgatattg tggcgtactg aatggcatca caatccaatt catctgctat
    35881 actcgtcaga agtgcgccga catgcatttt gctcgcatct aacggttccc cagtagcctg
    35941 atcgagaagt agaacagcac agtcatccgt ttcttccgtg ttgtagaagt catattttac
    36001 catgatcggg acagaacctg atccaggcaa gaatactttt aaatgaactt tagtcgtcgg
    36061 gtaggagata tgtgtctgaa ttcggcgcta tttgtgtttc atgggcgggg cctgtgaagc
    36121 gaaatgtgca tctgtgatct ggcaccgggt cagcgctctt gcttcggcac aactctattt
    36181 tttgaacact tcattaccca tatattctga ggatcgtata cggtatttgg caatggatat
    36241 aaaatatgaa caaatgatat tatataaaaa cgttaaattc tatgtcgccc cgggcggaca
    36301 tcaggcatat tttttctgtg gtggatctct catcgcaatg gagcggccag tttatggtag
    36361 tacatgtgtg gcggaatttg caaagtttgg acttgtcctc gggggtggtg aatgtaaacc
    36421 gttggcagca tatattcgac gcgaattgtc gcggcggggg atgaaatggg ctttaccatc
    36481 agagggcgaa gacatattcg tcgactgtct cgctatgctt agccgagatg gaatatgcag
    36541 cgagagggag ctatgtggag atttgagttt ggaaacgtat gatccggcca taacaaatta
    36601 tatagtatca gagagtggag tttcgggtct tcttttatgt atggcggacg attcatcgga
    36661 agaaaacaca attcatcttt ccgagacacc gactgtgaca gatttgcata ctgattgcac
    36721 gtatgattgt aatcgaaacg tattcacact cgcgtatgcg agattgactg aactgcccaa
    36781 ttctctgcac tatttagtcg agggtttgtt tgatggcatc ccagttcccc gattgccatt
    36841 atcccctaat acacgtaaaa cgcgaataga tattgtaatc actgcaaaaa cagcggcgaa
    36901 aacaacagcg gtaaaatgca cttcgtggca acgcgatcgt tcccaaaatg gaatggcgct
    36961 taatggaaat tctacacaac atgccctcaa aaaaacgagg ttttgcactt tcgttcaagt
    37021 aaaatacata ccgcggacaa ttagaatatg ggcccgggag tctagccagt ccaggtcacc
    37081 cccgccgcta aataagctat gggaattgtt ttgcacaata gatttagtgt ttaggaacga
    37141 atctcgtatg attgctggta tggaagtggc catgggcgcg ctggtagacg aggtggcgat
    37201 aatttcagat gtactgttcg ggcgacatgc gccagtattt attggccacg gctcaggcta
    37261 taaaacggta tcccctacac aaaagtttct gttactacaa tacgtaaaca agttgaatgg
    37321 catgcctaac tgtttcggtc tattgtcgga aatatgccat caataccagc caggtgtcga
    37381 aaaagaatcg ccacaatcca tgctggattc tgtactcgtg gacatggtca atagtatgta
    37441 caaaaccgcg gtgtttgtgg gtattgctgc tgaagtagtt ggggcatgga tgcccgcttc
    37501 gccggacgag ctagaaatgc aatccccgag cgcggtcgcc ttcggcgatt cgactgtatt
    37561 actcgatatt actgataata cagcggtatc agacgacacc cgcaaaatta aagttcacaa
    37621 attagccctt atattggatc agatatatag gggggcggac attgtagcta ctgcttggaa
    37681 agaatcatca tacatggata catccaacct gctatgcgcg gcaatagatg tgtcgctgtt
    37741 gaccgcattt gagaaatcag aaggctatag tgaatatatg agacatataa tatctcttat
    37801 cgacgttcgg ttgaaggatg ctggatgtga cacgatatgt ctgtaagaaa atgagatgtc
    37861 gaattgcgcg catgatgcgt aaaatggcga tttaaaggaa ataaatatct cagacaattt
    37921 tttttgattt tttttattta acttcaattt cggatatcat catctacatc aattacttta
    37981 ttataccctt ggtaattata tcgcatattg attataatca tcctgacagt aataactatt
    38041 accgtcaggg ctataataga tccggcgaca gcggtagcaa tgtaggttgc ggaaataata
    38101 gtaactcgtt ccgactcgaa tgctaaaatt ctcactattg tgccgttagg gtataatagt
    38161 aacgagttgc cgtatatttg ggcagttgtg ggattgaaac ggcgtataga tgaattgcca
    38221 aatgcgatca gctcgctctg tagtttgggg gacgaaatgt aaatagaata gcggatattt
    38281 ccatcggcgg aatatcgcag caaaacacag ccgcaatacg ggcacgtttt tcccgagggt
    38341 cttgacaata ctgttggaac aatgttacct atcgttgtag tgcacggcat cctggtatat
    38401 gttataaaaa gctgattgtt aacatcaaca ccgtctacgg tataaacaat gccttgcatt
    38461 cctgcccttc gagagactac atagctccca ataccggaaa cgggcagaat taaaatagca
    38521 tttatttcta atagatcctg gtcggagcag gacaatactt ctgatgcata ggcagacagc
    38581 gttctgatca acggcgacct aagcttggtg aggatgtatt ccgcctttgt ttcgagatca
    38641 tcttccttca tattaccctc atgggatttt tttttcaaat actgctgaat gtctggatag
    38701 aaaactacat ctgccattgc gtatatccga tggtgttcag aaaggtccaa tcgtagtgaa
    38761 gaaagacatg gtgtatatac gtctagaagg tgtattgggt cggcattact tctgattttg
    38821 acatacagtt cttgaatagc caactcagtt gcgataacat gctcttctgt acacatcgat
    38881 gatgctaata gtattgccct ccgtgcattt cttgaggcgc cccattcggt cagtggccgt
    38941 tgcaaaatac tcgcgaatgc ataatacaac gcatgctttg ttgtagtgtt ccatgacaga
    39001 atgtccctca tggcctcgat gtgaatattt tcaatgaacg acagtgccac tgtagatacc
    39061 tgttcgctta aagatccgtt ttgacggggt atatccaatg cataagcgga tctcaaaagg
    39121 aatagatgtt gtatcgcaga taagggacgt gtatgtccgg aaattggtcg aatgacttta
    39181 gacaacaacg atttaattaa atccgctttg ctatctttta tgggcgttcc cgatataaga
    39241 aagtgtgtac tagcgtcttt acgaaatgca gcagaagaaa tgccttctac aattaacctc
    39301 aaatcggctt cgatttcaat tatgtcatta agagaggtgt agccagactg aaatgcgtta
    39361 cgtatgaatg cgaacaacga tacaaataaa cgcgcaataa cgttcctgaa actatgcatt
    39421 tcatccacga gccggtcctc tgctgccagt atcagcatct gggcatgcgc tctgctaatt
    39481 aggaagtgat aatccataga atcgtccaga ctcttaatca tattcatgta tgagtcacgc
    39541 tcggagtccg aaacgtttct atacacacct aataggtaga tccaatgggg gcgtccagtc
    39601 cctttattta caggttcata ttgttgtcgg ggtggccaca acagtgataa atttcggtac
    39661 tttgcagata ttatcagttc aataggagga ttatatttcg tcgaaatggt catggatgcc
    39721 aaagtaattc ccatcttcat taaaatctcc atcccagcag atccgaatat aatggttcgt
    39781 acatgatcat aatctatcgg gacgagagaa tccatcggat cgacaaaaca agatcgtttt
    39841 gtgtaggctc ctaccaactc gcttgtgaga acgaacttgt atccggggtt gagaaagtct
    39901 gccggtttta aacttccgaa ccctgccgga gggttttctc cagtaggttg atcgacaaca
    39961 atttcatatt tcttcaacgg tgtattggtt ttcgacaaat agggtgaaag ttctgtcttg
    40021 aatgtatgat tggcgtatga accggtatta ataaatttaa ccaggttatt ggacgttagt
    40081 agcctggata ttggacgctt gaaaaaaacc atttgtcgta cctgaccgat cggcagataa
    40141 aagataacgt tcgctgtcgt cacagccgta tcgatataaa caaatgtcga atttttccgt
    40201 atccagagtg tctcgtcttt ataatcacgc gtcgatatat taaagcgtac gagcggcgag
    40261 ttcttcatgt caagcaatat ttgcgatgga tatgtgcctg gaagcgatat ttggtaagat
    40321 gaataaatat tcgctatgat catgaaacgg attatgcagt aaaacttcat ggtatacacg
    40381 ttttcacaaa aaatcagact gaggggccct taggtttata tgaaatatat tcttcgcggg
    40441 tttaacagtt tggcgatagt catatatagc aacagatcgt agcgtatgac tattctagca
    40501 tggaccaata ttaagttatg gcagtaacca ataccagcag attaagaaga attatcgaga
    40561 cgctccaacc tcgttacaca ttcccttatt ataggaaatt acatcatctt caagctcgca
    40621 taaatcattc cagctagcga gagtagacaa tctctccggc atagtatgca ttatagcgct
    40681 ggcgcattct cgacgtgaca taccgctaat gtcaaataat tcgacattaa tggtgtgtag
    40741 tttagtcagt aatccccaca atatccaaga atactgagtt aacagctccc cattttcgct
    40801 acacagctct ttccgtttaa aaatagccag gagagttcgg tccagcggca ttcgagttct
    40861 cgaacaaata acagggcggg gacgcgagat gaattcttca agtaatgact cttcaaacca
    40921 aggaagtccc aaccattcca tttcccagct ttctttctcg taagggcatg ttagatttgc
    40981 gtatttaacc gtgtccacca aagatgcgta tacggcattg agtgttctga gcatatttct
    41041 atctgccgtt tcacccggtc tatctcttga acaaatccta ttaacgtgtt ccttttcgtc
    41101 gggaaggatt gtggctgtca ggttgcatcc gggggattcc aacggaagtc ttattataga
    41161 gctaatcaac atttccaaag aatattctcc aagtaaatag cgagtgattg ggaaacataa
    41221 tatcgccgcc acagggtgcc tatccagcat taatataatt gctggagtat cgcacatttc
    41281 tatttttcct ctacatttag atgataaccg ttcgtgaaaa agcaaatatg gatcggcaaa
    41341 tctggcttgt atagatgcca tgatcatgtc agattggaat cgtgataaag ctccaccacg
    41401 cctacgttct ggcgtttcgt tggcagctac caccaaatcg gtagactggc atctccaata
    41461 tttcattggt tcgtacactt tcaatatagg agccccatcg ggcgtgtggt cgggcatagc
    41521 gtttagtata gacgttttgc ctataccaaa cggtccgtct agataaactc gcgttaacgt
    41581 gggcggtctt ctcggcaatg ccatcgacgc gcagatccaa atgcaagcca aggaaatatg
    41641 gtaatgctgg attagctggc aattgtcttc gaggcaagca cgcgggaaac caccttatgg
    41701 caggattgct aaaagcgggt gtccgtggtc ataatcgttt ttacaaaaag cttgctgctg
    41761 aaaactttga ccagtcgtcg gcggggaata cagttggtag aacattacag aagatattaa
    41821 gcaagatcct gccttctgaa ctacttaaag gggcgtcggc gtttcgattg gcctttgaag
    41881 tagacctggg gcgcagaagg ccagattgca tttgcatgtt caccttatct ggcgggttat
    41941 tggtggaagg ctgtaacaat gtctgtgtca taatcgaact gaaaacttgc agattttacc
    42001 gcaacctcaa gacggccagc aagaatgagc aacgcgcaac agggactaag cagttgctgg
    42061 agtctaaaac gttgatcgag cgcatggccc ccaagggatc tgatcatact atcatttgcc
    42121 ccgttttagt gtttgtcgcg agacgcgggc ttgtagttat acgttcgaca ccattaaaaa
    42181 agaaggctat atgtacagac tttcatcgat tggcatcaat gatgtatctc agatcagaat
    42241 ataggcttta tgattcgggt atgtgcaagc ccatgcgtaa aatttgccat cgtaataaac
    42301 gaacggtgag cactgtacgt agaatgcgat gtgggatttc tgatactggt gtgcttccaa
    42361 tcgaaaaaca gcatgtagat gcacgcggta aggactgtgg aacatctggc attcaaggag
    42421 aaccgataat gcagcgcatg cgtaacatca tatcgcactt atcgcgaagg cattaacgat
    42481 ttaaaaaggg gcagtctgca aagtttatcg cgggtgtaat gtagacaccg cctgttaggt
    42541 tgaccttcac atttaaatac gcgacgtgcg gctgctagga atatagtggc cccggcacat
    42601 taacacgtcc ttaaaatgtc tagagacatg gtcaatttca tttggggggc caggattatg
    42661 ggaaatgacc acttggaatc acacccggcc gatacaaaga attttattgc cccccgttgg
    42721 ccaatacagt tttggaaaga ccccgttttt accgatgagt gtggggcatt ggaaaaacaa
    42781 ctcgccctcg tgacggcacg caacaaggct gccgctgcag cattagacga tttagatggt
    42841 cgcaccaata ctattgcggt ggaggttgac cgcagactca gacctttgga ggataaattg
    42901 aaagagatgg cgtcgacttt ggccgatctc gaacaggctg catcggccgc cgaacttgcg
    42961 gacgctgcgg cagatgctga attacccgca tccgtgagct ccgagccgcg taaagatgat
    43021 agttgcgctg agaatcgtat tgttaagatc gcgaagaacg atccggcgct tagatacgtt
    43081 tctaacctgc cggtggattt gttgaacata atttatgcga gtagaggagc tgcgtcggca
    43141 ggtgttcttt tcggaacgtg gtaccgtgct ttgcagaata tggtaataac cgaaagaccg
    43201 catgttgccc gcaaaataga ctaccatggg ggaagaatgt cacgaacgtt catgactacc
    43261 gtggtaacaa ttttgcaatc gtgcgggcgc ctatatgtgg gtaagcggca atactcttct
    43321 tttgagtgcg ccgttctctg tttatacgcg ttttttgtga aaactggcca tgtcgattcg
    43381 catccgtcca attttactac tgcaatagag tccgttccca cttatttaga tcacttggca
    43441 tctaaaatag tagaggtaga ctacaaacca aaatatggat ttgatgcgaa acggttgccg
    43501 aaggattatt ttgaaccacc ctccggaaaa tacgaacgtg acgcgttgat agatcacagt
    43561 gttttaaaag tattggtaaa atatcgagtg ttgccccccg caatgggatc aattccacgt
    43621 gggtgcataa tcgaagatgt agataaaaat caaactgcgt acgatgacga tgtgaactct
    43681 gcagcggcag cattgttggg gagggcacag cccctttttc tgatggagga tcaaactttg
    43741 ttaagatcta ctctaaatac gatcgcatct atgttgttcc ttcgacgcct gctgtggaat
    43801 accaatatat attctgctaa gattaataac ctctttcagt tggggtcatt cgttcctgga
    43861 accgtgtcaa gtgtagcagt aggggcgtct gtcgctactc cggaaagcgc aataaggagt
    43921 gatgggagaa acttgttgtt tttatttcag aaatatgtcg cccctatata taacgcaatt
    43981 aaaggagtag aattgacgca gttgtttccg gggttggtag cgttatgcct ggacgttcca
    44041 ttttttgtta ccggcatgtc cgatcataaa caaccaccgg cacgcatcat cgatacgtct
    44101 ttgagtaaat atcagaccac tgtagcaaaa ctcgtctctt tagaactcga gaacagaaat
    44161 cgaggtaacg ttgcatccat taaagaggtg atagcggcgc atgactcagt aacccttcaa
    44221 tatgagcatg gtttggagct gctaatgcag atacagcaac ccagagcacg cctctttgag
    44281 agtaggaaat taatagcatt taacgtacaa acggattatg atcttcttta cttcgcgtgc
    44341 cttggataca tacccaaatt agtatcagcg ccataaatat cgtaaagact cgtccggcgg
    44401 agtattattt gccgggaaga atcggcgaaa tgaaaacgaa cgatcatccg gcggtgtatg
    44461 tggctggtta tttaacgctt tatggtgcaa aggacaacaa cgatttggtt atagatcgta
    44521 atgatatacg agcggcaatt cccacaccct ctccgttgcc aataaatatt gaccacaggc
    44581 aagattgtgt cgtcggtgcc gttcttgcgt tggcagatga cgaccacgga ttatttttcg
    44641 tgggaagaat aaattgtccg ttaatgaccc agacccttga agctgcggct agtcaagaga
    44701 tatttagtga gttggaaaac ataagcaaag acgaaaaact gctttattta gtaacgaatt
    44761 atctcccatc ggtgtcgttg tcgtctagac gcctcgagcc tggggaacgg gcagatgaaa
    44821 ccttcttctc tcatgtagct ttatgtttgt tgggtaaacg tataggaaca atcgttacat
    44881 atgattttga cgtggaccat gcaatacaac cattcacaaa attgtctgac gtatgcaaat
    44941 catccttaat atctgaagcc atcgagacag aaaaaaaaat tggacccacg gtatggaacc
    45001 cgagtaaaag tgcaataaca aaggcactgt tggccactgc catcaacaac atgttattga
    45061 gagataagtg gcgcattatt tctgagcgga gacggctagc cggaattgtt ggccagaaat
    45121 atctgcaggc atcagcttta acagcattgg atggttttat gacgtcggac aatggctcta
    45181 agtccatccc atcctgcgaa agcgtaaatc cggaaaccgt acaaagggag gggatacaag
    45241 agtgcgatac tccaatgtta agcggcaacg agacaataga gaacacactt ggtggcaagt
    45301 acatagggcg gccgcccata tgctcgtcga cttctgaact ccgcgatcgc ttttgcgaaa
    45361 taccttctga gaacctgcct ataatgagta gccaatctcc acgtccacca ggagacgact
    45421 ttatttgggt acctatcaag agttataacc agcttgtgtc caggtatgcc cagcattcag
    45481 ccaacaatcc agacccggtc acgaatacta atcaacagtt atacattcca ccaacgatgc
    45541 cttctacagg acaatccccc ttctatagcg gatatggtca atatgggcat ccgctaccat
    45601 catacagttc tccattttca tccgggtgtg tgcaatactc gggaatacag ccacaccccg
    45661 tccattctgg acagacatcg ttggaggcaa agttgtcggc gctactagac tgcatgaata
    45721 aggacaaaag gcagatggat gaagggtaca gatacgacgg tgtatactcc ggtcaagaac
    45781 ggcgcgcgcg caagcgacca tatgcatttg acaaatatga tgaatctgac ctatgttatc
    45841 caggagagct tagtaggcac gaaccccatt atgaaggcga agggaagaat gttggcccat
    45901 cggagaatag gcgagattcc atccaaacga aaactgtcct ctctggtctt atgggcgctg
    45961 taacttcttt gcaaagagaa gtggaacgat tgaatgggga gcgccagtat actcagccat
    46021 atgctgccgt ttcgaatgtt ggatcgggat tacccgcgcg ctattactgt cctacgatac
    46081 aacaactacc gcacccggtt acctccgata ccggctatcg tgcaggcggt gacgacggga
    46141 cgtccacctc aggcaaagct gtatcaactg taagacacga cacaggtact gatacgccag
    46201 tgtcgggccc agcgcccgcc attaaagagc aaatcacaga ccctaatatg ggatgtggag
    46261 ttccacaaga tactgtcgac gcaagcgcga tagctggctt gggcggcagc gagattcagg
    46321 cagcgatgtt tttattagcc acatgatgat tagccacatg atgacccatc gctgaaaagc
    46381 gggtgtgtta atgtcagaga gctgtaccag cagtttattg tggacataaa cgctaataaa
    46441 tcgttgagac gcaaaatgtt tttattagtc ttcttgaata caacatctct atacaatttc
    46501 atcatccgtc tcagaatccg tgtcgtttag tttatcatat ttgcgatgtc cattcattag
    46561 tctcatgttt gaaagatggt cggacaggat agcggttgtt cctctctttt tcttacgcaa
    46621 tttcttttga tggcgctctt ctgcagatac tagcgccata tactttatca tttctctagc
    46681 agcttccagc ttcctctcgt ctattgacat caattcactg tcagatccat cggtatgcgg
    46741 cttccgtgtt gcctgatctt taagttcctc tgtggtcatg ggatataagg ctttcatcgg
    46801 gttgcttttg agcttgttta cataacgata agccaaaaat gccgcaatga tgcccgcgat
    46861 gacaatcaag cctatggcta gagcgccaaa cgggttggac ataaatgcgg aaatccccga
    46921 tacagtggat acaatggccc ctgcagcccc gactactact ttccctatag cctgccccac
    46981 ttggcccatg ccgttaaaca attctgccag tccgttcata aaggcataat tagtgtctac
    47041 ctccatcact ctattaatat cgtaaaattt taattcatgt agttgattgc gcctagcaac
    47101 ttcagcataa tctaataccc ccacgtcacg caattcttcc tttgtatata cggaaagagg
    47161 aagaatctcc cgatcttcca aaagcgttag atttaattct acgaacgtac tcgccagttg
    47221 gatatctgcc gcatctacca tcttaacaaa gttataattt tcgtagaacg cgtagccatc
    47281 tccaaataag aagtatctac gatgattggc cgaacatggc tctatggcct ctagagttgg
    47341 aatcaattca ttgttttccc ccaactgtcc ttgtattttg tcttgtcggt ccccgtagga
    47401 gaataacact aaagggcggc tataacaagt attggtagag gtgacaacac gcatggaatt
    47461 ttgtaaggta acagaatctg aatcgatctc aatacatgat gatacggcgg ctacgtcacc
    47521 caacattttg gccccaacgc gttttcctaa tgttgcactc gcagttacac tggggtttat
    47581 tttgatagct tcgcgccaca acactaattc cttattttgc aattcacacc aggctgttgc
    47641 gattctactg aacatctcgt taatgtgtgc ttgtatgtgg tcatatagga attggagcat
    47701 ggcgaattga actgaagcgg tcgatcttat aattacggag tcattcaaga tggccttgcc
    47761 ggacgaggcg cgatgtagat ccctgcgcaa tcgtgacact gatgtagcgt tattactaat
    47821 aatggcatgc ttattattaa cgagatctaa catttcatct gttcggttgt cccgcaacaa
    47881 ctctcttagg tacatgtgag ccagtgattt tgacagaatg ggctggtatg ccacgacgaa
    47941 ccctcctagc gttaaaaaat attgaacgtg gcccatcttg acatgtgtat cattatattt
    48001 ccttttaaat attttatcta tttcagcctc ggcatcacgt ttaacgcatt gtcctagtat
    48061 gatacggtct gggttgaatt ctgttgtatt gctaatgaaa gttgccgaca actcgcgggc
    48121 cataaaacgg aatttcttgc ccactctagc acgcagcatt tccgttacct ctttccactt
    48181 tgccatagag catacgcgag agattttggg ggcccatgtc cacccaacag taaaatgttg
    48241 agttacgaga aaattgcgct tgacgggcgt gacgagtttt cggcgcgtat ccaaatccat
    48301 ggggaaatag ctgtcaaatt gcctgaatcg gtcttgcgga tagctcatgg gctccgcggc
    48361 cgcgtcggtt ggagttgttc cataaaatgg agacatgttt gcgatatctc cattggccat
    48421 tgcaaagtac gtgtatggaa atgctgatct ggcatccatc tcttctacta tgcagttgac
    48481 ggacgtgccc gttctatata cccatggaga tccccacacg gtgtacgtct cgttggtcgt
    48541 atgccatgcc cgcgattcgg ctgtgctaaa tttcgatgga cgtagcaata cctgcttttc
    48601 attctcgtcc ctgtcgtatg catcgacgta tacattgttc cgaagatacc gggctttgga
    48661 tgaacatttc cccttaccat ctatcaaatc agtaatttcg tcgatagaca cgggtgttct
    48721 atctgtatac ctgttagtta tctgtctgta cgtcgtccca gtccacgtcg tagtttgtat
    48781 aacgttctta tagtaaagtg ttactttgaa tttatacgga ctgatattct ctttaaacaa
    48841 tatggcaatt ccttctcccc actcagtgga ttttaacggt tccggacact tcctaggtgg
    48901 ttctaaccga actatggtag agcctaccgg tggggggcag acgtaaaatg tagtctcgtc
    48961 ttcggatagc tgtatgcctg aaacaatttc tcgcgctgtc acatttggta atttaatttc
    49021 tgaggtcgcg atggataaga ttggggtgag aaaaataaat aaagaccgat taaagtactt
    49081 cattgtagga gtcataggca tgagttccac cgaccgtatg aatcaaaata ctaaagtcct
    49141 aacgatattg acctaggtca attgtgggtg tggctattac taaaccgatc cgatcgtaac
    49201 tgatccgccg tagcgggagc cataaactgc aaaatagaat aaagcaagga aaaaacatcc
    49261 gtgtcaacga gaacggtcgg ggattgattg tgggttagat aagccctaca cccgataagt
    49321 gctacgagag gacaatcggt ctcgtatgtc agatatactc catcctccca aatgtactcc
    49381 ccccccaatg ttagctgtaa gccatcggca cgacacacct gcaaatcgcc acatttgaac
    49441 acggatgcaa aaagggcagt cgccaaaatc aactctcgta tatatttcca tgccattcta
    49501 tgtgcggtgg ttatattatc cactccacca aaatcgtaaa accccctaaa tttacttatt
    49561 atccaacttg atgtgttgtt gcactgtaac ataaatcgtg ccatttcttc cttcaagtga
    49621 ggcaggaggc ctacattttc cacactgaaa tataaagccg tattcgaggg ttgggcaaaa
    49681 cgatggacat catgattgaa caatggacca ttcactagct ggaaaaattt gtgcgttagg
    49741 ctggggagca ttgccgggtc tattttatgt tttaacaatg ctgtctgcat gaaccgatac
    49801 gcatcgaaag cttcgtctcc tctgcggtta tctataacat tcgcaaaccg agtttgaact
    49861 gcttccaaca gcccacgccg tgaccgaaaa ccgttaaata tggcaacata tgaatctatt
    49921 agaacttctc catacacgtt aacgcgcaga attttttcaa gctcttttct ctgctctgta
    49981 atacacttgt ctaaactcgc tagagatctc ttcgtcaagc gctcggcata cattttgcgt
    50041 ctgcgcgcgg catcagccga cgccgcgcgc actagttcca accactcaac atcaccacgg
    50101 gcatcagaaa gtgagcgatg cgcgtctcta ggtgttactt gcgttgtgtc accagtagac
    50161 tctgacgtct tgggtgcact gtcctgccta acagagcgcg aggtgagggt ttccagtgta
    50221 ctcttgagtg cgtcgtgcgc cgcttcatcg ggatataata gacgtttgag caaaggtgct
    50281 gacaggtgat ggtcataaca tgctttaatt agcgcctcta taatgtcgtc gggcgcggct
    50341 gtcctccccc ccaaaagtag cctatcggcc gtgttcattt gttctatttc atccgaaaat
    50401 atacgctcga agtgattcat ccgcttatca aatagggccg tttctattac tgacgacctt
    50461 aagtcaaaca accgttcctt agccaccacc tgttccaaat tgtctgcaaa cgagtcgatt
    50521 gtatttcctt ggggatggct agctttccgt cccgacgacg ccgtccaaaa ttgcaattca
    50581 cttattgcat agaggtcgcc cgatgcggga agaaatacat tatgggcatc caatgcaacc
    50641 attgctgctt gggacacgga atctggacta acattagtgg acacagtatc atttatattt
    50701 ggattattaa tatggtttaa tgcagtagtc gccactgcta acttgtcagg gagtatgtac
    50761 gtagcatggg gcaaatgtgc caccatatcg tccggatcga cgcgcagtat catttgtttg
    50821 gtgacatggt cgcacatttt cccgacgatg cgcttatgtg ccgagtctcc actgttcgcc
    50881 gtcacacaaa gttcttcaaa acatactgaa cagggttggg acggatcgta taactccggt
    50941 ggtacaatcg acccagatcc cagagtcttg agcaaatact tatctatgct tgccataaac
    51001 cgcccgaccg atcgagaatt tataatgagg tgacagtaat taagttgctt cagtacgttt
    51061 tctacatcgt gtagaaactt tatctcagtg gtaacgggcc caccgtaggt atccagttcg
    51121 gccactacat gatatggaca cactccttgt agagacatcg attttacaaa aaagtttcgt
    51181 gtattccctt caacgacgta atcgcacaac gccgatagca acacttcccc ttctagcctg
    51241 gcccgccgaa tagccgacca tacgccatat gttatgggag taatcgaaat gtcctcctgt
    51301 tccttccagc ccgggagtag ttttttttcc aaatatcgta tcattagaac gttcagcttc
    51361 aaacgattta tcattcgcat gcctacgaca ggatcgcatc gcttcaaaat ttcaatctga
    51421 aataggtacg attgtatttg accccatacc gcaagtaatt tctgacgcgc gatcgagcct
    51481 tcatattcaa gttcactggg ttggtgcgga ccgtgttcca tatttcattg atcgagagta
    51541 ctaccaagaa atgacaaacc tcccacaacg gtatgtctta tatatgtgaa ccacgcaaca
    51601 aggaaatgga tattgtaatt tttttattga gatgtacatt tcacatcgca tacagatcag
    51661 atgcacaatt cagctacaac atatctacag atagcactgc tgcccgtttc tctggaacag
    51721 ggtccagatc aaacacgctc aaatttggtc tttttgtacc accttctgac agagaatgtc
    51781 catcggaacg cttttcaacc ccatcgtccc actcttcata gttgaacgtt ggtccgttgc
    51841 taggtatgaa tgcagaagcc gcggccgtct cttttgccag gcccatggca acatcgatac
    51901 tccatccacc ttccgattgc tcggcctgtt cattaaggtc ggcgatgagc gatgagatgt
    51961 aatcatcgcc tgttatttct atccaatcct ccagttccat ttgacgtact cgctcgccca
    52021 ccattttcag ggccagcata tatacttctg catgaggggc gccaccttct tctgacagta
    52081 tggcccgggc cctatccatt aatgtagcct ctttcaaacc tgacgagaac cctgtatgtt
    52141 ctgctacaaa accaactctc ggacatgcca ttacatagcg atgtgtccta tcgaaagaca
    52201 ttaaagagca cacatttcta ccacccatga tatttcccca atttccagac tggaatacct
    52261 ttgtgctgcc cgccataccg tgatatttac taatgctcac accaatcact atcagtggtt
    52321 ttgtgctcat aaccgaaccc actaaattag tagcggaaaa cgtagcacac caagcatcct
    52381 tgcgatcggc aattgtccca attaactgtt gggctgcgag tgatacatcg cgcccctgag
    52441 tgattgtttt atctatccag ggcaatacta tggcaggatc tcttggtttt ttagaagcgg
    52501 ctaccagggc cgatattgtg ttaataaaga aatgtttatg agaacagtac ttcagaattg
    52561 tattggcgag gaaaaattgt gccaaatctc caaaccccgt tgggctgata tttatgtaat
    52621 tcatgtctgc atatacgttt gtgaattttt taatgaataa cgccttttcc tggtcttctt
    52681 tagataacat ggtatcgggt agttgattcc gttgcaacag agtccaaaac caatgtgcat
    52741 tcggaaccgc accgttaggc attttgacgt taggaaaaag tgcggaatgg taccgtttaa
    52801 tcgcaaatcc cagcggtcca ttaagaacgt tcatagtttt agtcggacgt tgataggctt
    52861 ctatcatatt cgcgagcctg gactttgcgg cgtccgaagc agtaccgatg actccaccgc
    52921 caaatattac tctatttttc actttaagct cccggattat ctctattgta accctggtaa
    52981 gatcgccctc catattaata acagtaggat cgtattgaga tctacttgga tcgggaacgg
    53041 ccacatgttg atcctctaac gtcgctgtaa tatctttgga tgttataaat cctgcatttt
    53101 ggagttccaa aactctccgt ctcaaaactg actggaactg cgttctaaaa ttccgagcct
    53161 ctacctgctg cccgtgcatg agcatggaac attggctcaa tgccatgtct tgtataacgg
    53221 caatggttgt gcgtctggcc agaaacgaaa gcacgggaca aaatcccgaa gaatatggct
    53281 cgattgtcag ggaaagcgtg tgattagcgt cgcataatcc ttctcgtata ttggattcgc
    53341 gtatttctgt taaattgcgc ataagttggg aagcttcacc ctctattatg tttctcattg
    53401 ttgatacagc gtgtatgaac gatgccccgt ctttaatgct ggcgtctgca ggggccatat
    53461 tcataggatc atcgcatgcc agaagccctt ctttttccaa cgccttcatt accctctcaa
    53521 cggttagcct atacgtatcc tgcatcacac tacggctcgc ttcaccttcg gaccgcttca
    53581 aggtcgaaaa ttgtgcatag ctaccgaggg cgtttacatc acagtaattg ttggtcattg
    53641 caccgaaaag gcccatggca ccacgcattt gatacccgaa tttaggcagg cgatattcaa
    53701 gccgtttcac agtcgtgtga gcgcaataca ctcgtgatgt cttgtcacac aattcacacg
    53761 gcatgtccgc gtcgattgca gatgatacta atttgactgt atccaagtcg tgatggcatg
    53821 cgtttgcacc accatcgcat ctttccagat aaaacaaaaa ccttgccagc aattgtgggc
    53881 aaaatccaca agctagtatc aaatagtcca atgaatactc ggacgatgtg gagggggcga
    53941 gtttggggag ggcatcaccc gaaatcggtt ttccatctcg atcgaccaat gggtttgctg
    54001 ccaaatgcgg agcagcaatt tgaaaaaatc tataaaatga tggtgcgggc actcctgatt
    54061 ccttgccatc agaactgcta gcttcaccca cttcggtcat gtatataaca gaattggaac
    54121 tgaataccat tgctcctacc agtccggcca cccggcccat atatgccgac aaagcttcaa
    54181 ctctatctgt atatccaact gggttgcaga atatgggcca cttttttaca tcggggattg
    54241 gttcttcata tacagacgag gcgatcacat tttctatcgc cagtgttgcg tcggacgcca
    54301 tcaatgaagc cgttctgcgt tcatatcccc ccccttgcgt ttcagcacca tccctctttc
    54361 ctgctttggg ttggcctttc cccccagtgt ccgccgtcgg agtaaaagcg gtaaatgtgg
    54421 tgtctgccgg tagcaatatt ccctcgtggt tttcatcaaa acacaaatgt gcggccccgc
    54481 gggcgacggc gtcgatattg cgtacgcgta gaccaaccgc gtcagtacct aacacgtagc
    54541 cgtacaacag gcgacatagt gcgtcgttaa aaaatgcctc gggcatgact gcaccatctc
    54601 ccaatgctct tggtctttcg ctaaacggct cgttgctgac gcggttaaaa tccggtagga
    54661 ctaaatgcaa aggatacagg ggtattctac gaacttccgc atcattaatc gtcacggaat
    54721 cgctcccacc ataatacaag aaagaattgc acaagtatat tgcttccttg aataattcgg
    54781 tgactactag gtacaacatt gttttttggg cgtccaagcc gagctgttcg catatttgct
    54841 tgccgcttgt ttctaccgat cctggggccg aataggggca gtatccaaat ctttcacgtg
    54901 catattcaca cgcctttgtt aaattggggg cttttgagca aggctttatg caatctccgc
    54961 cgtaaaatac aaagacatta ggatggtaat gtgtcgggac gagcttgagt gttatcccac
    55021 catttaccaa gcctgtagtt ttggttcctg caacagccgc cacgttccgc acgaattccg
    55081 actccaccgt aagaccggca atcagcggta gtatactttc ttccgaatcg atgcattttg
    55141 ccgcaaaagt cgacaattca tcgacgggta cggcgtcctt actcatggaa tatacataac
    55201 caatcggtcc tccgacaagt ttcacgcttt tcccgacacc atccatttgt gatcgtaaga
    55261 cagccttcca gttgaatagt gggtggaaaa gactcttcga gaagtatcac accccactac
    55321 agctatagca atagcaatca aacgcacttc acatttctcc cgcggtctgt tttaaacatg
    55381 cgattctcca gggggcgtgt cgcaacattt cctttggtga cactagctta cgtggagggg
    55441 atctgaaagt ataataacca cattgtagtt gtggcggtac aaacgcatct gcactgaagt
    55501 atatgatttc ttttcgcaat cgcgtggcat gtctatcgta ggaacgacat ttttcaaccc
    55561 ctgcctcgaa agaaggaaga ggaaacatga cgaacaaaac gctttgcggt acagaattgg
    55621 ccagggcaga ggtgcgaagc ataatctcaa aacatatatt actgatctgg gggaatttaa
    55681 gtatatttct ccaaaatgtt tggacgttgg aaacagtcaa caaaaaggga cgcatgtcgg
    55741 cagattgaaa cggtcaccca tattatacaa aaatggggac gtgtatgaat ttctcgactt
    55801 cgacgcatgt acaggcatat ggcctcggag atgctctgtt tggaacggca gatcgttttt
    55861 accttcagat tttgaccctc gtttttctag atttcacgtg tatgacatgt tggagacggt
    55921 ggattttgcg gacggggcaa tagaccgcga caagaataga ttttgtgatc ttttgcgccc
    55981 catgggcaca attgtgacca tgctggggat cacagaatgt ggtaaacgag tggcggtaca
    56041 tgtgtacggc ataaagccgt atttctacat gcgtaaggtt gaagtggacg ctgcatgtgg
    56101 atgcaaatgt ccccgcgatc tcgccgagaa tctggcgacc accatacgct cgtcgctgat
    56161 ggaaacaaca gatggtaagc gaccctgctt attcgcagcg cgatcggtat cggcggactg
    56221 tttcgagata gatatcgtcc gacgccggga tgtttattat tatggaactg agttggaaga
    56281 atattaccgc gtgaaatgtc agagtggcaa atacatgtcg tttatatgtg acaactttca
    56341 tccatctatc accaagtacg aaggcaatgt agatagtatt actcgaatgg ttctcgataa
    56401 cgccggattt ggtacgtttg gatggtattc tctaaaagtg ggcgattgtg gcgagaaagt
    56461 tcaagtccgc tcaccactcc accatgttac ttcatgtgat attgaaatta attgtaccgt
    56521 ggacaatttg ataggccacc ccgaagatgg catatggcca gattataagc tcctgtgctt
    56581 cgatatcgag tgcaagtcgg gaggcagtaa cgaatatgcg ttcccgactg caacgaatga
    56641 agaagacgtc gtcatacaga tttcttgtct tctctattca atcggtcaca aacgactaga
    56701 acatgccatt ttgttctctc taggatcttg cgatctgccc caatcttgtg aagacgtgtt
    56761 tagagataca tataacacga cacccactgt gctggaattt gatagcgaat ttgaactcct
    56821 attagcattc atgacattta tcaaacaata cgccccagaa ttcgtaaccg ggtacaatat
    56881 cataaatttc gattgggcat tcattgtaaa taagctaacg gtagtatatg atatgaaatt
    56941 ggatggatat ggcatcgtta atcaaaaagg gatgttcagg gtttgggatg caggtgccaa
    57001 tcagtttcaa aagaaaggca agtttaaagc aaccggtata atcgcgttgg acatgtattc
    57061 tatagctacc gaaaaaatga aattgcaaag ttacaagttg gatgtagtag cggaggctgc
    57121 gttgggggaa agaaaaaaag atctatcgta caaagaaata ccaagatact ttgcatccgg
    57181 tgcgaataca agggggataa taggagagta ctgcctccaa gattcattat tggtaggcaa
    57241 gctttttttt aagtacgtcc ctcatttaga actgtcggcg atagctaaat tggctggtat
    57301 tttgcttaca aaggccatat tcgatggtca acaaattagg gtatacacgt gcttgctacg
    57361 cttagcgggc ctccacgggt tcatcctccc ccaaaaaaag aatgggctgg tcaacgatgc
    57421 gggcgacaat gtcgcaaatg ggataagtga agacattacc agatccgcag cacgttcggg
    57481 aaaatcgata caaactggcc ggaacgtagg gtatcaaggg gcaaaggttc tggatcctaa
    57541 agctgggttt cacattgatc cagtagttgt gtttgacttt gctagtctgt accccagtat
    57601 tatacaggca cataacctgt gttttactac tctactaccc gctggaacaa taatcaatga
    57661 cctgcgacgt ggcgatgact atatagagat agacgtgcag ggatctattc tgcgttttgt
    57721 aaaaccacac attcgtgaaa gcttgctggg aattctctta aaagactggc tggcgatgag
    57781 aaaggcaatc cgtgcaaaaa ttccacatag tccggatgat ttggccgtac ttcttgataa
    57841 gcagcaggcc gctataaaag tcgtctgcaa ttcggtttat ggtttctgtg gggtagcaaa
    57901 cggcatgcta ccttgcatag atgttgcagc cagcgtaact accattggtc gcaacatgct
    57961 gttgactgtc cgtgattata tccacgatca atggggcgat aagagttcaa ttatgtgcaa
    58021 gtttcccgag ttggaaaact tcatgcagaa caaagagtat tccgtagatg taatttacgg
    58081 cgacaccgac tcggtgttca ttaaattcac gggcgttcat atagatgggc tagtaaagat
    58141 aggggatgat atggcccaaa aggtatcctc cgtcctgttc cccaaaccca taaaactgga
    58201 atgtgagaaa acgttcgata gattgttact cataacaaag aaaaagtata tggggacaat
    58261 ttatggagga aaaatgttga tgaaaggcgt ggagattgtg cgtaagaaca attgtcgatt
    58321 tatcaacacg tatgcaagac gattaactga tctgttattt cgtaatgatg cagtagcaga
    58381 cgctgcggcg acgatcgcct ctaaaccgcc tactttttgg acttcctcgc ctctcccaga
    58441 cggtctgaaa ccgttcgggg atgtattagc agaagcgtac ggtcaaatgc tgtcaaaaaa
    58501 cctgattgat gttggagact tttccatgtc cgccgagctg agccgccctc cagatgctta
    58561 tgcgaataag agaattcccc atctaacggt gtactacaaa ttgctaatga gatcggagca
    58621 ggtcccctca gtaaaggaca gaatagctta tgtaatagca gccgcaacgc caactgtgag
    58681 acgtgatgcg gaacgggtgg ctgaatatag aaatgatccc cttgcaacta gtactaatac
    58741 cgacgccagt tttttagaaa gtttagattg tgtcgacacg tcaaatcgat gtgagcgggc
    58801 tatgaggaat aagttgctga tttctgatat ggcggaagat ccttcgtacc ttacgacaca
    58861 taaaattccc ctaaataccg attattacct atcgcatctg ttgggcaccc tctgcgttat
    58921 tttcaaggcc ttgtttggca atgatttaaa aacaacagaa actgtgctca aacgttttat
    58981 tccagaaact tatacggacg acatggattg cgcggagcgc ttaccaagcg caatatttac
    59041 cacgataaaa agcggagctg gagtacccgt caacgaggag gaagaaaatc atcgaaagtt
    59101 gcgtaaagct ttccgtattc taacaaaagc tccccatcaa tgttaagatc gcataacttg
    59161 caatatatat catctgcgtt aatagccggg acatcattca aatctgcgtg ccgagtgtaa
    59221 tcttttctaa taatcaacac aaagtttgta cgccatacat gagcgataat gtagtagtta
    59281 ttgcacgctg tcttaagaca atctatcagc ctgtgatgaa gatggagaga tttaccaggg
    59341 aacacaacat acatcatata ttcattgtcc cccgcttcgt gatctttata gaataaaact
    59401 ttaacatttt tcacaccgga atcgagtaaa acataatatg caaaaaatag ttcgggtatt
    59461 gatataatgc gagttaaagc tgtttccgcg cctctacatt tctcctcccc attccccatc
    59521 ttttcacgta cggcaattat cgaagcaaaa aaaactctat atttataaat gtcatttatc
    59581 tgctgcacat atgctaatat tagcgcggct ctgtcatttc gacccagccg tggttctcca
    59641 ttcgagatac atgtaggaca acatccaccc acacctatgt agtaccccat ccccgacaaa
    59701 gataagcagt tatccgctac tgcttctgcc agattaaatg gtagagatat ggatgtagtc
    59761 ttaataagtg gtataatcag atccttgacc accatcaatt cttcagaggg agactctgca
    59821 ataaattcga agtaggctct gtaggtattg acgtatgttt ttctagcatc gatcttcgag
    59881 ctgttgacac tggtccgcga atcacgtccc tggcgcctag tccatcgcgc tgaccttact
    59941 gatcgtctcg cagatttgcg tctcggtaat gccgagtatc cggtcattag gcaaaccgat
    60001 aatctcgcct ctacacgtag tcacccaaag aatgggcgag agaaatcagc gagattgaat
    60061 gcctctgcaa cagtgcgccg gcgtctttca caaacgcaga taatgcggtc ggacggggcg
    60121 ggaatacttg atatgttttg aacgcgtatg cgagagccca aaaaccggca cagacgcgtc
    60181 cctcgaagtg attctgactg gccaggcgag ctttatataa cggcaggtca tcatcgacag
    60241 tggttgggtg ggtaaacaag gtcctgggat tggtttgggc tatccgcgca gcgcacatcg
    60301 ggtcgcagaa caggtgttta taaatagctt ccgccccggt ggccttcatt aaattcaaga
    60361 agcagccatc atctcctaaa tctacattct cttctacaga cccccatgca tccagaacgg
    60421 gttctatact gtggaacaga ccaatgttat tagacgaata cacaatcacc tgacgcttaa
    60481 actttcgcat ggcctgccag tatgtacgaa tgatcagtaa gttacagagc agacattcgg
    60541 cagaagttcc ccctttactc atcgcatgct ttagttgtgt ggccatcaat ggccccaatt
    60601 ctaaatcggg ttcagaatct tcggtataac atgcactata tgatggcgtc acgtttgggg
    60661 ccaattcatg tctacatgtt ttccaaaatt tatccacagt ctcctttctg actttggatg
    60721 ccatgcgagc aagctcgctc gtgtcggtag ggagcgatcc cgttccagag agcaataaca
    60781 gtatcaagtt gttgtatccc acggtgaaat ccttctttac caatccccct acatctgcag
    60841 tatggacagc cgcgggcaac ggttctgtgt catacgtctt actcgcatcg tctgaatgga
    60901 gatccaactc gcgttcgtat gcatcgtcat cggaggcggc acgcgaagta caactttcgt
    60961 tttgaaagga attacactca acattcctag cacagtcttt ccatcccgcc aatgcaacgg
    61021 agagcgcggt tgggcaagag tttgtctgtc cgatgtgagg atttgtggat gtactctttc
    61081 tttgattttc ttttgccacc gccgacggcg ctccgttagg caaaaattta tttggggtat
    61141 cagatgtatt gattgagggg tcgtttagat cagataaagt catcagcatt gcccgtgtgg
    61201 cactctgggc caaatatgaa taattactgt acaacacttt ggcatcccca aatgtaggcc
    61261 ctttaatatt tcctctagaa gaacgtcctt gtcttccacg ggacgaaatt atctcatcgt
    61321 ggcgtctgcc aggcacgcct ccatctgttc ggaaacagcc atgtaaaaaa aaatgtcttt
    61381 gtatatcctc gagcgttaac aattttttgg caaacgaacc taccaacgta aaaccatact
    61441 cgaccaaaaa atgcttatcc attatgtaca cgaactcaaa tgctgctatg aacgttgcgg
    61501 tagaacaagg tggcgctcct aggcatttgg aacataaaaa tgcatagtct gccatccaca
    61561 tcgcagataa tcccaaacgt cgtctgtaag tatctaacac ccgacagact aaacatggcc
    61621 tatccagggc aaaggtgtcc gcacacgttt ctacaaacgt taccagttct gattggataa
    61681 tactgtcttc gtgctcttct agattttctg acacatcatt tagagtatcc cgaacttttg
    61741 tcttaatcgc atgggcggaa aaaagcaact cgctgaaaag catgtcattg caaattaata
    61801 ggtccgggtt gaaggcgaca taaggatctt tgaacgcatc ggcggcccat ccatcattct
    61861 ctgcagatgc gcgagcaaac ggggcgagat cgaactcgca gtttgacatg tctaacgatg
    61921 ggaattatac tcgtcgtcag agcgtgggtc ttttgaaaga tgtaattcca gaagtcgaat
    61981 taacgtcctc tcaaattgat aggttggagg aacgctactt gcgggacgat gccgaatatc
    62041 gcatatggtt tgaatattta atacccgatg aaattgatat aatttttccg acgaccgata
    62101 gtaaattgaa ttatttatct ttcacacgaa ggctggcttc tggcatccgg tacaacactg
    62161 cccgaaatac attacgggac gacggcgcaa aaaatacttt tggtcaaaca atgcaggtat
    62221 gtgagcatgg agcggcgctc aatgggcgga gcgaacgatt tgcatcagtc attaataggt
    62281 tccttgatct tcaccaaatt ttgaaggact gttgaaacgt acagggtggc tgtggcacca
    62341 ccgtacacat attttcgttg ggggatacct aattactagc agatcttagt aatagcgcaa
    62401 tttgacggtg tgtgcgatag aaatggacaa cccccctacc gtgaataatc ggcgtggagg
    62461 actaatagct cgcatcaaac tagtggtcgg cggtcacctg tctacgggaa attacgatca
    62521 tgttatagcc gaaccattct ctggttatgt accttccagg tgtgtttttc agttcagcgg
    62581 agcagatggt gtggaaagtg catttcccgt agaatacatc atgagaatga tgagtgactg
    62641 ggctgaaaac gaatgtgatc cttatattaa gatacagaac actggcgtgt cggtgttgat
    62701 agagggattt ttcaaccccc cgataaacgc cgcgaaggca cctttggtgg acaaaatcaa
    62761 tatattacta aatactacgg attctacggg catagctcta tctgatataa acaggataaa
    62821 acaatttacg ggggtcgatt gcagaccttt ccaagcttgt ttaaacgtga attgcttcgt
    62881 gcgtttgcct agtgtacagc tggcttttag attcgttggt cctagcgacc cgagtaggac
    62941 atctcgactc ctagactcgg cggtaggggc atttgataat aaacggaggc tacgtcgaaa
    63001 tggactgcct tgtgcagaga atagacctga gtataacact tcccagggat gtgttccgat
    63061 tccactaata gatgatatac agaaatcaaa catggcaact agtaatgcgg cgaggcgcat
    63121 attgaatatg tttaaggcat tttcaagtac ggaatacgta accactgtac gtatatcccg
    63181 ttgtatgatt atacttctgt tagtgggtgt catattaacc gccactgtat gggccattta
    63241 tgtttatcga gtctaaaagt cgtggaagcg cctggccatc gccagtctcg acctgccact
    63301 gctgagttcg gcttcaattc cagcatccca gaaatgtcgc agtcaccatc acgccgtgca
    63361 tcgcttccta cgaggccttt tgacgcttct gatttgggca catacaccct ggacatactc
    63421 caccgctatt cgctcgtaga tttagtacaa ctactgaatg acttgccgcg taacattacc
    63481 tccacgcccg cttctaatgt agaaaccatg gcaaaaatta atgttttaag ggccatttgc
    63541 gtaggatttg ccgaggtccg tcgccacaac gacgcgcgaa ctttacagcg aacggcaatg
    63601 tttgccgccg acgacgtcgc atcacggatc agaccatcca ttggattaaa gcgcacctac
    63661 ccaccgggta tattttccac agccattacc gtatctaatt ccgaggatga agagagaaat
    63721 tcgtattgta aaaataaaaa atacaagata gtacataaat tcttattatc tttaatccat
    63781 gaggagcatt tttattttaa aaatgtcagc cgccagccct ataaccctag atcgcaactg
    63841 atccctagtc tgcgttattt gtcttgcaat cttttcgcac gcctttgtga gtgcatacaa
    63901 tgcccccctg ctcgcttttc tgaaatcgcg tcgggtcatt aatgtgtcgg ctatcacaat
    63961 gcgagatgta ctcgacatgt ccgtgtctgt actattggga ttgtaaatag tcgaccgcga
    64021 atcatcagag tcggaatctg taaaggatac agattccgac tctgagcgct tatgaatggg
    64081 atccactcgg acgttgttga acttccgttc ggattctgct tcagtcaaca ccggcccccg
    64141 atagctacta aggttggggg gtttgtgggt tgtttgtgaa actgctttgc ggtgtgcatt
    64201 accacggggg gtgtggggaa gtatctgttt ccacgatgcg ataacgttcg gtggcggagg
    64261 gggcgattca ttctctagtg tacgcgtttc aacttcagga acgtgattat ttctttcagg
    64321 acactctttc caatttcctt cttccttcac ttcgggtaca ggtatattct taatgtttac
    64381 atacatgtcg tctgctcgtc tcaactgcgg ggttatgatg ggtggtggtg acagtctctc
    64441 cgaatgatcg tggctgctgg tcgtcgatgc catcccaact aggatatcag cagtcgaact
    64501 cgaaattttg ctctttaggg gtgaattgga ggccttcgaa gccattcgct ctttggagcg
    64561 agagtttatt tgtttccgcc ccatacgttc tatattctta tgccaattcc ccgataactc
    64621 tttgtaaatt ggagttggag atatcaaggg agctgaaatg attggcggca tttcaagcgc
    64681 ctccggagcg gtttggtgtt cgtctaaccg gtcataaagc tctgaatgtt tttcaagacg
    64741 aatgcccatt ccttctttca tattaacagg tgtagcattt tgtagggtaa ttataggagg
    64801 agacacacag cccgcgattt cgccatgccg cttctgagat gcggccgtgc gaacccacct
    64861 tgggggactt ggatacgatt ctacattctt aatcgtggtt tccgacatgc cagtcttagg
    64921 tttgtggcga agaccgttat tgtcagcagg catagtgcgt ctacccgcca atctaatatc
    64981 tgtgtttttc tttatgctgg agttatccgg ctgtacaatt gactgagcca ttgccgtaac
    65041 atttttatct agagcaccga gttttttgag gggggcagat tccatgcgag acgtctccgg
    65101 ggctggtggt tcatatacga ttgggggcgt gggctcaggt ttgaactcca taccgacaat
    65161 aggtttatag tgcatggcag atcccacatc ggacacgaag ccatcctgat ccccctgtgt
    65221 ggcaaggtct gaatcagctg tcatggtctt gctagtagga tttgcgggat cgtagtcggg
    65281 tttcagtgta tgcgattcta cgagcacgcc cggttcaata tctcgcgcat aaacgtcggc
    65341 ggtcatattt gtattaacag gggtcatttc cccctcatca tcgatatcaa gagcactata
    65401 ttcaaccgag tcaggagctg cgttaccttc aataccccct ccaatatacc cgtcttgctc
    65461 gccgtcgcta taaacgggca attcttcgct gccggtgagg ggacatacgc cagggtttat
    65521 tttaaagaaa ttaatactct cccccccatc agtcgtattg tgctgatcaa cgccagtatg
    65581 gtatatgggt gtcggataga tcctagaatc gtccgtgaag aacctagatg cttcctgagc
    65641 gtctaatacg tgcatgtgtt gaaaatcttc accgtacacg tcgctgtcaa tgtatggcaa
    65701 ttctgctatc aatgcatcat cggcgcaggt catacgtatt ataggagcgg gctccagttc
    65761 ttctttggcc cataacactt tcactggaac catcccagca tccactatta ctaaacacgg
    65821 cggggcttca gatagaggtt tggaggcaat gaggtgggat agcagctcta gctgttgtcc
    65881 aaggcacgca ttttctattg gattgctatc ggccgccaat aacttggcgc cccatgacgt
    65941 aatatcagaa gaaacggcgc ccggctctac aaaacagccc ttagaaccgg acctggaatc
    66001 aaacagccga atacatagac tcagcccaga atcgggtgaa aatgcttccg ggcattccgc
    66061 cgccacgaca atcctggcgc cgaatatagt ggcgcatgcc gctatatcca ttgcatttac
    66121 ttttaatttc cgactaggcg gagtagatac aaccgtaaaa gtggtggccg ttccagtata
    66181 ctcatagaga ctgggacaat ctaaatttgt ctggccattg ataaccccag tatgatcaat
    66241 ggtcgatgcg gttacacaaa gggtcgcagc tccatctcct ctggccatta cgacgtcgtc
    66301 ataggtcttg catgtcggtt ctatcccatc cggcagcatg gacgaccaca tggcagctaa
    66361 tgcagttggt ggtaagcaca tacgagccag caccgtagtc gtgagaagaa gactatctgt
    66421 tggcactact gcgcgaattt ttgcaaaccc cgccccttca tctccagata tatctcccca
    66481 tggggccaga gggtcgtgat cagaaagacg gccccgtttc cagtcggaat atcgtatagc
    66541 aaaaagcgct ccaccggatg ggtctttctc ccctccagca agactcagtg gtctgcaatt
    66601 agggtctacc ttgcccccat ccaccactcg agttgataaa caattaacaa acagtacgtt
    66661 ggaaatggca tctgtcaaaa cgttgataag agtttgggcc atgaagccgt attggtttct
    66721 caaatctagt ttcgaaaatg ctaccacgtg gcctggtgta catgccataa ctgttaccaa
    66781 aatatcggct gggtctaatc taactacttg tctacgacga tcgtttgcca tgaacttctt
    66841 tacttcaccc ttttctatag tagccccata ttgtccgggt ataaagtaga tatcagataa
    66901 attgctccca gtcatacggg ttaacgttgt tgctattaat gcacaatata ttgtgccgtg
    66961 tgcctttata caataatctg gcgaccagtc atggatgccg gtgtatacat attttctaaa
    67021 aagttggaac cgatctgcac acgcctggac gtatcctaat cttaaaatca tcagatcgtt
    67081 caagatgcct gcggcagatt ccatctctac agttgaaata aggtttgtag gggcacgtgg
    67141 tttgatattc acagcggacg tttcgcacaa acacgcagca agcttatcgc atgcggttcg
    67201 gtaacaaata gagtatctca agggcgtatc tgtagaatct aaaaacgtgg tgaggccggg
    67261 catatcaatc tctgaaaatg cttctcgtaa ggtagctact actttaggtt tcatccaggc
    67321 cgcaactcta tgcttcaaat atttatccgc aagtctaacg ctaggggccg tgtcgggtgc
    67381 aatatctgcg cgccccgtat caaatggtag caatgggggg tcgcctatag attcggttga
    67441 tgcattagca tatgcggtgt atagagccag tcttatcttg ataagcttta catatcgccc
    67501 cacttgtttt acataccatt ttggaagcct tttggcaata tcatcataca ttgaagacat
    67561 cgccctgaga tcatttaaag aaaaggtcaa cggtacttta ctacatatta tttccacctg
    67621 ccttattgtg tcttcaatct ccttcatgct atcgaggaaa ttatcaagca tcactgtccg
    67681 gtctttgtac ttcgagtcta tacttcctat tatttttgaa ggaagtctat tgtattccat
    67741 actgttacgt atggagttta tggcatttgt cgacgcttta gcccgtgtag cgctttcttg
    67801 tgcagcagag aatccttccg agctcttatc aatcctgtct ctattatgaa taaaggcaga
    67861 ccatgtttca tcccacgccg cctctgctaa agctagctca gacttcagtt cggccaaacg
    67921 gttttccaat cgcactaaag cttctatacg ctctgcgtac attgtcattg gaccactccc
    67981 gtcgattctg accgtcagat cgtgtgaatc tattactgac tcggcatgtt ttaaccaatc
    68041 cactgtttgt gtgtccagtt ctttactttc ttcgacttta gtgagaagaa gtgctgcttg
    68101 tgttactatg tcttgtgccg tctctgcctt atcgattgcc ttcgctatgt gcgcaggcat
    68161 tgcaacgagc cgtagcaagt tcttcagatt tgccaactgt tccgcggttt cactatccac
    68221 cgcataagat gcttctgcca agtcctttaa aatagattcc cctctcgact ttgcggcttc
    68281 tatagccgcc tctactctct gtgttattgc tttgatggca tcattgtcac gccgaagaat
    68341 gtatgcacta tactccgcat atgctgtgcc ttcaagctca gttatttttt cttgttgcaa
    68401 tgcatctgct atcgacatga ttgtggtcgc cgacggtatc acgatggata tgccatactc
    68461 cagagcccgc ctggccccct ccgatctatg cgtccgggcc agggtttcta aggaatcgct
    68521 tatctctata gagactcttc ctgacgcatg caacgcattg accctcatat gttcaagtct
    68581 ggttagaagt ccttcgaacg agtcatggcc gcggcgataa aaatctacat atttcgccag
    68641 gcttggtatc gctctgagat cagattctat tgtccctaca agaaaatagt aatccaagtt
    68701 ttctgggtgg gcgctggcgt atctaaggat ggcgaataat actttaagta agcttattaa
    68761 gacgtcgcaa ttcactccga aaagcattgt atagtagggg gccgctgcaa aaaatgcatc
    68821 cccccaagta atgttcttaa gggccactat cggtggtttt agaccgtgga tgatattcgt
    68881 cgtagaatac gggttaaact gtaagacagt tactatcgca ttttctacaa cacgagcatg
    68941 agccgacaca attttttcgg ctcttgattt gaaacggaca gtatcatatt cggcatctct
    69001 ggccgtttct gccaaactat ttatccttac ggcatcaaat tccgatttta tttcagcatt
    69061 gaccaacact gaagtaacgg aagatgtcca taattcctcg cctcttgatc tctcaacatc
    69121 cacgcgattc cgttggtatg attgaagagc tatgtcaaaa tcacccaccc tattattcac
    69181 agactctatt aatttattca attcggttat tctgcgctgt atgtgagaat tataagtaag
    69241 gggttcgtta tccaaagccg tcaacgcgtc tttgcaatct cccgcttgtt tggtcgctgc
    69301 ggaaacagct gctttagcat taactataat ttcggcatct gtgttatagg tgtacgtctt
    69361 aggatctaaa ctcttgattt tagtgattgc atctatcaca gcttcggaac tatcacgcgt
    69421 cgttctgatc aaggtgctta aatatgctcc gcgactagct aaatctgccg caccttctgc
    69481 atcagtcaat aatgcgtgta agaatgaaaa catatccgcg cgttcagtag ataagactat
    69541 atcctgttga gatatcgtct catcgaccgt attaatatct gctattgctt ccttcagcac
    69601 cgagactgct gccgaagtct tttctattga cgtcggctcg gatgcagcag atgtcagtgc
    69661 agccgaaagc acatcagcat gttttccgaa aaatactgat gccgaatgat attcgctctc
    69721 atgccccagt atcaccttaa tagcgagggc gaacgcgcca ccgagacatg atagctgtga
    69781 tgccgttcct gtactggggc gcgccaacag tgttttgtac tgagttatta gaacccatag
    69841 atccgatcgt aaagctccca tcacatctgg tggggcggaa gccaacaaac tttcaaatga
    69901 tcccattcca ggaatgatgg aatctgagat tgttttgatt gtcgaactta tgactctcag
    69961 acctgcgaaa ttttgtagag ggcgtagcag tttacgcatc gccgcatata ttccgtcgac
    70021 agcagctttg acttctgcgt atttagcact gagacgggcg atcaggagtt ctgtttctga
    70081 ccgcttctgg cgaatcttct cacgaatatc agcacttaaa gagctggcga gtttagcgcc
    70141 atccaggcct ttcgtgatac taactatgga gtttgccagt ttgagagctt catctagttt
    70201 ggtgggatcg accaccgtct cgatatccgt gtacgatgca atcttagatt caatttcatg
    70261 caaacgctcc agttccgtaa atgctgtttc gcggcgggca gcattatcat tcacagcgtc
    70321 aacttcctcc aatagtagat ccagctcgcg gcgactaatc caaccgttag tctggacaga
    70381 aaccatcagg cccttccacg ttacaagatt gtccgccaca tctaaatggg gcccgatttc
    70441 catcaagtct ttaagcagtt gcgattcgag cgctttagat accgacacgt gtacccgcgc
    70501 atcgcaccgt gaagatatta ataatattat gtcatctatt atggacaggg aagaaagtaa
    70561 tctggtcata cgttccagct gttcggtgtg tacgatttta aatttagacg tctctttcat
    70621 atccgcgcgc atcaccttcg cactatataa agcacatttg gaataatact ctcggagggc
    70681 attgcctact atatcaatag ccgccttccc gagagactct agctttttcg ccacggcatc
    70741 agtggccgtc atatctatgg cacttaaacc cttcgcgggc gacattcccc caccaccccc
    70801 cataacaaaa gcgtcaaatt tggtgttcat ccatcgaatt ccctcatcga gcgcttcaat
    70861 ttctgctagt attagttccg ccttacgcgt ggccatattt tccctatcac gtatgaactc
    70921 gcaaagagac acaaccctgt tcgttaacgt ctgatctgag ttataagaag ttgtctctga
    70981 atacaacttt ccagacctat aaaaagtatc tactaaaact gttgccatgc gctcatagat
    71041 tctatcaggc tccatcgtac ttgcttctcg ttcaatagca tcgagagatt tattgagtgt
    71101 tattgtagct tcctcgacct ctagtgccac cattgtcagc ttactcaaag ccaatttgcc
    71161 tatgcgcgaa ccttcggtaa taactgattc tattaagttt gccgattcgg aggcttcggc
    71221 caatgataac ctggtcgaag atagaaatgt gctaaagtgt gacgaagttg caaatgctct
    71281 tgtcagagcc aacatttcgg gttcgacgat cgacgctctg tcggtaacag tctgtgcacc
    71341 attctctatt atgtaattaa acaatttggt aaacacatcc attatgcaaa cgtctaacac
    71401 tcccccatcc cgatgagacg tgggaaccac caatctcatt ccatcggcta tcgactccgt
    71461 tatactatca atcatatcac tgatggtcga taggggatag ctgccagaat agtcgtcgtt
    71521 ccaaaaacta tcccgcaatg tattatctaa atttcctgtt actgtatggg ggttgaatac
    71581 ggccctattt cttagactca aatgttcgat ggaatcggaa atatttgaaa ttgctcccgc
    71641 ggggctatcc gaattatgac catcgacatc aggcggttca ttagagagat gtccatagtc
    71701 aagatccaat gcccgttttg atttccgggg tggtcttcta gcctggtgga acgttggtag
    71761 ttcggacgat acattttccg aactggatgg cggcgtccaa ctcggacgcc gcctcttttg
    71821 tctcgaattg gaccccctcg agcgccggtc gggcttatgg tcatgtccat ttttagaagg
    71881 gtcgtgcgca acagctccta agtgagaata ttcctcagat atttctgatg cgtcagacca
    71941 aacggctggc accgatgttg cctccgatac atcttctata tgcgagttta ccgactcatg
    72001 tataaccgat ccctcggaat atctgcggca atcggttctc gcaggcggat cggaaatatt
    72061 tatgttggtg gaatcgccac ccacaagagt ggatggatca tattcgccgt gttcatgtgg
    72121 tgtaagatgt gtactttccg aatgcaattt aggcgaacta tctgcgtgtg agtcggctgg
    72181 ttctggttca gaaacgagct tgggggtacc tacaactatt ttagtctgcc tgggcctcgg
    72241 tctggaagat gggtcgaaat ctgccgacac tatctttaga ttatcattct catccgccct
    72301 gcctatgtcc aatactatat cagcggttcc atataaacgt gaaacagcag atattatttc
    72361 ttcctttggg ggggcactaa cagcggtaga aacaaagtac acaaaagtcg cagaccaatc
    72421 tggcattcct gaaggatctg cgtaagatgt gagatactga taaaagtaca tatcgctcac
    72481 gcgtacgatg caggcttggc ctatatgccc atgaccatgg ggatcgaaaa tatagacgct
    72541 atcctcagtt ttaaagaccc ctattccgag aactccgata acaattaaac agtaaatgtc
    72601 cccccgtttc tgtttccata cccgttctac aaatgttctt gcagacattt gcgtgtctag
    72661 aatgataggc gtgctatcgt cgagataaaa ctcggattct ccatatgaac ttgaaaaggc
    72721 gacgcataaa ttacccccgg gatcttttga taaaatacgg tttggtagat catgcggcac
    72781 acaagttgtg tacactcctc gatccgacgt atgtattgtc cagtcttttc cctggagaag
    72841 aaaaccatct atcgcatcgg cggaaagggc cgtatccaag ccatatgtaa acacaatgcg
    72901 cagaaatgct aacgatgacc tcaaacacga taccgacgac ccgggactta attccgctgc
    72961 aaattggttt ctaatgccaa cggcgacgat tgaaaaatct gtcgtatcca ctacccgttt
    73021 tgtccatctg tccagcatta attctgagtc gcctgcagtc gactccaata aactatttcg
    73081 tttgtacatg tttgctcgca cggcctccat ttaatcaaat ctgccgttat gctcgcgatt
    73141 gagatcagtg agtgtgcgcg gtacgtgcgt tcgggcgatg atgtatgctg taccaaggtc
    73201 actcagtctt taaatgagta ttggtcattt gtgttacttt tattcagatg tgtgcagttt
    73261 aatcgataca tttcaaaaac agatccgttt tcccagccgc taatacttta attaacgata
    73321 caggatggtt atgaggtcgt tccttgcata gatcgccctg tattaaatac agtatctact
    73381 atattaacca gcgcatctgc cgacactcta ggttttgtga taaaatctgt cgcgaaggct
    73441 gcaaggtcga catcttcggg gggtagggta tcgaaatcca gagtgttaaa attgatctcg
    73501 tcacgatgaa gtaaattatg tcgcgcagtc aattccacaa caaaagtcgg ttcatcttca
    73561 tacacggtag aataatcatg caagatagtt tgtatgacat catctaggtc cgtatcatct
    73621 atttctcttt cggcaccatt cgaacctacc ctatcatcca atatcccctg ccatacattc
    73681 ccgacattct ctatagctgt aaccaagtct tgcgaacttt tatcgcgaaa tgaggaatta
    73741 atttcagaaa gaatagacca tttatcaaga agatgggata tggatcgcat cccaggaggg
    73801 tggctacagg ttatcaacat tcttacatgg aggtccatcg aagtctgcag gcgcacaagt
    73861 ccagcataat cagctcccag atcagagaag aatcttgcag cggcatcgct aaacatactg
    73921 gcctcttcca acaaactatc acacaggggc aatttcttgc ccgtttcttc cattacggtt
    73981 ctaaacgtta ccactttgag cctcatatca gccaacatag cgtttgacga attatacgag
    74041 tccctaatag cagccattat atccgctatt ttccacgaac cgaaggtgag ttctgtcgac
    74101 cccctactgc gaactgcaac tgtgcctccg ggcatgcttt gcacgaaacg gcacgaaaag
    74161 aagtgtttga atttcgatgc caggtctaaa agttcatggc acttctccgc tatgtattga
    74221 acacactcat acgtacgtgc tgtcaattta tgaaaactgt gtcgcatggc caccccgtgc
    74281 atagtcacca acagtacact gttcgatatt ttaggacgcg gcggtacaaa tggtctagtt
    74341 tcgggaggca gcagcagaac agctgcatta atgacctcat ggagttcggt tagcagtgtt
    74401 tctatattat acgcatcatc tgtcgtaggg acggggggtg tttcactcgc aaacgggctg
    74461 atggcagaga ttagagcatt tagctttgct ctgtggtcta taaaactatt tatgtaaggt
    74521 gtaccatagt ctcgggccca cgacaacacc gatatgacag tttttatgtg ttcataagaa
    74581 aaactggccg cagtggtact tgttagcgca tccatgcatg cagtagccac gatatatttt
    74641 ctaaactggg tggacgtagt ttgggacatt attggcatcg attgtggata tcgaatattt
    74701 atagctatgt gtaccatatc catttcgcta ttatcggcat ccaccagatc tggagtgttg
    74761 ttatgagccg actcatatgt atctctaagc gagtctgtag aatttgagtt ttcctgcagt
    74821 gaaagccccc atataacttc tgctctatga tcaaaccata gcagaagaga ttctcttgca
    74881 gaacttagag ctcgtgcaga tccaccaaca tccattttac gtgcaattag atccatttct
    74941 gccaacaaaa cagaacgtgt ggtttttaca taatcatcgt gggtatcggg gggtatgcag
    75001 cggcctaata tctgagatat taatccatgt tctagaccta gggcaaatat aaattccgaa
    75061 tcggattctg gaggaagact gccatctacg taattttcca agtaattcat gccaggccca
    75121 taactttcaa taagtccaaa cactatattg ccaatgaccg caacacaccc aataacttgt
    75181 tgtaggtcat tgaatatagt ctctaccgaa tttctataat tcttagccat atatgttttg
    75241 agggcagatt cgtaagcttg gcacgactgt cgaacaaagc cattgtctat taatgcctca
    75301 agtaattgtt tgggcgacga actatattga atggcatccc aggcccttct gacagattcc
    75361 gaaagttttg ttctggcttc atctataacg ctcgtactgt gatctgaccc atcgctagaa
    75421 attagttgga gcacagctga tatgtgaatg gccaatgaat cctctgttaa cgatgtacta
    75481 gaaactataa tgtcttcgcc acttcgcaac ctctctgcca ccataccagg ttgtattcca
    75541 tatatgaacg gatctccgta tgcaattgca gccgatgcac gaacctcata tgacgtacgt
    75601 ttagttaaat ttgcttgtga cgccgacatg agttcctccg agcccaatgc attgcaatcc
    75661 tcggcaaatc tttctttcaa taccgaatgt tgggaagcgc ccttgcctct aaaatattga
    75721 tctatgaaag ctatagtgaa caggattctc gtcaaaggag taaaagctct attcgttgtg
    75781 catcgatata aaatgacaaa cggtactacc catccaacag tgcgggcaat aagacgtatg
    75841 ccttcctgaa caaaggggaa atcatatatc aattcgaatc gcttatgtgc taaagagtca
    75901 gttaaattcc aaacgttagg aatacgttcc cgatcagata gcaggaattc cggtgtatag
    75961 gaaacggcac ttgtggccgt atcttcaaac tctgcaaacc agtccgttat taacggcccc
    76021 attacattcg ggccgaagga ggcggatatg cgtaagttgt ttctggataa ccaagaaata
    76081 ggttcctctc cagtcatttc tcccaccaat ttacgcaagc ggatcgattc gtctctccat
    76141 gacgttttat cccatcttac tgagacgcgc cacagtatca atccagtaaa attttgcgcc
    76201 aacattgccg cttccggact tttcgttcgt tgatatactt ctaatatcac ggaaaaaaca
    76261 tcacgccaag tcgactctac ctgctgtata ctcatttgtg tcgatgacaa gaaaaatgtt
    76321 ccaatggctg cccgtgcctc cgaaatcact gtaacgggcc acggctccgt aggggaattt
    76381 tctgcgcata acgtctgcaa tgtatctagc aacgcattca atggatagtt atcccccttc
    76441 cctaatgcgg acattttagt aatgggacta ctcgaacttc gacgactgct tacaataccc
    76501 gatttggttg atcctcttca caagaaggtg atccaaagaa tgaatcgggg cagaaactct
    76561 ataatattta acagctgttt tcgaacccgc gattctgtag gacggccctg ttgttcccca
    76621 ataccccaca tagcatatat tcattcagtc gtgcgcaatg tgtatactgc acctgaatat
    76681 accggcagtt ctgattcgag tctagcggag atacatgcta ccacgtaacg gttctgtggg
    76741 gcataactga tttgcgcgac agtaggcgag tatacgaacg tcgatctagc atacaactat
    76801 ggcgttacct gagagatcgc gcaatactaa gaccgcttca cgcacaagtg aaatgaaata
    76861 ttatagcgca cattctaacc gtccgtacga attgcacagt ctcatgcgat ctatcggcaa
    76921 gaatattcga accagcgtag gaggtcgcat caatttgggt tacatgaacg ttggggatcg
    76981 atcctcagtg aacgacttaa atgtgttatg gaccgcggat acactcggca tgtataaaat
    77041 ggaccgaacc ccggcattca aagactctac cgcaaagact acagcgatca tagcacagtc
    77101 tatacggtca aacagcgaaa taagagagtg ggggggcgat agggccgtaa taacgcgtca
    77161 ggtcacacta acggatttct gttttcccga cgccgagttc cctggatcaa tactgctatc
    77221 tatgcgacac ccgctggaca taaacagcga agctctatac gcgactccag gagggcgcga
    77281 tccacgggca ttagaaaccg cgtggtatga cctctccgaa ctggcagcgg tttctgtgaa
    77341 taggagggat ggcgggggtg tccgcccatc actagtatct ctatttttcc tagtcgcttc
    77401 tcgcgcggga gattattcgg acaaaaatgg cgccgaggct gtaagagccc atgtgattag
    77461 taactacggc cggcggagaa tggaagaaag actggataga tttggaatct gccaaatggc
    77521 gatgcttaga tctcacgtat ttccacatag atttttccaa ttattaggag gtatgatatc
    77581 gtgggtatct caacgtgaaa ttgcgagcat cacagctgtg atgcgcggct cacaagagag
    77641 catcaaaaca gaacagacca cactgcccag atcctccgta tatgttcccg catgtgcata
    77701 cattgatttg gacagcagca tacgggtaat atatgaagac aaatccgcct cgttgatata
    77761 cctagtattc gtgtacacgc aacgattagg gagagaaagt attcgcgtgt atgttatgcg
    77821 gagtcgttta ggagagggga ctgtccagga gtgtctgggg tacctgtatt ccgagttgcg
    77881 ggcaaataac acgatccacg gtaccgatgg cacactaacc ccgcatggag caaacgtaaa
    77941 cacagaattt cccctgaaca gttcattcga gacacagagt caacctgcaa aatttactag
    78001 gaaagtggaa aaggctgagt ggaaagttga cttgcgtggt cgccccacac aagaatcttg
    78061 catgtatgca gcgtattgtc gcatgggata tttagatggt tcgtgtactc ccctaaagaa
    78121 atccgaacgg tatggatctg tggatgtacc tattgtatgg cttccgggaa tgcattggga
    78181 tgtaggggac tggacggagt gctattgtta aaaacggcgc ccaactcaca tagaacgata
    78241 tcttgtccta gaatgtacat ccactcccag attattgcgt tatttccaga ggagggactt
    78301 acagtataaa ataaacgcga ccgcactaca cgccacgccg ctctcgtgga ggctcgacca
    78361 caataatagc atactgatat catctgaaca ccaagctgaa aatagcaatg ttcgacgaat
    78421 ctgatgggta ttcaggccca ggaaaaattc atgccagggg aatcgaagcg cccgggactg
    78481 ggcaaataca tgtcgtagac gcgagtaccg catctcgtaa attaaatgac atgcagatgt
    78541 catcgtcggt ggcaactgaa ctatactcta ttgaacgcca gctattgagc atggactatc
    78601 tatcagattc agatttgtat atgatagacg ttaggaaata tcccgagacg ataccatcga
    78661 taagtgatat gcgagcacat attacacgtc tagtaaataa gatgaagccc atttgccgtt
    78721 ttgatgaacg gctttattct gtatgtgggg aacttgtcca tctgagaatt gcgtcgtcag
    78781 agactacttt cgatgcctgg ctcacgtcaa agaaattaaa ccttaaagcc gatgtgttag
    78841 ataacttacg gcgatataga gctcatatcg aaatggacat gcttcgattt tatggaaaca
    78901 tatatccaca gttaaaacga ctggggctac agtctgcatt gaaatatgag gagtatttgg
    78961 tggagctgga aggtggaaaa aaggaatctt tgtgccaatt ttttattcgt ttggccgcag
    79021 ccgcggccac agaagcttta cacagaaagc ctttgattgc ttccctaacc aacggcagtg
    79081 caaattggag aacagctttt acatcctttt ttttggccct tgcacatcag ctctttgttc
    79141 cctcgactcc gtgcatgcta tttttaggac gagaaggtta ttcgacggca agctgttatc
    79201 tcatggatcc aagaactaca accacacaag atactatcaa agttataacg aatgatgttg
    79261 ttccccatct cctggcacga ggagggatag gcatatcatt gcagcacgtc aatcaaaaat
    79321 cgggtctgat gcatgtttta aagctgatag attcattgat tgtggccact aatgtgaacg
    79381 agtcccggcc gacgggcgtt tgtgtgtatt tggaaccctg gcattcagac atcatgtcgg
    79441 ctttgacgat gcgcggaatg atggccgccg aggaatcgag aagatgtgat aatgtattcc
    79501 tagctctttg ggcgtgcgac ctcctgttta agagatacct gcgatatgtt aatggagaaa
    79561 aaaatgtgat gtggacttta tttgactccc gcgcgtctat tttatcaaaa ctatatggcg
    79621 ataaattcga ggtggaatat gaacgtctcg aaaaagaagg tattggggtg gcccaaattc
    79681 caatcagaga catgatgttt gcgatcataa aaagcgcagc ttctactgga agtccattca
    79741 ttctcttcaa agacgcctgc aaccgacatt acatcacgga cacccagggc gatgctattg
    79801 ccggatccaa tctgtgcaca gaaataatac agaaaacaaa cgaatccaca aatggcgtgt
    79861 gcaccctagc aagcattaat ctggccagat gcgttcgccg tgttaacggt gaatgtaaat
    79921 tcgattttga tgcccttagg catgccgttc gactggccac cgtttttacc aatgcaataa
    79981 tggatgggag tgatgtcccc acagtcaaat ctcaatcggg tcgagaccgc aacagatcta
    80041 ttggtatagg cgtccaagga tttcatacag ccatgctatc tttgggtcta gatttagagg
    80101 acggagctgt cagagcactt aataagcaaa tatttgaact aatgctatta gaagctatga
    80161 ccgtgagctg cgaattttgt gagcggggtc ttccaccgtt cccagacttc tctgacagct
    80221 actatgctca aggccgtttg cattttgatg gatgggatag tgtggagtta acggcccccg
    80281 aggaatgggg agttctccgc ggtcgtataa tgtcgtctgg gctttacaac gcccagttca
    80341 tagcgctgat gcctactgcc gcatcggcgc aagtgaccga ggttagcgaa ggatttgccc
    80401 ctttgttcag taacatgttc agcaaggtga caagtgccgg ggaactgctt agacccaaca
    80461 gtcaattaat gcgggagctg agacagatat atcccgataa tgagcagcgt cgcttaagcg
    80521 ccattactgc acttgagtcc actgcatggt gcgtcaaaga agcgctaggg gatcggccgg
    80581 aatgtactcg tctactcaaa tataaaacgg cgttcgaata cgatcaatct ctcctaatag
    80641 atttatgtgc ggatagagcc ccttttgtgg atcagagcca atcaatgact ctgtttgtaa
    80701 cggaaacagc tgacggcacg ctattggcat cccgcgtcat gaacctgctc ttacatgcct
    80761 ataaagctgg tctcaaaacg ggaatgtact attgcaagat ccgcaaggct acgaatactg
    80821 gcatatttag cggcgacgga gaactgacct gttcttcctg cgtgttgtaa taaccaccgt
    80881 ttattaactc aatatagccg ccatgaacaa cccagtgcat gctgccggga atccgccgaa
    80941 caattatttt tctttagatg ggaccgatct tcatctttcc gagagagggg ccacttctcc
    81001 gaaagggagt gatgggggag acctagcctc tccgtacgtg aacaattgcc atatcacaac
    81061 ggcgcaatat ttctacgttc cggaatgccc tgatatagga aacctacgat ctttgagcat
    81121 catgaaccgg tggaccgaaa cggaattcgt aattgcagac gacctcgagg atgtcggcaa
    81181 gctttccgaa gatgaaaaaa atttttatcg ctttctattt acctttttat ccgccgccga
    81241 cgatctagtt aacttgaata tagacagtct gttgagttta ttcactcaga aagatataca
    81301 tcattattac tttgaacagg aatgtataga agctgtccat tcgagggcct acagtataat
    81361 tcagctaatg ctgttcagca atgatcaagc cgctcgccaa gaatacgtca cctcaacttt
    81421 gagatccccc gcaattttat caaaattgga atggttggaa cggcgagttg cagaatgcac
    81481 ctctatcgct gaaaaatata ttctcatgat tttaatagag ggtatatttt tcactgcgtc
    81541 ttttgctgca atcgcctacc ttcgtgtcaa taacctgttt gtggttacat gtcaaattaa
    81601 caacttgatt agcagagatg aagctataca cgtggaagca tcctgttgca tttttaaaaa
    81661 ttatctcgcc ggccccaaac ctactactgc ccgcatccac acgctgttta aagaagccgt
    81721 taggctggaa tgcgagttcc tccgcacggc ggctcctcgc accagtaata ttatcaatat
    81781 tgatgccatt tgcagctatg tacggtacag tgcagacagg ttgttgagag cgcttgatat
    81841 actgcccatt tacgacgaac ccaaaccccc tgctgatttc cccctcgtcc tcatgtccgc
    81901 tgcaagcaat actaactttt tcgagcgacg aaacaccgca tactctggaa gcgtttcaaa
    81961 tgatctttaa ttcgcaattg aaattacccg attcacgtgt actttaggtc aaataataaa
    82021 gttcgtgtaa tgcatcctcg ttcgcgtttc tttttttagg cgaccctatt ccaatacttt
    82081 gtcaacactc tattgaaagg cggtatctcg ggaatgcgtc gtaaaaaagc ggatgctaaa
    82141 ctgcccgctt cgttactatc aactatacta cggaggacca agttctcaat tgcagaatca
    82201 tcccgcgtct cttgcgtaat aggaaaccgc tttaagatac tgactctgtg tgttcttcgt
    82261 tctggtgtta tattttctat tacatgtttt ataaatttat attctagaac ttcacatttg
    82321 gttcggggag ctcgtaaatg cgttaacgcc tgccgtgcgt cgcgtattat atttacatcg
    82381 ttataggtgg cgcacaggcg gtctgtgctg gagttatgat catttttgcg gttctcgctt
    82441 aaagttgtcc gtagattatg cttcagtcca gacctatcta tatgcttctc gtttacagca
    82501 tgtatggtag aatccgcgct gtcatggtca tcgatagcgt ttcccatacc tcgcatggca
    82561 ctcccaagtt cgactatttc ttgcatagat ttcaaattcg gctctcgatg aaggtcagta
    82621 tgacaacgaa caaagtttaa taagaacgtc gagtaatcca tcttcaacgc cgccagtata
    82681 tctttacagt gaatggtcgg tgggaagata cgtgtcaaat ctataattat atcacacccc
    82741 attaaaatca aatcggtatc agaagacagg acataggcaa ctgtctttgt atggtacaaa
    82801 ttggcacaaa tatcatccgc ttccatcgtg ccggcatcca cataaggata acccataaag
    82861 cggatcatgc gcatgcatag ccggtgtata atttttggtg tgtcggattt gtcgctccat
    82921 ctgcagatcc ttttatgggg tcgcttcttt cgagagctcc ccccttctgt ttcttcatcc
    82981 tcatcatgca ctatcgcacg gagccgtcct gaccctctaa cgacaacgtt gcaggtagcc
    83041 gctattgctt ttgccccata cagcgccttg acgtttccgt acatacccct gtccgagaca
    83101 aatactgggt aatatgaccg ttggtgcaac aggcgcagca aacagtataa acatcgcaag
    83161 gtgataatcg aatcctcgac cccatctatc ttctctggat aaaacttctc taacagtccg
    83221 tacatgacgt tccacaaatc cacggcgatt ggtgttccag ctccacaagc tatagttccc
    83281 gatatttgac ttttgactaa cccattggca tacgcaaaat tcatgcaacc atacataccc
    83341 atgactactt gtattaaata tatttttaac gcacagcaaa tgtaaactcg agcaaaagat
    83401 aaagaaaggt ctataaatta aaatcgcata tcaagtacta gccaaatgac ccaagaacat
    83461 ggcatcccag agaaattgca gcaccgctac ccatatacac accactttcg gctgtgatat
    83521 atatagttta aatgtccatg gatctataac gtcaaattat gcatctcgaa tataaaagtc
    83581 atgatatctg atgggtaatt ttggaatggg tttaaaagtt tggacgaacc atattatcac
    83641 agttgatgtt caccactagc acgtaacgtc cgtcccggca taagtgtttg atataggtga
    83701 ctcccggatc ataatatata ctgcgtttta gacctatacg gtaatgcaac atccatcatc
    83761 cggtgacgga aatatagatg gagcgccaat cgccgatagt ttgatacgta tagtgcaagc
    83821 cactgtaact aagccccata atcctgtgca gtataaagcc tctcccccct ctgaaacaag
    83881 tactgccccg cctacacccg accagcacgc cacagctgtt cggatccgag cttctactat
    83941 acaacgcgga cgataatttt gtccacccca tcggtgttcg agaaagggtt tttatgatgg
    84001 caggaataac tgtcgcatgt gaccacactg caggagaggc tcatacaccc gaggatatgc
    84061 aaaagaaatg gaggattata ttggcagggg aaaaattcat gactatatcg gcatcgttga
    84121 aatcgatcgt cagttgtgtg aaaaaccccc ttctcacgtt tggcgcagat gggctcattg
    84181 tacaaggtac tgtctgcgga cagcgcattt ttgttccaat cgaccgtgat tccttcagcg
    84241 aatatgaatg gcatgggcca actgcgatgt ttctagcatt aactgattcc agacgcactc
    84301 ttttagatgc attcaaatgt gaaaagagaa gggcaattga cgtctccttt accttcgcgg
    84361 gagagcctcc atgtaggcat ttaatccaag ccgtcacata catgaccgac ggtggttcag
    84421 tatcgaatac aatcattaaa tatgagctct ggaatgcgtc tacaattttc ccccaaaaaa
    84481 ctcccgatgt taccttttct ctaaacaaac aacaattgaa caaaatattg gccgtcgctt
    84541 caaaactgca acacgaagaa cttgtattct ctttaaaacc tgaaggaggg ttctacgtag
    84601 gaacggtttg tactgttata agtttcgaag tagatgggac tgccatgact cagtatcctt
    84661 acaaccctcc aacctcggct accctagctc tcgtagtagc atgcagaaag aagaaggcga
    84721 ataaaaacac tattttaacg gcctatggaa gtggtaaacc cttttgtgtt gcattggaag
    84781 atactagtgc atttagaaat atcgtcaata aaatcaaggc gggtacgtcg ggagttgatc
    84841 tggggtttta tacaacttgc gatccgccga tgctatgtat tcgcccacac gcatttggaa
    84901 gtcctaccgc attcctgttt tgtaacacag actgtatgac aatatatgaa ctggaagaag
    84961 taagcgccgt tgatggtgca atccgagcaa aacgcatcaa cgaatatttc ccaacagtat
    85021 cgcaggctac ttccaagaag agaaaacagt cgccgccccc tatcgaaaga gaaaggaaaa
    85081 ccaccagagc ggatacccaa taaaatgcca gacaaacccg gcatcctggt tagagggcag
    85141 gtgggctggg ccaaccttca cgggcgtccg acagatcggt gacactcata cgttaactaa
    85201 acgccggcag ctttgcagaa gaaaatatgc cttccggagc cagctcgagt cctccaccag
    85261 cttatacatc tgcagctccg cttgagactt ataacagctg gctaagtgcc ttttcatgcg
    85321 catatcccca atgcactgcg ggaagaggac atcgacaaaa tggcaagaag tgtatacggt
    85381 gtatagtgat cagtgtatgt tccttagtgt gcatcgctgc acatttagct gttaccgtgt
    85441 cgggagtggc attaattccg cttatcgatc aaaacagagc ttacggaaac tgtacggtat
    85501 gtgtaattgc cggattcatc gctacgtttg ctgcacgact tacgataaga ctttcggaaa
    85561 cgcttatgct agtgggcaag ccggcgcagt ttatatttgc tataatcgct tccgttgcgg
    85621 aaacactgat caataacgag gcgcttgcca tcagtaatac tacttacaaa actgcattgc
    85681 gaataatcga agtaacatct ttggcgtgtt ttgttatgct cggggcaata attacatccc
    85741 acaactatgt ctgcatttca acggcagggg acttgacttg gaaggcggga tttttcatgc
    85801 ttaccaccgg aacattactc ggtataacaa taccaaacat acacccaatc cctctcgcgg
    85861 ggtttcttgc agtctataca atattggcta taaatatcgc tagagatgca agcgctacat
    85921 tattatccac ttgctattat cgcaattgcc gcgagaggac tatacttcgc ccttctcgtc
    85981 tcggacatgg ttacacaatc ccttctcccg gtgccgatat gctttatgaa gaagacgtat
    86041 atagttttga cgcagctaaa ggccattatt cgtcaatatt tctatgttat gccatggggc
    86101 ttacaacacc gctgattatt gcgctccata aatatatggc gggcattaaa aattcgtcag
    86161 attggactgc tacattacaa ggcatgtacg ggcttgtctt gggatcgcta tcgtcactat
    86221 gtattccatc cagcaacaac gatgccctaa ttcgtcccat tcaaattttg atattgataa
    86281 tcggtgcact ggccattgca ttggctggat gtggtcaaat tatagggcct acattatttg
    86341 ccgcgagttc ggctgcgatg tcatgtttta catgtatcaa tattcgcgct actaataagg
    86401 gtgtcaacaa attggcagca gccagtgtcg tgaaatctgt actgggcttc attatttccg
    86461 ggatgcttac ttgcgtgcta ttaccactat cgtgatagat cgtcggtctg cgcatcgccc
    86521 atgctggcgg aacgctcttt cgaaccgtga ataaaacttt gtatctacta aacaataact
    86581 ttgtgtttta ttgagcggtc gaaaacaatg aggagctgca atttaaagct aaccgcatac
    86641 gccgggcggt aaagaccatt ttataccata ttacgcatct atcgaaactt gttcgagaac
    86701 cgcaagtata tggtttccaa catgcgcgtt ctacgcgtac tgcgcctgac gggatgggtg
    86761 ggcatatttc tagttctgtc tttacagcaa acctcttgtg ccggattgcc ccataacgtc
    86821 gatacccatc atatcctaac tttcaaccct tctcccattt cggccgatgg cgttcctttg
    86881 tcagaggtgc ccaattcgcc tacgaccgaa ttatctacaa ctgtcgccac caagacagct
    86941 gtaccgacga ctgaaagcac tagttcctcc gaagcgcacc gcaactcttc tcacaaaata
    87001 cctgatataa tctgcgaccg agaagaagta ttcgtattcc ttaacaatac aggaagaatt
    87061 ttgtgtgacc ttatagtcga ccccccttca gacgatgaat ggtccaactt cgctcttgac
    87121 gtcacgttca atccaatcga ataccacgcc aacgaaaaga atgtagaggt tgcccgagtg
    87181 gccggtctat acggagtacc ggggtcggat tatgcatacc ctaggaaatc ggaattaata
    87241 tcctccattc gacgggatcc ccagggttct ttctggacta gtcctacacc ccgtggaaat
    87301 aaatatttca tatggattaa taaaacaatg cacaccatgg gcgtggaagt tagaaatgtc
    87361 gactacaaag acaacggcta ctttcaagtg atactgcgtg atagatttaa tcgcccattg
    87421 gtagaaaaac atatttacat gcgtgtgtgc caacgacccg catccgtgga tgtattggcc
    87481 cctccagttc tcagcggaga aaactacaaa gcatcttgca tcgttagaca tttttatccc
    87541 ccgggatctg tctacgtatc ttggagacgt aacggaaaca ttgccacacc ccgcaaggac
    87601 cgtgacggga gtttttggtg gttcgaatct ggccgcgggg ccacactagt atccacaata
    87661 accctcggaa actctggact cgaatctcct ccaaaggttt cctgcttggt agcgtggagg
    87721 caaggcgata tgataagcac atcgaatgct acagctgtac cgacggtata ttatcacccc
    87781 cgtatctctc tggcatttaa agatgggtat gcaatatgta ctatagaatg tgttccctct
    87841 gggattactg tgaggtggtt agttcatgat gaaccccagc ctaacacaac ttatgatact
    87901 gtggttacag gtctctgcag gaccatcgat cgttatagaa atctcgccag tcggattcca
    87961 gtccaggaca actgggcgaa aacgaagtat acgtgcagac taattggata tccgttcgac
    88021 gtggatagat ttcaaaattc cgaatattat gatgcaacgc cgtcggcaag aggaatgccg
    88081 atgattgtaa caattacggc cgttctagga ctggccttgt ttttaggtat tggtatcatt
    88141 atcacagccc tatgctttta cctaccgggg cggaattaag attaaccatc gtatgtgata
    88201 taaaaattat taagtgttat aaccgatcgc attcttctgt ttcgattcac aataaataaa
    88261 atggtattgt aatcagcacc atcgcattgt ttcgtagatg actcatgttc agtccgcgtg
    88321 atgtcaaaaa tacgtatttt tggtatcacg cagcggccaa aatgcccatt atgttatttt
    88381 tactccaaac gcggtattta aaacatcggg acgtacatca tgtggcgcac gttaatcgta
    88441 tacggtgccg ctacattaaa aatcgcaagt ctccgaatat caagctcacg gccaaaacgt
    88501 cggtaataat cttacgcatc gaatgtgata cggataccgt acaatcgctg agtagatttc
    88561 ctatatagtt actcagtagt gatacacaat cacaaaatcg ctggggtata tcatataaga
    88621 atgatgtcgc ccacccctga agatgatcgc gatctcgttg tggttcgtgg acgtctccga
    88681 atgatggata gcggcacgga aacagataga gagcaacgac atccacgtac gacttggcga
    88741 tcgatctgtt gtgggtgtac gataggaatg gtatttacca tattcgttct cgtagcggca
    88801 gtattgttgg gatcactatt cactgtttca tacatggcca tggaatcggg aacatgtccc
    88861 gatgaatgga ttggtttggg ttatagttgc atgcgcgtgg ccgggaaaaa tgcaactgat
    88921 cttgaggcgt tggatacatg tgctcggcat aacagcaaac ttattgactt cgcaaacgcc
    88981 aaagttctgg ttgaagctat cgccccattc ggtgtgccaa atgcagcata tggggaagtc
    89041 ttccggttaa gggacagcaa aaccacgtgt atacgaccta ccatgggagg acccgtgtcg
    89101 gcagactgtc ctgtaacatg taccgttata tgtcagcgac ccaggcctct aagtaccatg
    89161 tcttccatca ttagagatgc ccgcgtgtat cttcatttag aacgacgcga ttattatgaa
    89221 gtctacgcct ctgtcctctc taatgcgatg agtaaataaa aacgcacctc taacggttac
    89281 tgtgttttat ttatccaatc acaccataga cattataaac ataatatgga tctttatttc
    89341 atataatgta ttatacagac cgcgcatcgc gtgtaaaata ttattcgctg gacactttca
    89401 gcctacgtaa aatatgttct accttggaca ctggtatatc tccacgcatt gttttttcat
    89461 gaaagtattt ggttgtcgga gtagacaccc tgccagattc cgaaactgga gggtcattgc
    89521 tcgccaaaga aggcccccca gacccatcgg tcttacgaat tgcaccagtc agaccgtttc
    89581 cgatgttcgc acattgagaa ctcgaccccg cccccgcaaa ttcagtcaaa ccaggaaccg
    89641 tatcgccaca gccacattcg acacgatcgc ctaattgatg tgtgggcgta cttcccgact
    89701 tgttcgagtt tttatcttgc ttccgaatag atttcataag ccgtgcatta acatcgctta
    89761 ttcgctttgg cagtaatttt atccccagta gagccagggc gttcttagac agtttaacat
    89821 catcggttgc agcgcggccg aaccaagtat ttatgctgca ctcgagagcc ccccatgaca
    89881 cgggcaacat gctcggaaac aaattcccaa gctgatgttc aaattggtct tgctgcaaca
    89941 gggcctcttt taatatagta ttttccgtat taccgtccaa ccatatcaca tatcccctct
    90001 gagttaaatt aattaggtac tgacaatgat ggttgagaag tgaaaccaac gaaaccactg
    90061 ctagtatggc acgtgagttc cgatcaccat caaagtccac caggcgggtt tgcgaccata
    90121 atacgctggt ttgtagtaag ggggcgatga cattgcctat aattcgacaa agcaatgatg
    90181 tcgaactcca tttgtctgat ggtaaggagg aaatttcttc catgaattcc ttcaacgatt
    90241 cgcccacatc cccagtatat cggcaagcaa taaacttgga gcctgtggtc atatccagag
    90301 tatcgaccaa ccacagcatc cacttataca acatcaccac gtaactcaac aacaattcca
    90361 atcgggctga tgtgtcagaa ctggcttctc caattttgtc cggtctcatg tagtacgcgt
    90421 acctctgtat catgtcgaac aaattccgca gagatgtcca acagttacga aaaattaggt
    90481 tatgattctg acatttgaac ggattctcaa ccaatggatc gcggtaaatg gttgggtaaa
    90541 acagtaaagc caaggcggcc tttcctcgct ctgtaggatc gcgagtttct gtatacggta
    90601 tagaatgtcg ttcgcaaaaa tagctgttgt aggcagctaa aaagtggcgc ttcacctccg
    90661 atctactaag cttcgccctt ttcaatctac gtttaatatt atacatatat cgatgcatat
    90721 attgtcccac cgcatccccc aaagctagcc gaagcaccac gtactcggga acgccgttat
    90781 cggtagtatc gcgcaacact gattgtcgaa atttggaatc caatccaaat ggtggcgtgc
    90841 aattagattc catccgcttc tccatactcg gcgtcgactt gggtgctcca accaactatt
    90901 aactgccgtg cgcgttgatg cgaacaatct ctctgttaga aagccggcaa ttttggtctt
    90961 cggtagagca gggcgggctt agcaatcctt cacggcatcg gtcttatgtt gagcaagaac
    91021 aagttgccgc gcgtcttaat cagcaaccgc ccatcaacca cattgcttcc gcggctgaat
    91081 taaacgtcac cacccacata caacacccct ccgcgtcggg caagagtttc ggaagcacgc
    91141 tatttaaaag ggcgcggttc aaatattaca tctttggcat cgagtagggc gtccttcaaa
    91201 ggaacaatgt ttccaaggac atcgtaatcg acgggcggcg gaatcagctc taaagtgtcc
    91261 aattctgagt atctaccgcc tccagaaata atctccgaca tttccatggg gggatcccct
    91321 cgcgcaaact tcagatccaa taaatccatt gcttcgttgc gttcctttat atattcctca
    91381 acagtcacag gtctatatag acatttacat acgtaggata agtacctata cattataaaa
    91441 gtttccgacc aaacgcctac ttctctgtcg tgtatttctg atgcgatagt tagttgtgcg
    91501 acgacaatat tcaagtaacc caacaatcgc tgtaaaacga tagttacggc gattatcgcc
    91561 gagattagat attcccccgt ttcatctgtt tccttttcca aaaaggcatt ttcccgagac
    91621 attacctcat tcattagctc tgtaaatgac gtcctggcta caatatacgc tctcacaata
    91681 gtcataccca aaggagtgcc tttaggtccg taaaaagatg cttccagtcc ccccaaacat
    91741 gccccttctg catgcagcag atctatgcta tgcattggca gatgttggct agaagtgtta
    91801 tttctgagcc atgcatataa tccgttattc ttattgcgat ggagcagctg gcccaacgca
    91861 gcgtataaaa agtgtgaggc caaagtggcc actacgcata tcattgtaac gcaagctgat
    91921 aaaattcgaa gttcttccac cgttaaagag gcggaatgag acgatattct agcaagtaaa
    91981 acacattccg cctgaagcat agctgaaatg gcatatcgta caacggctct ggacttctgc
    92041 tctagtatac accgcaactc cggccagtat gcaatggcgc cgtaacaagc ccgcaggaca
    92101 gaagccgcgg gacctcgtgg cgcgtgaatc acatcggcct cgaatatttc agcgtcacct
    92161 tctggaacga attgcaaaga tgatactaat ttaatattac cgtacctagc cataccgtcg
    92221 cggtgcacat tggcggctat tttcatccca acatttatca aaaacattac agcttttaca
    92281 ttagtcaaat cgtatgaatt catgatggaa tttcttaaag agtccctact taggcacaaa
    92341 ataagagccc gtgcctgctt ggctgttctt ttccacgcaa ttgccgattt ggggggtgca
    92401 ctagtataca tttttccttc atcgtaatcc ggcctgtcgg cagaatgcca aagggttcca
    92461 ttacccaaaa ttttccctcg gttgtgcaat aattcatctt ctctcatagc gtccgaaaag
    92521 gatatgggct ccaacaatct gagtagccga atatgtatga agtcgaccat gggacttggg
    92581 gacttgacaa atggaagttt tcgttgtgta cctttgatgt taactccttt gacttttctg
    92641 ataaaaccgc gattttgtga ctcgcttgat aatgggggat gatctcgaga atctacaaag
    92701 atcatcgatg ttgaatttaa ccgattgggg tattcctcat ttaatgagtt gctagtagat
    92761 ctgtgattat ctcgatcgtt ttgcgattca tcgtattctg ggtctgacga tgtgtattcc
    92821 gaatcgccgt cgtgtcgtaa atttgtagac gcgtccccat agcctcctgc tctaggcccc
    92881 ctccttcgag aggacctccg accccgcctt cgaacccggc ccgatctagc cgcgtacgta
    92941 taatcgccac ttgtgttcga accaccatga aaacgataag accgtttacg actactacga
    93001 tcggtggatc gtccagatcc gctatgtctg tgtctggacc gcatgtgata gtgagtatgt
    93061 gcactagcgt gtcgcgtgcg cgatcgagac gatggacgcc gtctcgatcg cgcacgcgac
    93121 ctagatgccg catcattcat atgcaaccca ccatcatgat actcagccgt tggttgcgat
    93181 cgcctattag agaacgtatc tcgtagatag cctatgaagc ttttcctttt taaaccggat
    93241 atgtcatttc gcgtcttagg gtcgtccagt gtgacatatg tgtgagaaga gttgagaaac
    93301 ctccgggacc caccagttac atagtgatgt ttgtcaacat tgtagtccat attcgacgag
    93361 gccccaacgt gttcgctagc caagttataa acacctcgcg ataaacggcg tcctgatttg
    93421 cttcgatgcg aaaaatggct tcgtataggc tccccgctcc gtcggtaatc ttgatcagaa
    93481 tatccgtaac ggaacttaga ggacatgacc gttgtggttc ctcgtggaaa ttgtaaccgc
    93541 caaccgcaga cttgccacgt ccgttcattt tataaagagc gtgtctaatg gtggaagcgt
    93601 ggcactggcc gaaatgatat attgcgtata gagcgcgaca aacgaattag atgcgaatgt
    93661 gaagatcatt tttattagat gtaacatatg cctacaccaa tagtactaaa caagcacacc
    93721 catcccatat gcttctctcg ttatacagta gtcagcatga gaggcgggac gggatcgccg
    93781 ggtaatatag aatcgggatc tgaagcatcc accaacaata cttccaccgt cgttccatag
    93841 ttaacaggta catgtgtcag gcggacatac gtatgatcag acagtccaga tagttgcggt
    93901 acgcttggat gaatattaga atatagttcc attttggctc gtatgttatg gaacaaatag
    93961 ccagacgaac ggggcgcggt agctgtaaat gtgggtggaa acactacagg cgattccaac
    94021 tcttccaaca attcgcaacg aattaaagga agaccaagtt cggatcgtat gtaattgcta
    94081 gatcccaatt ctaaagaagt caaagcacga ccctctatca ttggtacccc atgattataa
    94141 atcattggct gaaaaataca ccaaaactgt ctcccctggc cccactcgca tcgcaagtag
    94201 acaaacaagt cctgatgcga cgtttgcatg gcttcgagac gctgtgatac atctctggtc
    94261 gtagataaat aaaggtgtaa atataaaagt ttggcaattc ggacggcatc gcggtaataa
    94321 ttattggata tgtaccaccg ggctttgttc tgtacataat catcagaaac tcgaaccccc
    94381 cgcgactcat tgaggacgga ttttataata tgcattatca aagcgcgaca ataaccaaaa
    94441 aacaatttag cgtatatttg ctctctggcc tccagttcct ctaaatagaa ttcctgaacg
    94501 gcagtcacgt aagccggtaa atcatcctta gatgcaggaa cgggtgggat agacgatttt
    94561 ccatgttcat ttaaattaag tgcggtatat tgccatgtat tttcatatac ggcatccaat
    94621 acctcccgag gacatgtaga caggattttg gcatgcttgt ataaatgcga attgagcggt
    94681 aaacatgaaa aaagatcgac atttactctt tccaatttgg ccaataatga agggccctct
    94741 gcaaaatcca gttcaaggat aagtcggtca taaagtaaat ttggggaggc ggcctcggga
    94801 gatgggagag atagcttttc agagaagggg gcaattatgg gcgttgtata atcaattgcc
    94861 tcgccgccaa acgcaggggg tattgcatcg ttaaagttct cggtactttc tcttgcgact
    94921 ggatcagcga agcatctcat tgcattggcg tatgcttcga tttcggaaaa tagttgttta
    94981 ggactataaa agttattcga gatgctcatt gtttactgtt aaaggctcca gggaaactga
    95041 attagagcct agagtacgtt gacgttagaa tggtctactt ggggtttcta cagtgctacc
    95101 ctcgaaaaat actactcact atcgctggtt cgttctccag gagaatcggc gaaggattgt
    95161 gccgacgaga caagtctagc tatggcaatg gggcggcgag ctcccgaatt aaatgaaccc
    95221 tcgccacttt cgacatcacg ctccgatcta ccacttctgg atttcggttt attgtctgca
    95281 cttcccaaac cagtttcttc catgaatctt tgggtacagg attcagcttc ctccaataaa
    95341 tatggccctt cacgaaccgt tacctttact acagctctga ctagaaagtc ctccagctgt
    95401 tcgtctgtcc tcggcggttc tttattccac agggcaagcg cgcctctgaa tgcatgataa
    95461 cgagcaactg ctgcaaccgc gcaacaaaac acatgttggt taaaagctac agtattagat
    95521 ttccaatgac tggtacgcga tgtcggtgcg ctactgaaca tgaacttatt tttttgcacc
    95581 gcccgaaccc ccgggcgagc tcgttgtcct agggggatag aggaactctt agaagtgtta
    95641 gccggctcga cttctttgac agatttgcgt ctttgtagag accgatgatc ggaagggcct
    95701 ggacgttctt ctggaggaga gctttctgca tgatgtgctg attgcctgcg tgtagaacga
    95761 ggcagttcag ccctcggggg gcttcgtgca tgacgattcg acgtcaccct agaagcgtgg
    95821 agatagtcgt ctcgtggggg gctttgcaaa gaacgtgtag actttctacg ggtggtacca
    95881 tccgtaccac ccgtaccatc ttggtgacta tgatacacgg atggacggcg ccgttcgtat
    95941 ttgcgccctt cgctgtctcc catatccagt tactcttgca agtgtgtatc gctgtatctc
    96001 ccctccccag gctttccagt ctatgatgag ctcgcctggc cgtcaccgca ctatagagtc
    96061 taaaactgaa gtccacgccc attatgacta ccactcctcc cgaaacatgt ccgcggtgaa
    96121 taaccgaaaa catgcggaat atgagccgac aagaagggcg gagattgcgg ctgccagacc
    96181 tagataaaac aagaccgaga aacccgagga aaacgctatc gaaacgccta ctgcggaaca
    96241 cgtagaatcc cagaaatctg cgccggctat agaacgctcg ccgtcgactg ctagaaccac
    96301 gtggacgcac actatccaga tcacatagac agaccagctg gggcttatat gatggacacc
    96361 aacggagccc atctccgaat cgaaaccgaa cccgaacccg caccttcgca cacaacgcga
    96421 gttccttgga gattgaaata ccgggtcgat gaaacgttat atacccttga ccatgaacgt
    96481 tggacctgtt atatagaaga tcgggatcgc cgctgtctac gcgttattaa caaccaagtg
    96541 atatcgctat gtaaatctga taaaagagag aaataccaga tatgtgtcct tgacctggga
    96601 ttaagagttg cagttcctca agagtacgct gtcgtattag cgaaattggc agatccggat
    96661 ccgacgtctc gaggtattcc cgtaatcgga gtcgccaacg gagtgatcga ctcgggatat
    96721 agagggacaa taaaggcaat cctgttttac gaaaagtcat gcgtcatccc taaaaatgga
    96781 ctagcaattc gtttgtcgct agtaaaactc gtttctccta acatggattc cagaatattg
    96841 tttgacctct ccgctatcac gacccattta gaatgcggcc cctcattttc gagctccatt
    96901 gcaaccgccg cccgatcggg agcctccgaa ttggtaccaa taatacccgc aagcgctaat
    96961 ggcatatgga acggtactgg atgtagaaca cttgtgtgtc tatatgatag cagagcttcc
    97021 aatgcttcac actttacatc atccgataaa aacgttgcat ttgcagttcg gtataacgat
    97081 gaatccgtag tcatgggcct gaaagacata cccaaaccgg acacccaaac atttgtgcga
    97141 ttctacacct ctggcacgtt tggcacagtc ataccattcg atgagacatt cacgcccaag
    97201 cgctcagaag acgcgggata tgatatcccg gcacccaggg acatcttact gggaccgtta
    97261 tcatctacag cgattgtaat ccagcagcgt tacacatgtc tggatgcatc aacaatccct
    97321 tgcatttttg ggcgctcatc tcttaatatg cgaggtgtga tcgtttaccc cagcaagtgg
    97381 tcggctaatt catggctaat cttaacacta tgtaatacca caacatacga aatcaaaata
    97441 aaaagtgggg agcgcattgc ccagttgttg ttggttgatc aggattgtgc gaccctcttg
    97501 ccatcagaaa ataatacgac caacgcgttt cctacagtag gtaaatgtaa acgccctatc
    97561 tcgttaagcg gtgaacctaa ctggagagaa actactatgt ttgacaaaga agccccacct
    97621 agccagcgcc agcatgcagg gtttggctct acgggttatt agttcattgt ttggacaaca
    97681 accatgtacg ttatcataat aaacagtaat gaatcattac atgtaacgtt tctttatttg
    97741 agcggtcaca aatcagaagc caagctgttt actgtcagta gctttcccgc cttcctcgcc
    97801 tcacccctta aaacgcgtga tgtcgggtct gtagggcgct ctttaccgac cgtggtgggg
    97861 ggtatgttat tttccggtat cacctcatcg accaccgcaa tcgcacatcc atgaacagca
    97921 tcgctgtttt gagaatcagc aagtgaattc ccatcgacga tcttgtctga atcgtagtct
    97981 atagacgtac aacgatcatc tcgatcatgt cttaatccca atgctttctc cactaacgct
    98041 atatcactca ttgcagtttc agtggcggcc gtcagttgta ttgcatgctc cacaaacgca
    98101 tcggtctgcc ccgcatcaac agacatatac atatgcagta gtgcggcggc acatgtatcg
    98161 gcgaccctct gggcattttc ccggtgggtg gccacaactg catccaatcc tggatttccg
    98221 ttacctggaa catgttgcga taagcaatcc agattacgaa gacattgaga atatgtccta
    98281 gccaaggatt gtccccgcac caacttcctt attccgtcag cagatagtac cgccatctcc
    98341 agagtgatgg gcgtgggtag cattatatta accgtctgca ccgcctctct gattcggtgc
    98401 aaggctctat gagctgtgga atgttcagat aggtgcctgt actctgggtc gcgttttctg
    98461 gtgcacatga tggatcaaag ccttaagtct gtagacgttt cgtcggaaag tgtgagctcc
    98521 tcaatcaagg tcctgtttgc agtcgacggc tgcgctgtat cgttcacctt gggccttctc
    98581 accggtcaga tatcgtctac aaacatggtt tatataatcg cgtactggga ccctgacgat
    98641 gttctgtcgc aaaacacatt ccttgcggaa gtcgagaaca attctgagcc cagatccacc
    98701 ggcagcttaa ctttacaagc gaatacagag agtctaagaa ttgaattctg ccttctaaac
    98761 cagatgacat cgtgtatggg cggggcggac atgaaattac gaacgcgccc tatattcatt
    98821 tgtaggttca agtctaaatc agagattggc gcaatattaa gttctataac ccacggcctt
    98881 ccaattcaag cggatttgtt agcatcaact gtgtgcgaag aggatacttt tatgttgcat
    98941 gacgatttca acctcgcact ccacatttcg ctcagtaatt tggcgcgaag cgggaggaat
    99001 cataaacacg ccaataaaat tatgagtaaa gacacggtat tatccctatc gcaatcattt
    99061 cgtggaggga agcgcggtct gaccgcgctt tatcttcagc atgaacagaa agttacagca
    99121 gcatatcggc ggatatacgg cgggtcgacc acgaccgcat tctggtacgt gtcgaagttt
    99181 ggtcctgatg aaaaaagtct agtactggca ctacgttatt acttgttgca ggcacaggat
    99241 gacatctctg gagccgccac tgattacgat ctccaggcca taaaggatgt atgtaggaca
    99301 tatgacatac ctacgaagcc caaccccaca cacttttcaa cggcagattt aacatcgttt
    99361 gcaagactat cacgattttg ctgttcgagc gattatgcgc gcggggctat tgccagagca
    99421 ttcccaacgt acgtggaaca ccgaatcata gctgacgtgt cggaggttga tgctctgagg
    99481 gaatatattg agagagaccg ccccagttta aaaatttccg acctagagtt tgttagatac
    99541 atatacttag catattttga atgctataac agaaaacaac taaaacgcca tctggaagat
    99601 gtaacagtaa agtctccata cgaatccatt taccaaaaat cctcactggg taggcgtgca
    99661 gtagagaact tttttacaca cgtaagatct aggttgtctg tacacgatca tataacgaaa
    99721 aatgtttctc cagagcaagt ggaacttgga gaagagctag gcatggcctt tatagatgct
    99781 agaacctatt cgccatgtac aatgaccatg aattcatgtt ttatgggact atgtgaatgt
    99841 gccaccttaa tcacgaagcg tttagacaga ctggaaacga aacttcaaaa gcacggatgg
    99901 ccttgtagcc gatttgatgg tactaacgtt ctgtcagaca attctaatgt tcctcattca
    99961 tcattcgatg acagaactgg tatatgcgat agttttcaag aaccagctct tgctaccaga
   100021 ggcgggccaa tgatagtgaa acgtctgttg gccatggtat catcagatgg gtggtctggt
   100081 aatgtgggac cgatcagtat gctaatggga ttaaacgtat ctgaaagtgg acctttaccc
   100141 gtttaccgcg tgagcatggc aaaaggaaaa caagcttttg ttactcttgc tgcagaatgt
   100201 tgggaaaggg taattccacc tataggaact attagagatc gtttatctcg acttaatata
   100261 gccggcatgc caacggatga tttactctct cgcgataggt ttatgaacgt tgaaatggaa
   100321 cgaatactcg ggctcgttgg tacagaaatg ccttacatag catgtggtcc cgcagaagaa
   100381 caaagataca taaaccgaaa tgaagttttc aatgaaaatc ttgtagtgtg taatatcgtt
   100441 ttggacgttg atgtacattt aaagcaggca ataccatcgt cgcgcttgca tgccgcattg
   100501 cggggattta gatcgggaac tcttagagca ctttcactgc tcctgcctaa agcaaacttg
   100561 gacctacggt cctatccatg ttacttttat aaaagctctt gtaagaaatc ccaatctgtc
   100621 cgctttgcgc gctggacgca cttaacgtca gaatacacat atgattacga agggtcttgt
   100681 actcaaacct gggacttcga cacggatata agcattgatg atccccttct catagatcaa
   100741 atggacgaat ccgcttcaag atggacatcc gattcggctt taagcgctgc ttctgatgca
   100801 gacattccat gcggctgtca ggataaaata ggcatgcgtg tttgtattcc cgtcccacca
   100861 ccttacctgc tgatagggag tgctacattg gggggcattt ctagaattat tcaacaagct
   100921 gtgctaatgg agcgggactt tgtggaaacc ataggtcctt atttgaagaa ttatgacata
   100981 attgatgtag gagtatatgg tcatggtcgt agtctaagat taccattctt tagcaaaata
   101041 ggggacgatg gtttagtttc tgggagactg atgcccatct acgtattgcc tgatatatgt
   101101 gaaaatccgg acacattcgt cctatcacac ttcgatccac gaacattcca tttccatagc
   101161 cctcgaatga cgagattgcc tgtttcaaca gtcataaaaa atcttggggg agagtatgcg
   101221 atcttttttg aaaaaaagtt aacagtaaac agagatgcgt tttttggagt taaaagatcc
   101281 ctgtcggcca ctctccgaga acggggcata gatgtcaata gcgaggactc tataatagct
   101341 ttcgtgaccg attttatttt agaagatata tctaggtata tgaacgagca catgcccgaa
   101401 tgtgctgtcg agtaccgcaa tatgggcata tccggctgcg ttgttagaac agacagaatt
   101461 cttatccatt taatacccaa tacaacagca tcacgcgggc gcgggtttac gtgcatgcga
   101521 tataagcata caagatcgag tcgtacaagc gctcgctcat atttagcgtt gaacgttgat
   101581 gcacatggta gactgtgtgt ctgtgtcatt caacagtgct ttgcgacgaa gtgtgggaat
   101641 aataaattgc gcacgctttt taccgtggac gtcgattcga aatgtcgtac agaccaacaa
   101701 taggagtgat tgcaatcatt atttccatgt gtatgtacat gaccgtgttg attatgcacc
   101761 tgtcaaggct cactaaaggt ggtggggact gcatctacgc aattagtact ggtggaaaac
   101821 tctcaacgga aaactttact tgggaacgat ataattctac tttgatttac acgccattgc
   101881 aggggaagtt tctaatggac ggtgaaaatt tggatgatac atgtcgctct catttggtca
   101941 attccagcgc tgtcaacaaa ctctccgaat atgtccttat cgacaccaaa gtccgatttg
   102001 taaaagaagc tcgcaactgt gtcgcatata tttggaaata tcgaattcgt ccattgtgct
   102061 ttgcgttagc gctatatgtg atagctttta atgttcgcaa gtggcgatgt atgtttggtg
   102121 tggttagaaa tgaccgagat agcatttcag ccataatgta taccaaaaat tacgccagtc
   102181 gtgtaatttc caacctgtgg cttaaaacga catactgcaa aatatataaa ctaatgcacg
   102241 agataaattt cttcaaaaag gcactgagtc gtgcatttaa agaagatccc attactttca
   102301 ccttttccca caaggtggct gcttgcctca ttattctaga atgtatgata agggtctgtg
   102361 cgcaatgtgt gaccatatcg ataatctcga tattttttgt cccatgtgaa acaattttat
   102421 ctacttgggt cttaattgtt actggcgtat ttgtaggcat cataatttgt attgaattaa
   102481 gtttagtgtg ctctcccagc ccagaagtga gctctagctt taatgtaaat gttaaagaga
   102541 tggccggaca gcttaacgtt gaaacgcgat ggagtgtttg taccatattc tccaattgtt
   102601 gtgcagcggt tgtttccggc atttttctca aagcaatata ttttttgttc atgatcacgg
   102661 caattgttat tatcgtacga tatgaacgtg cactacaaat tgcgttattc ggacgtgcat
   102721 atttgccata accgagtcag gtcgaattgg attggctgga agggtgctaa ccgcatggca
   102781 tgcccgcggg cggaagttta tatatagtgt gtacatgtga tgatccgacc acatggcagc
   102841 atcttttagt ctttgtacat acttgtcgac agactaaaag attccaccat gtctaccgag
   102901 gcgttttcat gcgactctga agatcttatg agcctcttgg attacgactt aataaaggat
   102961 tcatcttccg acgaaagcaa tgaagtcgag ctcgtggaga cttctccgac aagtaaaata
   103021 cccaacaccg aagagctgtt tgccgccccc tgcagtcagg aacgccaaca gacacgtcca
   103081 tcaactgttt cgccagcatc ccgtcctaca aataacagtg gccctctatt cgtcgggcaa
   103141 attcgagaga tggctatgga atccgaacgg cgagccgaac agagtaatag caatggtgcg
   103201 gccttggccc gccagcatgc atgcggaccc cccataggtt ctccaggcaa taatctgcgc
   103261 gtctccggag gtgacgggag tgaatgtgcg cccatacaca aaagacggcg cgcgtttaac
   103321 ctcgtaccac gcacacggtc cttaaaaagg accggcgctc gcgaaagcag tcgatgtaag
   103381 tctcctaagc accatcgcca ccatgatgaa gtatgtcata aacggcgcgc cactggagaa
   103441 cggcatgacc gcaaaaggcg ttgtagagat cgatcccacg aactctcagg cgatcatgtc
   103501 agtcgccata aacagcgacg atcgtctcca ggatctgaac ggttttcttc tcaacgatca
   103561 tcagtatatg aggaactgaa cctgatattt agccgaggga aacgcaggtt aaaaacccta
   103621 tcaagcgatt gcgattttcg cgtatctagt aaaaatagat gggcttcggt actagccttc
   103681 gccgccaact ctgaatatgc ccttcgtgga cctcatataa catggcattg tttgttggat
   103741 gcggggccgg aattaagaag aacattcgaa atacgagcaa aaatttcggc cctggcatgt
   103801 gctgcgcgag aatcggtact tcggggagaa agttttatcg gagctttggg tagtgcagag
   103861 gaaactctat cttggttgaa aatgcatgcg accctgcact tgattctggt taaccacgat
   103921 ccaattttta agacggctgg cgcggtccta gataacctcc gcttaaaact agccccaata
   103981 ttgatgtgta gatataacac agaaaaacga tcgatggaag acatgctacg gcggtcatct
   104041 cccgaagaca tcaccgattc cctaacaatg tgcctgatta tgttatcgcg cattcgtcgt
   104101 accatgcgca ccgcaggaaa taaatatagc tatatgatag atccaatgaa tcgtatgtct
   104161 aattacactc caggcgaatg tatgacaggt atattgcgac atattgacga acatgctaga
   104221 aggtgtcctg atcacatatg taatttgtat atcacatgta cacttatgcc gatgtatgtg
   104281 cacgggcgat atttctattg taattcattt ttttgttagt aaactaccac aggctgtccg
   104341 gaaatctaag ttaatgaata aagtagatgg ttaatactca ttgcttagaa ttggactact
   104401 tttaattctc tttaatgttc gtattaaata aaaacatctt taataaactt cagcctcttc
   104461 gcttattgta gaaattgagt attcaaaatc atgttcaaag ccgtcttcgg agagtgtact
   104521 cgccacggtg gttggaacat cactatgtct acacgtcaaa tttaagcacg tcaggtctgt
   104581 cgaggacaag aaatggttaa ctagtgtttc aattattctt ataaacgtta agcattgtaa
   104641 gccccccggc cgtccgcagc aacaatttac tagtatgccg tgggctccgg gactatcacg
   104701 gatgtccaat tcgcacatgc atataatttt tctagggtct ctcatttcga gaaatcttcg
   104761 gggatccatc agcaatgcgg gctgtagtcc cgattcccgt ttcaaatgaa ggtgctccaa
   104821 cacggtcttc aaagcaaccg gcataccagc aaacacagac tgcaactccc cgctgcaatg
   104881 attggttata aacagtaatc tgtcttctgg aagtatattt cgcccgacaa tccacggcgc
   104941 ccccaaagtt aaaaaccatc catgtgtatt tgcgtcttct ctgttaaaag aatattgact
   105001 ggcattttcc cgttgaccgc cagatatcca aagtacagca cgatgttgca cggacgactt
   105061 tgcagtcacc agccttcctt tccacccccc caccaacaaa atgtttatcg taggacccat
   105121 atccgtaata aggatgggtc tggcagcaac cccataggcg cctcggcgtg gtagttctcg
   105181 aggatacatc caaagaggtt gagtattctc tctacacttc ttgttaaatg gaaagtgcat
   105241 ttgcttgttc ttacaatcgg cccgagtctc gttcacagcg cctcgttcac acttaaacca
   105301 caaatagtct acaggctata tgggagccag actgaaactc acatatgact aatattcggg
   105361 ggtgttagtc acgtgtagcc cattgtgtgc atataacgat gttggacgcg tccttattcg
   105421 cggtgtactt gatactatgg cagcgagcat gggatattca tcctcgtcat cgttaacatc
   105481 tctacgggtt cagaatgttt ggcatgtcgt cgatcctttg cccatcgttg caaattacaa
   105541 gtccgatcgc catgaccgcg ataagcctgt accatgtggc attagggtga catctcgatc
   105601 atacattata agaccaacgt gcgagtcttc caaagacctg cacgccttct tcttcggatt
   105661 gtcaacgggt tcttcagaat ctatgcccat atctggcgtt gagaccattg tgcgtttaat
   105721 gaacaataaa gcggcatgcc atggaaagga gggctgcaga tctccatttt ctcacgccac
   105781 tatcctggac gctgtagacg ataattatac catgaatata gagggggtat gtttccactg
   105841 ccactgtgat gataagtttt ctccagattg ttggatatct gcattttctg ctgccgaaca
   105901 aacttcatcg ctatgcaaag agatgcgtgt gtacacgcgc cgttgagtat acgggaaact
   105961 aaatgttcat agaggtcttt gggctatatg ttattaaata aaataattga ccagtgaaca
   106021 atttgtttaa tgttagttta ttcaatgcat tggttgcaaa tattcattac ttctccaatc
   106081 ccaggtcatt ctttagcgag atgatgttat gacattgctg tgaaaattac tacaggatat
   106141 atttttaaga tgcaggagta acaatgtgca tagtaggcgt agttatcgca gacgtgcaac
   106201 gcttcgcatt tgagttaccg aagtgcccaa cagtgctgcg gttatggttt atgcgcacag
   106261 aatccatgca tgtcctaatt gaaccatccg atttttcttt taatcgcgat cgttgtttgg
   106321 gcaactgcgt tatttcagat ctaaaaaatt taccctttat gaccatcaca tctctctggc
   106381 tcataccccg cttggataag atatcatgta gattccgccc taagaaatgc aaactaacat
   106441 tattgtcggt tccatataca cttccatctt gtccttcgaa aataacaaac tcgcgcaata
   106501 gaccgtccgt acatgcatgg ccgatgtgtg tcaacatcat tggtctgcta gatcccgatg
   106561 ggacgaatcg tacagtcgtc gctccagcat tggcaaaaat ccccagatac cctccatgcg
   106621 gcaaatctaa attgcgaccc cgaagagact gcaccaaagt cttatcgacg cacgctgatt
   106681 tttttgaaca gcgggagccc attatcttca gtggagcgta gacgggcgag gctaattatg
   106741 tgacatagca acactgcatg tatgttttta taaatcaata agagtacata atttattacg
   106801 tatcatttcc gtttgtaata tactgtatac atcatccaca ctattagtca gcactagcgc
   106861 gcgggcgcac gttacaatag cagcgtgccc gttatctata ttgtccgata tttacacata
   106921 acatttcatc gacatgatta aatacctaag tactgcacac agatgtttaa tgtatatcgt
   106981 catataaatt atatcgctag gacagaccca aacgaccttt atcccaaaca gtcagatcct
   107041 cttctcaagt gtcgatttct gttatggaat atgcataccc tggcccagaa attgcacgca
   107101 cgagcgtagt gaatgcgtca ttggttttac atttaaaggc taaatgcaca aattctttag
   107161 acgacagcac atcgttaaat agcatctcta gcgttcttat gaatgctaag cattggagtc
   107221 ctcctggtcg gccacaataa cagctgagta tcataccctg agctccgggg ttgtcgcaca
   107281 tagcggattc gtataaacat aggattttcc gcgaatccat cagttgcaaa aatctgttag
   107341 gctccatcaa caacgctgga tttacttcag atccacgcgt aaagtaatgg tgctcgaata
   107401 ccgtttttag agttgtcggc atttcaagga acaaagaatt catttcttca ttgcaacgac
   107461 gcgccagaaa tcccaagacc tctttgggta gtatgttctt gcctataaaa cacggcgttc
   107521 caagtgccag gaaccacgca tgtgttactg ttggggcgta ttcagaaata aagcggggtt
   107581 tatgcggctt ttgaagctcg gatatccaaa gtatcgcttg ctgatgaacg agcgatgtag
   107641 ctgttacaaa acctcctttc catcctccag tcaacataat atttatcggc ctacctatgt
   107701 ccgtaataag tattggtcgg gcaattattc cgtatgaggt cttgcaggaa taagctctta
   107761 gggacagcca gcttggatat ggtgcgaaac agaccttctc ggcttcagaa tgtcgctccg
   107821 cagtctcttc gtgtcggtgc atcttagatc caccatcaat gtgtgcagca ttgactcccg
   107881 cccgtcgaat attccttttg ttacgatgca gtaatgagca cgatcatggg cggggcgatg
   107941 acgttctatt tgcatgtctg cgaacaattt gcgtcagtca tacagctatg gagtgggcca
   108001 tttctggccg tcaacttaaa aacgcgaacc gcagacatat gtatttgcat gcaaagacgt
   108061 atcttcgtat ttctgggcat cttcaaatgc tctggccaat atggcaatga atttggattc
   108121 gtttgacgcc gatggtatgc agtgcaaatg tgccaatagc ccacatccga aaaagttatt
   108181 tgtcatacaa gcaggtgtta agtagcaatc acataaaggc accagacgcc tcatggcatc
   108241 ataatgaata gctccttctc cccactggaa ccactgacaa aatctgcgag tatattccgc
   108301 aaaccacatt ttatttctca tagaaactac cctaaatcct tttaacggga agaagaatcc
   108361 tagatagtgc ttgaagtcat gactgttact gctgcaataa cactgtatat tatttataaa
   108421 ttccgtttgt ctaggtatct gatgtaggca ttccgatccc tttactattg cgtcttcacg
   108481 accaaatggg aatgcgccaa aatccccaca cctcatcacc ctggaggcag attgtgtatt
   108541 attaatatcc gccgattgaa gcacaaaacg gtacggtact gttcctaatt ctggtataga
   108601 ttctatggtc aaaagtctgc atatccccga cattgccatg agatcacaca gtccaagtag
   108661 catgtttatt gagtcactca gactgtcaac gtccctcgcc gcaccaccaa tcgaaaataa
   108721 agtatctacg caagttatag ctccgcattt tctatcgcta gcagcaatcg cgacgcaaaa
   108781 cataaaggcc atgttgggat ttgaactctc tggggggctt gttatcttct gcaccgtcgc
   108841 agtcgcagtt ttccgaaatt tatgtctaat atattttccg gccgtgctcc aatcggccga
   108901 aaagaatctg cgtattacca gactcattga cgggccgata aagaccataa aacaaaattc
   108961 ctgtgcactc cctcctccag ttttgccatc gtccaagtcc cgtaactttt tttgcgtttc
   109021 gaggagcaag cgttcgttat ccctacccac acttgttttc caccgttttc ttattataag
   109081 cggttgtatc gccaacgcgt caccgcaggt tgtcacatac agtgatggca tacttgaacg
   109141 tgcaacaacg cgctcgcttt gcaaatctaa gtcattgacc atcaaatcgc gttgagagga
   109201 tagccaggca tcttttttcc tagtatggtg acggtgcagc caccccaact cagttcttgt
   109261 aaaaaaagct attggcggga atttatgttc tgaggtgcat tctatattta tgagtccatc
   109321 aaatgccatt aaccagattc gtattttttc gctcgacccg gcatcactat ggatacaata
   109381 cctttctatg gcccatttca gctctcgaac caaccacacg gacaattgac taacataagt
   109441 atgatcttta tcacagtcgc acccatctga gttatattta tggcatccga gcgctcttac
   109501 tgtacggtcg gatacaccca tggtttttcc tttatatagt cgggttatag tctgtcgggt
   109561 ttggcggtag cacggagtag tttgattttt aagaatcgaa aaccggcttg gagagaccac
   109621 tgtcgaatat ttgtccgtat actctacacg tgagtgttgt ccattcctag gtatattcat
   109681 ctgttcggat accttcaatt gctgttcagg cataacctta aagcatatgt tatgttgtac
   109741 atcaaaactt ggtgagttat gttcgattgc cgcgcataaa gaatcgtaca tgagcgtttc
   109801 tgctaacata ctatctatat tctcacacgc ccctgcatat actgttccta ttccaaattc
   109861 acgttttgcc ccatcggcta tctgctccca aaaagttgta atataggtgc cgctgggtgc
   109921 gaaattttca tcagttgtat tcctgataaa ctgaatcact ttacataatt tttgccacat
   109981 atctgcgtgc agccatagta tcgaacccgt gggctcggag acgacagtgc gtacaatggg
   110041 tattttacct ttccccaaca aaataatggt atacaagtta ggtccgtacc tagaccttaa
   110101 tgtttccaat tcttctgaat cactgcactc tcgtagggga gtaacggtaa taatttcgtc
   110161 tctgagcccc gttttgcgtt gaaaactaat cacattagat aatgtgcaat cggtttcttt
   110221 tatccggata catctaagta ttatgacatc ggtggtcatt gtttccatca acgaccatct
   110281 tttacgatcg cccatactac tcatggacgt tgtcggtgtt gaaaaatcac cagaattgca
   110341 acggatctct gggtaccatg ctgctgatgg aattggcggt tttaattgtt gtttcagtct
   110401 attattgcta tctttggcgg ggttgaataa tgtgggggga gagtgattgc aggaatccga
   110461 atgggtcaat aaaacgaccg tgctccgttc tgccggcgcc gatccgattg aagctatata
   110521 cttcgcttct ctccccactt ttccaatttg atccggaaat aaaacggccc cggacaacag
   110581 tatcgtacga tccggatccg gatcctgctt gcctacagaa gaatcaacat ctcgccccaa
   110641 tattctggtc aaaactggct cgctcatggc aacgcggacg tttcccccgg tggccagtct
   110701 taatggttaa tgttcttttc ggcaatctta tacatcagcg ggttgcgtga atactggtca
   110761 cagttcagtc atttactaca caccagcaat acgacgacgg acagtaccgt cccgacgaac
   110821 gcgacgccca aaattgctat cgcgaccgcg tccgaggcga tgtcgtacgg gcggtgcggg
   110881 gttggatcct cggcaaagag atcctcgtaa ttcggcggtg ggagcggagg gtaaagacgc
   110941 gggtggggat ctccctccgg accgcgcgcc gggcgcggtt cgaaaatgct ttccgcctcg
   111001 ctcagtgtca acgccaagta ttcgggcggg ctgggggccg gaatatctcc cgcgacttct
   111061 tctatcggcg cggaattgga gtcgcggtcg tggcgcgctt ctagcgtcgt caacggaagt
   111121 ccattttcgg ggtctcccgg tgggcgttca gcgtccatcg tcgtatatgc tctaacacac
   111181 gtctcgctat attaaaaaaa agaagagtat cggtcagtgt cgagtgtcgc cgacaatgtc
   111241 gcgagttctc ggcgatttaa tttttggaac tgctccctat gaatcccgta actgtagcgc
   111301 ccgcgcagaa agccgccatc agaccaacta cgtgtctgtt cgatgtttgc ccgccgatcg
   111361 ctttaccgat taaggttccg gcgagaaatg acatgctcga tccaagaaca aagtttttcg
   111421 cggtaaacaa caacatagtt accgtgcgag atggagaaac cacatctccc gaattagtag
   111481 aggaaagccc gcgctgtcgg tttggggaca tatcgatctt ttttgtgttt ttcctaggac
   111541 ccttttgcca gatcgtacaa agtcgcgtct tatgagcgga cgttcttact gcagctcggt
   111601 aggagtgggg cagggttaga tttcgtcggc gtttcggccc ccgtatgcgc cgcgccaccc
   111661 tcttcgccga gctctttatg cgcggtgggg gtgagcgctt ccggagttgc gatctccgat
   111721 ctcgagccgc agcccggcgg tgtctctttc agtggagcgt tagcgccatc atgtggttcg
   111781 tggcggtgga aaggctatta tgtgttaggg gagagaccac gtgatcggca tgcaaatgag
   111841 caaggcgaac gcgtcagcgt tcgcactgcg aaccaataat atatatatta tactattggc
   111901 tttaggtgcg aacgtccggc tagtccaata gcggggtcgc gtttcgtacc acgtgttata
   111961 gaccgcccta aactcgcact cgggggtccg gccgcgccca gacagggcgg agacgtgcca
   112021 caggggcttt aaaacaccgc ttcgggcacc gttcatctcg gcgcgccgag cgcgcgctag
   112081 ctgatcgcgc agggatgtcg ggcgcgccgg gatgagcggc cgatcagcgc gcggcgggcc
   112141 gaccggctcg aggataacgg gcccgttcgg acgtttcggt tttctgcgtc atggatcgcg
   112201 gggggacgcc gccgcggacc ggtcaatgtg gcggttcccg acggaggctc ggcggtcttg
   112261 ccgacgaagg ggaggggggc ggatggggtg ccctatctgc aacgcttctc tgctgtccgg
   112321 gttacttttg cgatggtctt tcgggggcgg gggtagcggc ggactgtaaa aactgacaaa
   112381 tgcgccccgg gcccgagtac gcgccgcaac tgaactatgg tcgatctaca gtttattttc
   112441 ccggccctaa tagtgcgggc gaaatgatcg cccgcagctc ggtggttgcc gcgcgggaaa
   112501 tgggaatcgt cggcgatgca attcgcgctg cgaaaaataa atttcactgc gcgaaccgcc
   112561 ggcgatacaa tttgcactgt gaaaattgaa tgtagctgcg cgaaccatca atgggcggag
   112621 gtgtgatatg gtgtgatatg gtgtgatatg aatgcctatg cgggcggtgg cacccgccgt
   112681 cggagtaaca tacaaattgg tgagaggtat gagccggtcc aggtgtgcga gaaatcggca
   112741 tcttccgtct gtagacatga gactcggata ccccgctccg ctcgaatcga gaatcgttat
   112801 gctctcggac ggtacgggcc ttacgtttca cctgcccggg tcgcctcatc tggacccctt
   112861 ttctagcttt tcggcgcggt tggctgccgc cgacggtcag ttgtacaaag aaaatgtgtc
   112921 ccatcgtaac gggtgtgaag ctctcctgtt acgatggggc ggtcattagc gtctcgctgg
   112981 tttactacgt ttaaaaaaaa accttaatta tttattttcg cgccacggcg cctttatagg
   113041 catctacgtg ccaactgccc acgaagcgga ggttatggcg agcctgttca actacgtccg
   113101 caacctttgg gggtgggcgt ggaattttgt ggtcggaatc ggagccctcg ggagacggcg
   113161 caggctacgg aggctacgac atttttttgc acacaaccct tagtggtccg ccttgagaga
   113221 gtggagggtg ggtatgggga tgggggcagt gtatttttgt aataaaaacg tatcgatctt
   113281 cagacagttt tgttgtctcc cttggttgct ggtcgctcgc ccggtacgcc cacaacactt
   113341 ccgggatata ccccgaacac agtcaatccc ggaagtgcgg cggtacatca gctcaagtcc
   113401 ctccccgtca cgtacgcgac caccactgca ctcgcccatt gcgcgaatgt aatacagtgt
   113461 cagctatccc atgggaacga atgtgcgagc acattcgacc cgttgggaaa cgcgaggccg
   113521 gatatgatga gatcgctcta atcgaaactt cgcccacggt cgtctaggac cgcctagcct
   113581 acgtgactcg gtgctggcgc gtctcttccg ggtcctttct gatcgcgccg ggtccgtgtg
   113641 cggacgtttc gcttcgactc tgccggtccg ctggtgccga cgatcgccgg gaccggcact
   113701 ttcgcggcgg acgagctggt aacctctgcg atcgttcggt gatgtgtttt tacagccgcg
   113761 cgtgggtttc gggacggagg tttcctcttt tcctaatccg cgtctttgcc gcgggtctct
   113821 tccggaaatt cacgggtcgt ctacgggggg gggggggggg ggaatttgat gatagccgac
   113881 aaatttgttt gggggggtac tcctttatat taaccggaaa ccatacttcc gggcgattct
   113941 caatcaccgc cccggattgc tatgccggtg tccacattaa tgctgtgagc accgtggcgg
   114001 tgttgcgaaa tgttggattt atcggcaacg ggcaaccggt cccggctact gtccggcctg
   114061 agaccgcccc ggcttagatg caattcgcgt gtatgtgtca tggcgcccgc tacgcctcca
   114121 cacatcctgt ttttttccga aagggggggg cggctcgcca gcgcagcgtt aaaactatat
   114181 agagccgaaa attgcgcgtg ttttaattat aagcgataaa tggcctttga gagattatat
   114241 gagcaaattc aacatctttt ttttcttaca cggcgaggag ccggcggccg aaccttggcg
   114301 cgtgacctag cttgaagaag tctggaaata tcacattgag gtaacgacgg gcgggcatgt
   114361 tagatggcta tctacttgca tttctctccc aacaccgaca ctaatttaaa ttcttgtaat
   114421 tggtacctaa ttatttcgaa tcgaccgtac actatcccga aaatgctgct atctaccccc
   114481 ctctaataat atttagaccg tatacacttc atcgtgatgt tggacagact ttattatatt
   114541 gcagggccgg acatgccccg tgaaatttag ttcgatttat tgccccttct gacattttgc
   114601 agactgaaat tttatcagtt gcaccacatg gggagtaagg tcatgtcccg agatggtcgt
   114661 ctcggcaagg ctttcttgcg tatggttctg ctcgtgcgac ctgtttacac gattttcatt
   114721 aatctacgtg gcttttatta tttccgcagg caatttcgga ccgagattgc ggattgtact
   114781 gccccgaatc ggtatttgcc tatcattttt cctaaagcgt gcccgggtta tgctttagtc
   114841 aaaccggtcc gttgtaggaa ttaggaaagg catctagata gtctctggtt tctcggcagc
   114901 gcggaacaat caacttgaaa aataggattt gatctgatgc ccgagcttct attcattagt
   114961 aatttatgca ggaactgtgt gcaaatgttt ttatacactt ttgtagtctt attatcgttt
   115021 gtaataggaa tttgaaaacc aggtggactt tatacaatcg tgagacgagt gttggaagat
   115081 ggcccttctc gggtctatga cctccgcata acacagaaag cgacgcgcag aggattgtgg
   115141 cgaatactgt tcaacgactg gccgtgttcg ggcatggatc tctcgcgggg tgcgtaggcg
   115201 tgtgtattca ttaacagcta tgtaatccgc aggattcgag tacccggcaa tgagacgccg
   115261 accaagaggg cgagtggtgt aaaaacatag ttggtcgtac cgaggattgt ggcgaataca
   115321 aggacgactg gacagttggg gcatactttc tcatggaccc ccgagttgtg tctattcgtt
   115381 aacagctagg ccgtccatga ggtcgtaggc acccagtaat gattcgctaa ccaaagggat
   115441 gggtagtgta ttgcgacaaa tacaattgga cgagtggcta ggcttgggca cggtccttct
   115501 cgcggatagc gtagatgtct ctattcgtta acagctacat tgtccgcagg gatctagcca
   115561 catggcaatg acacgccaac cgatgggatg ggtgttgtaa aacatagttt tttttgtgct
   115621 gcgggttgcg gctgatacag tgggcgactg gacagtttgg gcatactttc ttatggaccg
   115681 ccgaggtgtg tctattcgtt aacagctagg ccgtccatga ggtcgtaggc acccagtaat
   115741 gattcgctaa ccaaagggat gggtagtgta ttgcgataaa tacaatcgga cgagtggcca
   115801 ggcttgggcg tattttctcc ggtgagcgta gctgcctgta gtcgttagca gctacgttgt
   115861 ccgcgggatt ctagccacct ggcaatgatt cgccaaccgg agggatggat gttgtaaaac
   115921 gtagcttgtc cggtctcgtg tccggtgtat tagggacgtg ctctggattc tgcgctatcc
   115981 gccgctgcta agcagttagt tgtacggaaa tgatgacaga tcagactaat gcacggactc
   116041 attcagcggg caatgtagac tgtgtaccaa gtgacagcta cattgcccgc tgggtttctg
   116101 gctgtctgga aatgcaagag tgtagaccgc ccgcgatttt tgtgccatat gtggagcacg
   116161 ggtctctcgg aacaggcgta ttttttgcgt attttatgaa gcagcaaaga tacgcatggg
   116221 ctgagggaat cgtcctttcg tgtgcccagt gtattggggg cgtgctatgg aatgtagcgg
   116281 ccgttgtacg ggaagagtgc ccgagcgtaa tgcacggagt tattcagcgt acaacataga
   116341 ccgtctgtcg ggcaacagcc acgttgcccg ctgggtttct gggtgcctgg aaaatacaag
   116401 atgatattcc atctgcgatt tcatcgagcc cgggtttggg gtacgaaccc ttcatgtcgg
   116461 gggtgtttgt gtgtttgtgg agcagcataa atagccccga tttgacaggt tcgtgttggc
   116521 gatagctaca gtatggatgg ttgtataaag tttttcgttg aatcggctcc caggtaataa
   116581 ggaagtaata aagcgggcgt gcaagtgtga gcccttcacg tcgggggtgt ttgtgtgttt
   116641 gtgaagcagc ataaacagcc ccgatttgac aggttcgtgc tggctatagc tacagtatgg
   116701 atgcttgtat aaaggtttcc gttgaatcgg ctcccgggta atagggaagt attaagtggg
   116761 catgcagtta tatttcttta ttgtttgtcg caacgcagag aattcgatgc gcgccagcag
   116821 atggactttt tccagtcggg gtttgggtac gagcccatca aaccgggggg gatttcagta
   116881 tgtttgtgaa gcatctgaga tacgcccgat ttgacgaatt cgtgctggct gtagctacag
   116941 tatggatgct tgtatatagt ttttcgttgg atcgtgtccc cggtaatagg aaagtaataa
   117001 aagtgggcgt gcaatgatac ccccttgttg tttgttgcaa tacgaaggac ttgtccggtg
   117061 ccagcaaagc cgaaatacag ggcgtgtgtg aagagaagaa gatttcgcgg agcctgacac
   117121 tggccgaggg aaaacaggtc actggaggtt tcgggatgaa gcgaccgaga tttctcaggt
   117181 tcgtttctcg ccggctctct gatcggccct ctatgtgagc cgacattctt atatttctct
   117241 ctggtcgcaa tgtttttgtt gtgatgatta cccgtgggca cctgacaaag caaaataaac
   117301 accactgaat tgtcacgaag tctccttgtt tgtctgtgcg taccatgcaa tgggaagggg
   117361 gccatcggtt tgtttggggg gagcggtgtg tacttttctg caatgcgcgg ccgggagagt
   117421 cgtggttagg tttagggttt gaaataagac gggtacctgt taaccccggg ggtataaatt
   117481 gagggggggg ttagggttag ggttagggtt agggttaggg ttagggttag ggttagggtt
   117541 agggttaggg ttagggttag ggttagggtt agggttaggg ttagggttag ggttagggtt
   117601 agggttaggg ttagggttag ggttagggtt agggttaggg ttagggttag ggttagggtt
   117661 agggttaggg ttagggttag ggccttaggg ttagggttag ggttagggcc ttagggttag
   117721 ggttagggtt agggccttag ggttagggtt agggttaggg ttagggcctt agggcgttag
   117781 ggttagggcc ttagggttag ggttagggcc ttagggcgtt agggttaggg ccttagggcg
   117841 ttagggttag ggccttaggg cgttagggtt agggttaggg ttagggttag ggttagggtt
   117901 agggttaggg ttagggttag ggttagggtt agggttgggc cttagggtta gggttgggcc
   117961 ttagggttag ggttagggtt agggttaggg ttagggttag ggttagggtt agggccttag
   118021 ggttagggtt agggcgttag ggttagggtt agggccttag ggttagggtt agggccttag
   118081 ggttagggtt agggccttag ggttagggtt agggccttag ggcgttaggg ttagggttag
   118141 ggttagtttt tttttctgca atgcgcggcc gggagagtcg tggttagggt tctttttttt
   118201 ttagcgaagg aaagttccct gtcggccagt attggaggga aagggaaatt gtggtttggg
   118261 cgaagggaaa gttcccctgt cggccaatac tggagtgaaa agggaaattg tggtttcggc
   118321 gaaggagtgt gctctggagg ccagtatagg agtgaataga attttcccat tccgcggaca
   118381 gacccgcagc cggcatggag aaagtgaata tccccccaca gacaaaaggg gactccgctg
   118441 ctctccagga atcatacccg ggcgttcgat tacggtagac ggtataggcc acgatgtgat
   118501 cgaagaaggc atcgcttttg tttccacctg cagcatcggg cctggcttca tcgggttgca
   118561 tatgcgtaag tcgccactct cccaaagaga agccccgctt tcacccgtcc aacatcgccc
   118621 cgcgccaagg taggtaggtt cgtatatccg actgaatgta tcgctttctg taactgttgt
   118681 tatgcttaaa aatttattac ccccgtacat ccccatgaaa aaattaatgc atactgtaaa
   118741 tgtgctgtgc atgttattga aagctgccag gaccagtagc gaccgtggaa ggacatacac
   118801 gatacgttgg gagcgtggtg aacgttactc gagcaagaca gcgtccgata cactttagga
   118861 ttggaattgc cacacgacga tgagaaccgt tatcccgatt ccggctgcag cgacgatgag
   118921 accaagaggg aaggtttgac tcgcctctcc cagcccagga ccaaaacggg cgaagaagcg
   118981 acagaatccg tcctagaaac gtaaaacata ccaatgtcga tctcatactt atggtaggtt
   119041 caagtcacga caggccgcgt gttacacaca acccccattt cactgtgaaa tcccgcattc
   119101 ggttgttctc agaacacaaa atcgtgatgg cccgacagga aaacgaccaa atcaccaatt
   119161 gataattccc taacgcgttg ttctcaacac atcttaggca tgttcgtgct gttatataca
   119221 gcttccacca cagctgccgg catcgctccc ttccgcgtgg attctgaact gttttgacca
   119281 tgggattggg ggcttcccat ccgaatcccg cgccggatgc tacattgcct ataacatgcc
   119341 caactgacag ctagtctgcc ggatctgcat tcccgatact cggccgcacc tgccatgtaa
   119401 acccagatgt gagggtttat gcgtattact catacacttg atttttccgg cagcttgggt
   119461 ggtacgattt tgataaatgc tgcggtgtat cagcgtcgcg gcctggtggc tggcggccag
   119521 ggctaccagc gccgcgcacg gtgctcctcg cttctggcag acaccggcga cccaaacgag
   119581 ccgctcatgc ccgcccgtgc cgtgcttacc catccgccgt gctcccgcaa ccactcgccc
   119641 tgctcttcgg ccaggtacgc ggccagcgct gcggccaagc ggcttggccc ttcctcacag
   119701 ccgttttcgt acagcgccgt tgccagcgag ccgccgagga ctatggtcgc caggcatcga
   119761 ccccagttga agccgcttcc ggagttcaat tcagacacca cactttgcag cgccgacaac
   119821 gctgcctgcg tgccgccgct cgctaacggc gcgcaggagc gaaagaaggg cctctctcgc
   119881 cgctccagct cggccgccgc tcgccgcagc tctgccgccg taggactcgg cggcggccct
   119941 tccttgccgc agcagtgctg gaagtaatcc tccagcagca acgccgtttc ttccttcagg
   120001 gagtcagcca tggctacgcc cgattagttc cgccaccaca accccccccc ccgccatccg
   120061 gtcccggtgt gttccgggac ctgtcgttgt ggcgcagcgc gccgtggaca ggtttagcgc
   120121 tttttctcgc cgcgccgtca cttcgcggtc ttatcacgct ttagaccaca gggcgaacgc
   120181 agtttgtatt tattagttgc gcgcgaccga gtggcctttg ggatgtgata cgcctcgcta
   120241 cgaatgagga gacatggcca ggcagaaaat agagacatcc tgccgcattg aaccccatat
   120301 gttcgtcata gaccagcggc gtacacactg cacgcacgta tgattgggtg gataaacctt
   120361 tttgcttgga aattttaaag acgccgctac atgtttacgt gttgcgtctg cccttaatgc
   120421 gcagacgcgc tactctggag gatgcggaac taccgtcttt acggatccgg atgtctacgc
   120481 gctataacaa ctatactgcg catgcgccct actctggagg atgcggaagc cgcgtttccc
   120541 gcttctttct cagttcctga tctccgccgc ggattagtct tgcaataaat accacttctt
   120601 gtgcaaggac aaagaactgc atatataaag ttacattatt ctatgcgttt cgagtgattt
   120661 atccggtagg taagttgtct tatttacgat tctgtcgcat cacatttacg acccgcgagc
   120721 ataaaacgct aatgccttta ttgattcatt cttagtacac tctaaataat cacccgccgg
   120781 aaaattcggc tggtggtgcg acgcagatta gcgggggcct gaggcacggg agtgcagatg
   120841 gtgccgcgtt cgcgtggatg ggggatatcc tccttttcgg gcggtggtcc gcgagcagac
   120901 ggactgtcac gacatgcccc cagaccgttc gcgataggag cgccttcgga cgtaggcaaa
   120961 ataagcggtt ctcggcaagg ctcagtcatc atgtttcgag gcgctcccgc aaatacacag
   121021 ccgggtcggc gggaacactc ccttacaagg gccacggatg gttcgatttc gacactgggg
   121081 taacggatgt gtggcaaaag tacgcgcgca caccgtgcgc gctgcggacg ggtaagttgt
   121141 cattcaatcg tcgtcctcca ccgcacaagg ggacgctgcg gggcgtataa ttaccagccg
   121201 actatcatta tctttctgca ggattgtagc ggaatgccac tcggaggtcg accacccaat
   121261 agacctgcgc ccaacgtgag caacagtaag ctccgccata gtttcggacg ttccctcggg
   121321 aacgttgatc accacggggg tgccatgggg atccgggggg agtaccgtgt tcccgcacat
   121381 gtatcgcacc accttcgaga tcagcgaggg ggatgcgatt gcacgacggc ccgcctctgt
   121441 taggtaaatt ggtaagaggg gggcgcctag accccatctt cgagcggcgc gatgcgagtg
   121501 tgcttcccct cccaagaagt ctggttgcga gaacggatcg tgttcgttgg gctgggcgga
   121561 tgcttgccta gtggcggcgc aatagaacac cgccgaggta ggcacgggca tatcatcccc
   121621 caggtgcgta tctacgacgt atcgcacatt ggcgctgcag cagagtttcg gttgcgggca
   121681 ggagaactct gccgtgcact gtagcgcaac ctcagttagc aacacaggtc ccaaaacttc
   121741 tttagacgtc ataacggctg tatcgaggcc gggtgcatcg ggccacctga ggcagcactg
   121801 gttaagcggg tcaatccaac accggtaata tcgtacagcc tcggatataa actgcggccc
   121861 cccctgcggg cgcgaatttt cgtcaacggt gtccacgact attagcttat ggtgcctctc
   121921 tatgtttaga tgctgcagat actctagcgc accaacccat ccccagtcac ctacggacag
   121981 gaacagaaca ccggcctggg ttagcgggga aatatcgggt gctgctttcc acctgcccgc
   122041 ccacgcagca ctggaaggta aacacaaacg atttgacatt gccgccaata agaaagataa
   122101 tcctcccttg gttgtttcga aacggggcca cccataagcc gcatcggggg taggcacgca
   122161 gaacaaatgc tcccccttga gcgctttata caggacgaca atttttacat cctcgggaga
   122221 atgttgttgg tgatgcatcc acgcagtatg tctctttaaa gtttccaagc tgggttctgc
   122281 gttgcccccc cctacagtcg aggttgctct aggtgggacc tcgtttgcca cagcggctat
   122341 ttctgccagg cattctggag cgtagagcat ggcggggcgc caagggccgg gtattttagc
   122401 aaaatccatc agtgccgcgg cggctgcggg agggcagtac gctcggatat cagtcgggag
   122461 ggtcgtttct ggcacaagtc tccctactgg acatcgcctg cccccagaat cctccggaag
   122521 gttacctaac gggcgtaggg aaccgttcag tattgattcg cgtgtggggt agggttgatg
   122581 acatggtttc ttgcatgggg atgggacaac ttccagcttg gcgatctggg cggaggatcg
   122641 cggggcaatt tctccccggc gacccgcacg gatatcgcgg accagtacaa ttggctgcat
   122701 atgccccgcc gtgagggggc tgcctgacga ggcgggcgct gatttacgct tcctagacgc
   122761 agcctcccca ggcgtttgct gcggtggatg cggagacggc ccgtccgatt cgcgccgttc
   122821 tcgggcgcga actggtggac actgggggta tgatggggag tccccgatgg aggcaaatgt
   122881 ttgggcagtt tttccagatc ggcccgtaat gtgggtggca ctttttgctc ccgaggatgt
   122941 aacgagagtc ccggcacgcc ttttgggggc agtttccacg ggatcgctgg cggatgttcc
   123001 atgtgcgagg gtcgattcga ccatgcatcc tgggccagat ggtgtaggag cacgcttatg
   123061 cgctgttcga gactgtccgt ggttatctgg gcggggtcgc ctagggcgtc ccgggccacg
   123121 gaaaagctgc tcgggtttag gtggtggcaa gaatacaccg gggggtagtt tccgcgcgcc
   123181 cgcccccctt ttaggactta gccactcggc cacgcggcgg aggcgtttgg ccttacataa
   123241 cgcagggtct gcgggttcta cagtggcgtg atcctctagc aaaatgttag tgaaatcacg
   123301 ggagctcatg cgagcccact gttccgcgct atgtccgaca agcggtccga ccgttccgct
   123361 actagcgaca cggcgtgccg cggcggtacg ggtttcgagt ccttggtcac cggctgttcc
   123421 catattcgac aggtagatgg cgcgctcgag ccgtttcagg tcgttgcacc aagaaactag
   123481 tagcccgcgg cacttttccc actggcaagc ggcgaggcgg gctcgtcggg gtcggggctc
   123541 gcatgcggat agcattttag cgatcttgtg aaagccgtct ggcccggaca tcaaagccgc
   123601 tattacccga tcgcaggcca ggacgcaagc gtctgccaga tcggccaaag gtattcccga
   123661 gcagccgccg gcagccgctc cggggcctac ggggagggta aaatcggggg cgtctatgga
   123721 gccgcttttc acggcgcgtt ctatgccctt gaccccttcc agcacgcgag cgtagacagt
   123781 aaaggcgtca tccgcggggc cacgcctaga ggccccagcc gatggagatc cgtcggagga
   123841 tgtctctcct cccgtctccg gtcgtgtgcc cgactgtaac atgcccgcgt atgccgttct
   123901 cagagaacgg agaatgaacg ccttctgcgc ggtgtcgtat ctacgtgtca tggcaacggt
   123961 tgcggccgca tggggcagac cccaaagcag attgtctgtc tgcatggccg atgctatatg
   124021 ggggacgcat ttgtgaacgg ccccagtcac agcggatgcc gacacgcggg gtgctgcctg
   124081 gaactttttg ttcattaaac agtcgagagc actttcggcg ctcgtcagtc ttgcgtgatg
   124141 tagccaagtc atgatagcct tttcgcgagt gtacagaaaa tcgataagag cctcatattg
   124201 cttttggggg ttccccattt cttccacgta aactggaacg gggccgggag acgcctcaaa
   124261 tcgttcgatg gcgtccaata cttcgggggc attgtaaagg ccgggtcggt gaccgccgac
   124321 cccaccgaac caacaggaac cgcggggggg gtcgggaact tctatcagtg gttcgctact
   124381 ccggggccga gttgcagcgc atgatggtcc cggggtcggc gagcctgagg gggataggtt
   124441 cttctcactc ggacataaac gtgccgcacg gcctctggca gacccgtggg gacgggaatt
   124501 cctgttgtct tgcaggccgg atcgatggcg ccgctcagag ccggatgtag cggaagaatc
   124561 ggatgtgcca gatgacgaag atcgcgacga tggggaaacg gacggagacg aggaacgggt
   124621 tgccgatgat gaacgcgacg atgacgagga tgaggacgag gacgaggacg atgttgacga
   124681 cgtggccgac ggagaccggg aaaatgatgc agaggacgta gacgatgtac ccggtggacg
   124741 tgtacgacgc aagggacgac cgcgggccct tcgtggcgaa ggtgagcagg gggggcttat
   124801 gtgaaacccg cattgtctgg aactctcacc cgagctggat ggtttttcca aacccgatgg
   124861 gtgaggcggg ctttcgttgc gcgagtgggt cggtctattg tcacagtagc catcgtatcg
   124921 ttctccgcca ctatgtggcg aggatggaga tccgccacta ccgtttatgc ccccggagtt
   124981 ctcagccggg aggggtgtcg caggggagag aatccaatct ggcttgggga gtgctgggaa
   125041 catgggtgtg tcacagtctt ccatctcagg gtcgtttctc atatcttcaa agcagcgacg
   125101 tgacgcagct tctataacgg cccgccattt ctcgatcgct gcgtagagtg gtcttatgcg
   125161 cttttcgatg gccgggccat atgctgggaa gcccaattct agcatggcca tcgcgagctg
   125221 ttgaaccatg aacccattgg cattgtcggc ggtctcctcg aattcggacc caccctgcag
   125281 tatgtcttca caatgatcct ttatgttttg cagagcacaa ccggcttcgt ggactgcggc
   125341 cgagaggacg ggggggattg tctcctctgg tacaggtatc tcgtaaggca gttcgacgcc
   125401 cggtcgagcg gaaccggcgg gaaggaaatg tcccggagcc atgactaagc ccttccgtac
   125461 ttggtaaaac agataacgat agtgcagttt cttgaaatct tccaggtacg accgtccagg
   125521 ggaaatggaa ccccgtttac cttcaatcca cgtaatagac gagaggtgag gagcattgtt
   125581 attgtgataa aagcctccac actgctctcc ttccgcggaa tttgcaggac tgtctccaac
   125641 tggaatccca ttccagtctt cgtcgagcgg ggttcctacg ccaggcgggg gagcgcatgc
   125701 cgggaagcag ggtatgtccc gtgcagattg tagctggctg gaaaaatctc gtgtgagcac
   125761 atggcacatg tactgcatgc gcctcacaca ccgcaggcag tctaagcagc ggtacgagag
   125821 gcgggggatg gcagacacca ccccgggtgg tattcgaagt cctaggaaac ggagaagtgc
   125881 agagagcgca aaagcgtact tcggaatggg ggatgatgtt ggacagagct gttcaatcgc
   125941 ttgcatgatg gatgtcggca aatcaattgt cccaggccgg ggtagagggc attcgttttc
   126001 aggaccccat ccacaatcta gagatcctaa cccgctttcc aattcctgat atgcagcatt
   126061 gtccatagcc tccaggactg cacgagagcc ttttgtaaac agccaaattt tgcacgaggg
   126121 ccaggttacc acctgcttgt ggccgtgttg gctaaatggg ggggatgaat tggaggaagt
   126181 acttgcaccc ccttggtaat caaacgggat gtaattgtca tctgtcagtg gtgcttcttt
   126241 ttgcagaccc tttccccgtg attggtgtga tatctcacgt atcacggcct cggcggccag
   126301 ctgatcccaa aacgacggac atcgtttgat gtcggaaagc gtcagcagga atgcacagac
   126361 atcatgctgc ccagctcgca caaggtcgct gtaggcccgt acttcttccc ccgcttccag
   126421 gagcttcgac caaagttgtg cgtgacttcc cggcagctgt gttatcatag ccagctgttc
   126481 atgtggagga gttagcgctt ctacggacat ggccagttgc cgcacataaa caaagctggc
   126541 tcccgccgtc tgagagggcg agaattccga catgcggcca gatctaggtt gagcatcatc
   126601 cactccatgc cgaaaggggg agttgcgggc atgtgatgtg ggaggcaggc gtgtcggttg
   126661 tgtggagatg gggaccggtg aagagagggg tgctgaaaca ctatggacgg aggcagggct
   126721 gatgggggaa aataccatag attcgagagg ttcaggtgtg ggcgactcga cgggtggatt
   126781 tggcaggggc gtatcgatca tctcggtgca agagtttgga gactccccac cggcggcttg
   126841 ggtgccgtga tgttgatcaa acctgaacca atagctgtcg ggggatgccc taagcgcttc
   126901 gctgaccgcg tttcgcgcgg cataaatatg ggattggtag ggggcggggg gttcatagaa
   126961 gcattcaatg tcttcgacgc aggggggacg tggttcgggg ctatcccgct cgtaatagta
   127021 ggctttgtac ccggcgtctt tctcgaagat gtacggaggg tcgctcctcc gagagccacg
   127081 tccaaactca atatccagaa accttggtgg cgatgatgcc tcgggccctt cgtcactaga
   127141 ggaattatca tcttcgtcgc tgccgctgcc gctgctggag aagggacggt ctactgaaga
   127201 gtgccaggag ctaactgtgc taacctcatt gtcgtttgag attgtgctgt ataggctgtg
   127261 taggccaaat gggctggggg gcgcgcagga cgtggcactg gacggtgggg aggatgccgg
   127321 ggactctgac cgtccgtccg ggggttcgaa tctcgaacac gcatcctctc ccgcatcatg
   127381 ggtggacgcg gtcccatgat gggagattgg aggtagctgc gggttatgac cggatatggg
   127441 gtcgacggcc gtagataaca gcgaaacaca gggagtttgc agagatacgt cttggtaggg
   127501 atcgccaggg gtcctggggt tttgatggaa gggcccccct tcttcgagag ccgcaagtag
   127561 agaagcaaaa tcgggcgaat tgcaaatgtc gccaccgggg acatggtcat attctgaagg
   127621 ggatgccatc cctgcgggaa atggcaaagg aattagtaac actgcccaat tagacgacaa
   127681 aaatagaaag ggggtctccc ccagcgctag tgtcagtgta ctggaaagtg gaatggcttt
   127741 agaaagctga aagttatgtg attgatcccc agcggggatt gagtaacaac gtgctcgtaa
   127801 ggcccgagct caatgtacgt gggtgagtaa tgagttatga atggagtgat tacagtagat
   127861 ataattctca ggcgtatgcc cgcggcgcta caaatccgag ctcccgcgat aaagcaaacc
   127921 atggcgtata taagactgcg gggcgaggaa tatagcgcct gtcttaatgg tagacacaca
   127981 ttctgatgtt tcaccctcag gaaactgccc cccccccccc acacccgccg ctgcagaaga
   128041 agtgctaacg tggcgataca tctatccagg atgggacggg ggatggggag aggaggcggg
   128101 gcgcatatgc cgcaacccgc ctcctctcac actcgcgcct aggcaagcgc ggaaggcggc
   128161 atgtgagctg cggcgcctgc tgctcctacc ccatctctac acgccgggca tgcctacgaa
   128221 aagcatgttt cagatatgat ctcaataccg ttgcagtttc gatgtattcg gcacagaaag
   128281 ctgcagggcg aacaccgttt tggttatatt tttcttctct ttttcatttt cttttggcaa
   128341 aggacccttg tctatttttt tgccaattct gcgaaactgt taacgctgcg gcgggggggt
   128401 gcttccccac ccccttgtac tgccagtcga cagaacaaag tggagattta cagcggatgc
   128461 cgcttgtggt tagacacccc atccgcccgt ttttgaagaa ttgaatatta catagcgatg
   128521 cgcgatgggg gggggagaac cctcgcaatg tgttgtggct agcagatgta aaggcctggt
   128581 gaggcgagtg tctagattac aggagactaa tatagtcggt aacctgtcac ttcactccaa
   128641 caggatcagt cagcgaacgg catgtgagaa gccgactcat gttatgcgtg accgcagcgc
   128701 gcaaggtaac aaatcccccc cccccccgcg gtgttatgat gggggaactt gtggaggtca
   128761 tcaatgacca ctctttcacg tgagttcttg aggcaagtat gtttccccat ctttctccac
   128821 ggccataggt aacgcgcccc ccataattac aaaacctacc gtcgctagac acccttcaga
   128881 tgttctccgc agcctacgta tattgcgtcc actccaatgc ccgtttcgga ggatctcgca
   128941 tatatgcgag atctactgtc gtcccccgat gccgatctcg cacacagagg ctgttcgtga
   129001 tagaacggac ggtgacttcc agaaaaaaaa tgtccagggg acctcgcgat tgtgggaaga
   129061 ccgcttatat acacactcga cggggtttgt tttggcacgt caagtaaggg cgggccgtgg
   129121 acatatctga gatacgggcg ggggttgggg tctgtgttta ttttttaaca agacaaattg
   129181 ccgaaccgtg atagcaactg gcagccaatg agaatctgcc ggtggttaag ctaacactgg
   129241 ggatgtggtt cgctcagctg ttactgttcc ctgacagctt agtatattct actatgacaa
   129301 ttgcaggcga atgctgtgtc tgataaaagt aagagggggt gggaaagatg gcagaccagg
   129361 ggtctaaaac atcgaggagc cgttgcgacg gcttagtatc ttcaatgaca atcgccttcg
   129421 tatgctgtgt ccggtgaaaa taagagaggg taggaaacag cagaccgagg gttaaaaacc
   129481 ttgaacagcc gttgtggaat gcgtgcattc cttgcattgc gctgatcggt catgacccaa
   129541 gtattgccca tgggctctct tctagaaacg aaaatggtgc tcgaaacaaa aactaggcac
   129601 ttggtgagag aaaggggaac cgcggagagg atatgaaagc aatcgtatgt acaagtaccc
   129661 gcagaagagg aaaggtcaat accggggcat ttttacttcg tgagtctcgg ctccgcgcaa
   129721 ataactcatc atcggctaat tttcccggct gtatacagct gaactgtaag ttttcccaca
   129781 cggccgatgt cgaggcgtac ttgcgagaaa tcgatcgcgc atcggtccaa aacaccggac
   129841 atccatgtca catgtgggcg taaaaaaaaa tctgacccgt gtggcggcct tccatagtgt
   129901 ccctcccccg cacatatcct gtctcacttc ctctcgtggg gtccgggagg aagtgagaca
   129961 gccaatcgac aaggagcgcc gctctgctaa cagggtggtc tgttgttgtg gttaaattaa
   130021 gggttcttgt tttttcccgt tcttctttca ggggaccacc ggggattggc tgccgtcggc
   130081 agaacggccc aatacgctca tgcatgggct gcgtgtttgt cgcctcggtt gccggggagc
   130141 ggtcttgccg agcaggcaga ccctgcacta ccacacccct gtaaggcgtt gcataatggt
   130201 aaggaagctc ttatcaaaag ataaagtggc ccgcatgtca tcgctctcga atgaaatgcg
   130261 ataaaaggct aatggtacag ttttcatctc atttcataaa ctactttaaa tgcgtgatgt
   130321 gacttttttt gaaataaaca atcatttatt acacaacaca acgcgcaaag gccagtctat
   130381 cgggttcggt ttacgccttc gccatcacgg gccggcaaac gctctttgcc gacggattcg
   130441 cgtggttagt cgttgttgac ggggggcggc gacaggaccg cctgggtggg ccacatgtgc
   130501 gtgggggggg atttccgttt gcgtcgacaa tttacacttc ccggcgacga atggtcgcgg
   130561 cgggaccgcc atctgcgaac cacgcgtggt aacgcgagcc cttctgctta ggggtcctcg
   130621 acttggagtt tccggccaag ccccgcgaga gtccctcaca ggtgttcgat agcggggagt
   130681 tgaaatctcc gtcgccaaat acacactcgt cattgctggg gagggacgaa tactttggat
   130741 aggcctgaaa atatccattc gtgcgatgtc tcgcatgcct tttatacaat cctacaatca
   130801 gcagcgcgaa aagcaacagt actagtatta cgccggccgc catggaagaa actaagaggc
   130861 tgtaaatgac ggtcgggcct tctttaaaag cgcttgtatg tgtaggggcg gccgtgaagt
   130921 tgcccggcgt gtcggcagac accgcgttgt atccgaaccc gggcttgtgg acgtcttcaa
   130981 acacgttcag gatagtctcg agcgtggaca gataaacgta cgtccaagca agcggccttc
   131041 cattatagag gcctacgatc acgtacagtc ccgcgtctgt cggttgggca ttcgccaacc
   131101 tgaacgaggg aacgtccgat tcgaggaaag ccagcttccc ctggacggat tcgtctacgg
   131161 acgtttggaa tgtacacccg cggacgtcca cgcggcagcc gtcggtacgc gccgacgcca
   131221 actgcatgac gtccatattt gccgcaaaac gacattcggc atgctcgggt accatttggc
   131281 attccgattc gctcggatgg aatatgcagg gctcataaac ggtcaggtac aaacatttag
   131341 agttatacgg caggaacagt aacttgaatt ccagactaaa tgccccggcc caatttgtca
   131401 agtgtgcagt cacggaggcg tcgaccgtgt ccccggcatt aaacaggaaa gcgttaaagt
   131461 ttttgaatgt taggtcacag gtacaaacat aaatgtttgt acaaacaggt aacaggtaca
   131521 aacataaatg ccccggcata aatgtccctt acggcggatc gaaacgacat taggcatact
   131581 cgggtaccat tttgcattcc gatcagcacg gatgaaatta ggcaggaatg cggtttatat
   131641 tatgcggcat tggacaaacg atatggcatt gattggcagt ttatgaatgt cttcatgttg
   131701 ggcgtaaacg gattcctatt ggttcagaag acaacgacga tatatttaga gagaaaaagc
   131761 tacccagcat aggataaaca cacattgagc attgagagac ataggtatcg gtatggatgg
   131821 gaaaactaca cacgtgaaca ccaaacgact tatatactcg agcggtgata ctactgagca
   131881 agaatgcact gcatctgagc cactgaatga agactgtgat gaaaatgtga ccatcgatgg
   131941 aattggagaa gaatatgcgc agttcttcat gtccccgcaa tgggtcccaa atctacatcg
   132001 cttgagcgag gataccaaaa aggtataccg atgtatggtt tccaacagac tcaattattt
   132061 tccctattat gaggcgttca ggcggtcttt gtttgatatg tatatgctag gtcggttggg
   132121 gcgtcgactt aagcgatctg actgggagac tattatgcat ctgtcaccaa cgcaaagtcg
   132181 gcgtctacat agaactttaa gatttgtgga gcgtagaatt atcccatcta acagttatat
   132241 acgcacatcg ggccacgttc cgccttcgag ggcacttccg acagatacga atttaaagat
   132301 ggatgaataa ttaaattgga aagagtaact acattaatcg agcgtcatga cggcgtcccg
   132361 tgaaaatggg aattttctac tcgaaacacc gtgacatttg acagacctgg aattgttatt
   132421 ctgatatata gtgggtgtgt ctggccggca acatacataa tgtgcatgcg aaaccacttt
   132481 ttcagtgtac gctgacattg tgcaacacgg aggggtagca tctacataca atatatgttg
   132541 attaatgatt ggagaaaaaa ctatgcagct cgccgatcat atggctaact cgccttcgtc
   132601 tatatggcgg accccgcggg aaaaatcgac gtaccatctg atttacaaca ccagtaatga
   132661 acatgtcgca tccctgccca gatctgtgcg cccattggcg cggatcgttg tgaatgccgc
   132721 cgaaacactt caggtcggta tgagagccgg gaggccgcca tcagcaggag tttggcgaga
   132781 ggtgtttgat agaatgatga cagccttccg tgaccacgag cctactgcga catttaatgc
   132841 tgcaaatccc attagaaaaa tggtcgagac agttctacag aataatgaag agcccccgcg
   132901 gacgcatgct gaaatgggta atcgccttat gaacattatg tactggtgtt gcttgggaca
   132961 cgcaggacaa tgctcgatat ggcagttgta cgagacgaat caggccattt taagtttatt
   133021 agatgaagtg gttatcggca caacaaatcc cttttgcacc ctcgagcaat actggaagcc
   133081 attatgcacc gcaatcgcca acaaggggac ctcatcgctt gttgaggatg ccaaagtggc
   133141 cgagtacctg gttagcatgc gcaaattgat ataacatagg cacgctctga tgttacagac
   133201 cacaataccg catacattta ttgtaaggtt gttaataaag gtttattcta tgtaagacta
   133261 caatactttc gacattgctt gtatacatat taaatacttt ctcaagttcc tattacataa
   133321 aatgggatct atcattacat tcgttaagag tctggataat tttactgttt gccagcttcg
   133381 atcttggaac gtactgtgga tagtgcctta cttggaatcg tgaaaatttg aaacgtccat
   133441 tatttggata tcttccggtt gtcccatatc ccgccctggt accgctcgga taccttgccc
   133501 gtatggattc gtattgacag tcgcgcaatc ggggaccaac aacgcgtggg tccacactca
   133561 ttcggaaatt ttccgatgat tctgaatatt tattgccgct cgttacgagt cgttggacat
   133621 atctgtaata catttcttct tctgaaggat cgctgcacat ttgatctata cattggccag
   133681 gatgttcaag tctcagatgt tgcattctgg cacagcacaa ctttatggca tttccgatgt
   133741 aatcgtccgg cagccctggg ggagttctat attcgcatat tgggatggta aggacaatag
   133801 cagatctcgc aacctccagg gaggctataa taacgttttt aaaggatgga tttctcataa
   133861 aaatctgtcg caaattacac tgagaatatc ctttactagc gccgattgag agcatcgtcg
   133921 tccaattttc taaatggaaa gaaaacaagg cgggcaagag tgttccaaac attttcattt
   133981 tcggcgaatc tctcaaatcc catggcgtgc aattgattgc aaaattggca cttccgttca
   134041 cgtttgtatc tccaaactct aagacacttt taattgaaaa actacgttct agtgtggaaa
   134101 gaaacctata ggcagaccat agaactattt gacaccacat atctttttgt atgtcaaact
   134161 gaccatgatc gtatgttgct gaatgcacta gggcaattcg ctcgcgcgac tccatacatt
   134221 gaataattcc acacgtcagc tcatcggtta gcaaggtcca gtagttgaag tcatttattt
   134281 ttccccgcgg ctggccaaat ctacctctgg gaatatccaa gttgtcgaat atgatcgcac
   134341 cggctctggt catggtgaag gaactgtagc ataaagacgc aggtatcata ggggtaatat
   134401 ttttttattc actcacatac taaaagtaac gcatattagc accatgtatg ggctatcaat
   134461 tgacatttgc gtagcactac atcacgatta tgtacaacat aatgggacaa catatggcaa
   134521 gtagatgcaa tttcctcaca ctagttgggt ttatctacta ttgaattttc ccctatctgt
   134581 gatacacttg ggagcctcta caagcatatt gccatcatgt acgtttttat ctactgtctt
   134641 aacgcccatg ggaacggagg cgtcgtcgtc atgtattgga cggcaacata ggcagcaaca
   134701 caaattgcgt ttaggtgggg tgcatgtgga ctcgatacca agcccctgca gctggggaac
   134761 gtctggtgga gagccgataa tttgatatac gcacgccata ttactgtcgt tgaagtacgc
   134821 cttatcttct atgttttcaa atttaggttc ccaagtggac gtgagaagtg tttgtatctc
   134881 acatggaatg gcccaaggca ttccagccca ggtgcctggt actttaatgg caaacaaacg
   134941 ttttggtaga ggtattgatt ctattgcagt tctgcagata tctgcagccc cgagtatcca
   135001 caggctatac gatacgttat cggaggcctc cgattctagc attacatagc cggtcagtag
   135061 atcctgccat tcggtagcgc aaccggctac atcttcaaac agtctcacaa taaatgcatc
   135121 tctcgttcct gccaatccgg aaccgggcat accactcccg cctgccgatt taattctcac
   135181 aattgggcga tgccggcggg gcaaaacgaa tgtggatttg gcaaaccgac acaggtctgc
   135241 tgtacggact aatatgggca cacccacatc attcttcaga tgctccatgc attgttctat
   135301 gagaaagatc catagggtgg aggcagcgtc acgagatcgc ccaggcaatc gatcgcattc
   135361 gtctagtaaa gtgacgagag ttatcatgca cacacccatg cccacgcctt ccgaataact
   135421 ggagctgtgg aagatcggaa acgtcttttt gactgccggt ctcgtactac tttcgcacag
   135481 gtgtataccc ggacgcgtac tatatatttt atatcatcca acgtccgaaa ttacatacgt
   135541 ggcggcgatg gaagtagatg ttgagtcttc gaaagtaagt gcctcgaata tgggtattgt
   135601 ctgtgaaaat atcgaaagcg gtacgacggt tgcagaaccg tcgatgtcgc cagatactag
   135661 taacaatagc ttcgataacg aagacttccg tgggcctgaa tacgatgtgg agataaatac
   135721 cagaaaatct gctaatcttg atcgtatgga atcttcgtgc cgtgaacaac gagcggcgtg
   135781 cgaacttcga aagtgttcgt gtcctacgtc tgccgtgcgc atgcaataca gtattctttc
   135841 atctctcgct ccgggttcag agggtcatgt atatatatgt actagatacg gggacgcgga
   135901 ccaaaaaaaa tgcatagtga aggcagtcgt tggaggaaag aatcccggga gggaagtgga
   135961 tattttaaaa accatctcac ataaatcaat tataaaatta atccatgcct ataaatggaa
   136021 aaatgttgtg tgtatggcaa tgcgtgtata tcgttatgat cttttcacat atattgacgg
   136081 agtcggccct atgccccttc aacagatgat ctatattcaa cgtggactac tagaggcgct
   136141 agcatacata catgaaaggg gcatcattca ccgagacgta aagacggaga atatattctt
   136201 ggataatcac gaaaatgcag ttttgggtga cttcggtgct gcatgccaac taggagattg
   136261 tatagatacg ccccaatgtt acggttggag cggaactgtg gaaacaaatt cgccggaatt
   136321 atctgcactt gatccgtatt gcacaaaaac agatatttgg agtgccggat tggttctata
   136381 tgagatggca attaaaaatg taccattgtt tagtaagcag gtgaaaagtt cgggatctca
   136441 gctgagatcc ataatacggt gcatgcaagt gcatgaactg gagtttcccc gcaacgattc
   136501 taccaacctc tgtaaacatt tcaaacaata tgcggttcgt gtacgaccgc cttataccat
   136561 tcctcgagtt ataagaaatg gggggatgcc aatggatgtt gaatatgtca tttctaaaat
   136621 gcttacgttt gaccaggagt tcagaccttc tgctaaggaa atattgaata tgcccctatt
   136681 tactaaggcg ccgattaacc tgcttaatat cacaccctct gacagtgtct aacggtatac
   136741 aggcgggagc gggtcgtggc gtcatcatca ccacttgaga atttatattt tgaattgttg
   136801 attgataaat taacctgatt cattgagaac tgaaacgcca tattggtttc ttggatatgt
   136861 ctacaacaat tagttaaatt gctatgttct actgcgagta acatttgata agttgtaaga
   136921 gacgggcgac tcatgtcgaa gttgacgaat ataaagtaca taacgtgttt agaataccca
   136981 gaatccgaat agtccgcggg ggcgtcttct cgcgtgagta ccaaatactg agttgaactt
   137041 gaaaatgcta aatctgtgac actctttgtg tgatgattat tgtcaccact tcgaagatgg
   137101 cttcgacatt catgatgttc tggtgtttgt ttggaatcgt aatagcgctt gtttcgtcca
   137161 agtctgacaa caaagaaaat ctgaagaatt atatcacgga taagtcaacc aatattagaa
   137221 tacccacgcc attatttgta tcaacggaaa actcttatcc cacaaaacat gtaatctacg
   137281 atgaaaactg tggcttcgct gtactcaatc ctataagtga ccccaaatat gtccttttga
   137341 gccagcttct aatgggaagg cgcaaatatg atgcgacggt cgcgtggttt gttctcggta
   137401 aaatgtgtgc cagattaata tatttgcgcg aattttataa ctgctcgaca aatgagcctt
   137461 ttggcacatg ttctatgagc tctcctggat ggtgggacag gcgctacgtc tcaaccagtt
   137521 tcatttctcg cgacgaatta cagctggttt ttgcagcgcc gtcccgagaa ttagatggtt
   137581 tatatacgcg cgtagtagtt gtcaacgggg actttactac ggccgatata atgtttaatg
   137641 ttaaagtggc atgtgccttt tcaaagactg gaatagaaga tgatacatta tgcaaaccct
   137701 ttcatttctt tgccaatgca acattgcaca atttaaccat gattagatcg gtaactcttc
   137761 gagcgcacga aagccattta aaggaatggg tggcacggag aggtggtaac gtccctgcag
   137821 tgctacttga gtctaccatg tatcatgcat ccaatctgcc tagaaatttc agggatttct
   137881 acataaagtc tccagatgat tataagtata atcacctaga tgggccatct gtaatgctca
   137941 tcactgacag acctagtgaa gatttggatg ggaggctcgt tcaccaaagt gacattttta
   138001 ctactacaag tcctataaaa caggtccggt atgaagagca tcagtcacat acaaagcagt
   138061 atcctgtaaa caaaatacaa gctataattt ttttgatagg gttaggctcg ttcattggaa
   138121 gcatattcgt agttttggta gtatggatta tacgcagata ttgcaatgga gcgcggagtg
   138181 ggggaacgcc ccccagtcct cgccggtatg tgtataccag gctatgatca cgtgtgaaac
   138241 ttgggcggac ctgtatcata tgtacaccgt ccctattcgt ttatagccag tacgtgttat
   138301 ctgcacatag aggaacatgt gtcatactgg gatcgcatgc atggtatgtg tgactctaat
   138361 attattctgt atcataataa aaacacagtg catggtatat agaggatcgc tggtaagcac
   138421 tacggtagac caatcggctc agattgcatt ctttggcatc gataccgttg ttaatttata
   138481 tggcaaagtc ttgttcatgg gagatcagta tttggaggaa atatactctg gaacgatgga
   138541 aatactcaaa tggaatcaag ctaaccgctg ctattctatt gcgcatgcaa catattacgc
   138601 cgactgtcct ataatcagtt ctacggtatt cagaggatgc cgggacgccg ttgtttatac
   138661 taggccccac agcagaattc atccccaata tcgaaacggg ctgcttttga ctattatcga
   138721 gccacggatg gaggattctg gtatctatta tatacgcact tcaatagatg gttttaacaa
   138781 gagcgattat gcgagaacat ctatttttgt atgtaatggg tcgtctggat cgtgttctaa
   138841 cccccgccaa aaagtttcag atgaaatgtg catcccccac gtaaatcgta ttgcatttga
   138901 gcgatattta accctacatg ttggacggtt gccctacgga gacttgacat tacagcagat
   138961 acgtaaggac atgacgacca ccgctcctac atatcgtacc attcgcagaa ctacagttaa
   139021 tgagggtttg ttgacagcca agacatcccc tgatatcgat ttaaatgcaa caaatttgcc
   139081 cctacccatt agtaactaca cagattatat gagtgttatt tggagacgtg ttgccttaag
   139141 acgaatttat gcttatttgg tgatcgctat tatagcattg ttgatagtaa cagtctgctc
   139201 cgcacataaa agaggcagtt gtagtcgtcg acgtagaatc tacataggca atgaacctac
   139261 tacattgact tcgatcacta acggaaattt ccaagaaaag gagaccaaga atgtaccgtc
   139321 cgacatctca gacgctgagc ttttggagag actcgagaag aagatagaaa tgttacggac
   139381 tgaataattt ccaaatggca gttaggtacc caggaatgtt gggatatgta gatgtattag
   139441 ctataagtcc gtatttaagg ggagtggccc accaataata aactctggta tttttgtctg
   139501 ggaattcagt tgtgctttaa ggcgacctgc tgtttcgata tgcgcgcgtg tcgattatcc
   139561 atcctcatat tattattgca gacgatctcg gcgagtatga tacaacattt agatttatta
   139621 gaggggcaat ctgttgcagt cgatattcca agatatccgc cgctaacaaa cggtactatt
   139681 tatactgaaa catggacgtg gatttcaagt atttgcaacg atacatcgat gggttatata
   139741 tgtttggatc gcgcaacgtg ttttcaggat ttgcttttgg ggacatcttg cgtaaggtat
   139801 ggtgaagaaa agatcttgag ggtggataga tttgttgtga atagtgggtc tcttgacagg
   139861 atagcgtctt ctcagtttca ttatataccg aatgtaataa taggcactgg acggggaaag
   139921 gaacttacta tcttcaatgc tacatcgcaa atcgctggtg tatatacgcg atataccagg
   139981 aacgatagta ggcccgctgt aatggatgtc cttttagtgt gggtttcggt gcatgggcaa
   140041 gctccagatc gtactatgaa catatatatc acccccccgt cgactagagt ggacctaaca
   140101 ttcaaaaact ttaacgcttt cctgtttaat gccggggaca cggtcgacgc ctccgtgact
   140161 gcacacttga caaattgggc cggggcattt agtctggaat tcaagttact gttcctgccg
   140221 tataactcta aatgtttgta cctgaccgtt tatgagccct gcatattcca tccgagcgaa
   140281 tcggaatgcc aaatggtacc cgagcatgcc gaatgtcgtt ttgcggcaaa tatggacgtc
   140341 atgcagttgg cgtcggcgcg taccgacggc tgccgcgtgg acgtccgcgg gtgtacattc
   140401 caaacgtccg tagacgaatc cgtccagggg aagctggctt tcctcgaatc ggacgttccc
   140461 tcgttcaggt tggcgaatgc ccaaccgaca gacgcgggac tgtacgtgat cgtaggcctc
   140521 tataatggaa ggccgcttgc ttggacgtac gtttatctgt ccacgctcga gactatcctg
   140581 aacgtgtttg aagacgtcca caagcccggg ttcggataca acgcggtgtc tgccgacacg
   140641 ccgggcaact tcacggccgc ccctacacat acaagcgctt ttaaagaagg cccgaccgtc
   140701 atttacagcc tcttagtttc ttccatggcg gccggcgtaa tactagtact gttgcttttc
   140761 gcgctgctga ttgtaggatt gtataaaagg catgcgagac atcgcacgaa tggatatttt
   140821 caggcctatc caaagtattc gtccctcccc agcaatgacg agtgtgtatt tggcgacgga
   140881 gatttcaact ccccgctatc gaacacctgt gagggactct cgcggggctt ggccggaaac
   140941 tccaagtcga ggacccctaa gcagaagggc tcgcgttacc acgcgtggtt cgcagatggc
   141001 ggtcccgccg cgaccattcg tcgccgggaa gtgtaaattg tcgacgcaaa cggaaatccc
   141061 cccccacgca catgtggccc acccaggcgg tcctgtcgcc gccccccgtc aacaacgact
   141121 aaccacgcga atccgtcggc aaagagcgtt tgccggcccg tgatggcgaa ggcgtaaacc
   141181 gaacccgata gactggcctt tgcgcgttgt gttgtgtaat aaatgattgt ttatttcaaa
   141241 aaaagtcaca tcacgcattt aaagtagttt atgaaatgag atgaaaactg taccattagc
   141301 cttttatcgc atttcattcg agagcgatga catgcgggcc actttatctt ttgataagag
   141361 cttccttacc attatgcaac gccttacagg ggtgtggtag tgcagggtct gcctgctcgg
   141421 caagaccgct ccccggcaac cgaggcgaca aacacgcagc ccatgcatga gcgtattggg
   141481 ccgttctgcc gacggcagcc aatccccggt ggtcccctga aagaagaacg ggaaaaaaca
   141541 agaaccctta atttaaccac aacaacagac caccctgtta gcagagcggc gctccttgtc
   141601 gattggctgt ctcacttcct cccggacccc acgagaggaa gtgagacagg atatgtgcgg
   141661 gggagggaca ctatggaagg ccgccacacg ggtcagattt ttttttacgc ccacatgtga
   141721 catggatgtc cggtgttttg gaccgatgcg cgatcgattt ctcgcaagta cgcctcgaca
   141781 tcggccgtgt gggaaaactt acagttcagc tgtatacagc cgggaaaatt agccgatgat
   141841 gagttatttg cgcggagccg agactcacga agtaaaaatg ccccggtatt gacctttcct
   141901 cttctgcggg tacttgtaca tacgattgct ttcatatcct ctccgcggtt cccctttctc
   141961 tcaccaagtg cctagttttt gtttcgagca ccattttcgt ttctagaaga gagcccatgg
   142021 gcaatacttg ggtcatgacc gatcagcgca atgcaaggaa tgcacgcatt ccacaacggc
   142081 tgttcaaggt ttttaaccct cggtctgctg tttcctaccc tctcttattt tcaccggaca
   142141 cagcatacga aggcgattgt cattgaagat actaagccgt cgcaacggct cctcgatgtt
   142201 ttagacccct ggtctgccat ctttcccacc ccctcttact tttatcagac acagcattcg
   142261 cctgcaattg tcatagtaga atatactaag ctgtcaggga acagtaacag ctgagcgaac
   142321 cacatcccca gtgttagctt aaccaccggc agattctcat tggctgccag ttgctatcac
   142381 ggttcggcaa tttgtcttgt taaaaaataa acacagaccc caacccccgc ccgtatctca
   142441 gatatgtcca cggcccgccc ttacttgacg tgccaaaaca aaccccgtcg agtgtgtata
   142501 taagcggtct tcccacaatc gcgaggtccc ctggacattt tttttctgga agtcaccgtc
   142561 cgttctatca cgaacagcct ctgtgtgcga gatcggcatc gggggacgac agtagatctc
   142621 gcatatatgc gagatcctcc gaaacgggca ttggagtgga cgcaatatac gtaggctgcg
   142681 gagaacatct gaagggtgtc tagcgacggt aggttttgta attatggggg gcgcgttacc
   142741 tatggccgtg gagaaagatg gggaaacata cttgcctcaa gaactcacgt gaaagagtgg
   142801 tcattgatga cctccacaag ttcccccatc ataacaccgc gggggggggg gggatttgtt
   142861 accttgcgcg ctgcggtcac gcataacatg agtcggcttc tcacatgccg ttcgctgact
   142921 gatcctgttg gagtgaagtg acaggttacc gactatatta gtctcctgta atctagacac
   142981 tcgcctcacc aggcctttac atctgctagc cacaacacat tgcgagggtt ctcccccccc
   143041 catcgcgcat cgctatgtaa tattcaattc ttcaaaaacg ggcggatggg gtgtctaacc
   143101 acaagcggca tccgctgtaa atctccactt tgttctgtcg actggcagta caagggggtg
   143161 gggaagcacc cccccgccgc agcgttaaca gtttcgcaga attggcaaaa aaatagacaa
   143221 gggtcctttg ccaaaagaaa atgaaaaaga gaagaaaaat ataaccaaaa cggtgttcgc
   143281 cctgcagctt tctgtgccga atacatcgaa actgcaacgg tattgagatc atatctgaaa
   143341 catgcttttc gtaggcatgc ccggcgtgta gagatggggt aggagcagca ggcgccgcag
   143401 ctcacatgcc gccttccgcg cttgcctagg cgcgagtgtg agaggaggcg ggttgcggca
   143461 tatgcgcccc gcctcctctc cccatccccc gtcccatcct ggatagatgt atcgccacgt
   143521 tagcacttct tctgcagcgg cgggtgtggg gggggggggg cagtttcctg agggtgaaac
   143581 atcagaatgt gtgtctacca ttaagacagg cgctatattc ctcgccccgc agtcttatat
   143641 acgccatggt ttgctttatc gcgggagctc ggatttgtag cgccgcgggc atacgcctga
   143701 gaattatatc tactgtaatc actccattca taactcatta ctcacccacg tacattgagc
   143761 tcgggcctta cgagcacgtt gttactcaat ccccgctggg gatcaatcac ataactttca
   143821 gctttctaaa gccattccac tttccagtac actgacacta gcgctggggg agaccccctt
   143881 tctatttttg tcgtctaatt gggcagtgtt actaattcct ttgccatttc ccgcagggat
   143941 ggcatcccct tcagaatatg accatgtccc cggtggcgac atttgcaatt cgcccgattt
   144001 tgcttctcta cttgcggctc tcgaagaagg ggggcccttc catcaaaacc ccaggacccc
   144061 tggcgatccc taccaagacg tatctctgca aactccctgt gtttcgctgt tatctacggc
   144121 cgtcgacccc atatccggtc ataacccgca gctacctcca atctcccatc atgggaccgc
   144181 gtccacccat gatgcgggag aggatgcgtg ttcgagattc gaacccccgg acggacggtc
   144241 agagtccccg gcatcctccc caccgtccag tgccacgtcc tgcgcgcccc ccagcccatt
   144301 tggcctacac agcctataca gcacaatctc aaacgacaat gaggttagca cagttagctc
   144361 ctggcactct tcagtagacc gtcccttctc cagcagcggc agcggcagcg acgaagatga
   144421 taattcctct agtgacgaag ggcccgaggc atcatcgcca ccaaggtttc tggatattga
   144481 gtttggacgt ggctctcgga ggagcgaccc tccgtacatc ttcgagaaag acgccgggta
   144541 caaagcctac tattacgagc gggatagccc cgaaccacgt cccccctgcg tcgaagacat
   144601 tgaatgcttc tatgaacccc ccgcccccta ccaatcccat atttatgccg cgcgaaacgc
   144661 ggtcagcgaa gcgcttaggg catcccccga cagctattgg ttcaggtttg atcaacatca
   144721 cggcacccaa gccgccggtg gggagtctcc aaactcttgc accgagatga tcgatacgcc
   144781 cctgccaaat ccacccgtcg agtcgcccac acctgaacct ctcgaatcta tggtattttc
   144841 ccccatcagc cctgcctccg tccatagtgt ttcagcaccc ctctcttcac cggtccccat
   144901 ctccacacaa ccgacacgcc tgcctcccac atcacatgcc cgcaactccc cctttcggca
   144961 tggagtggat gatgctcaac ctagatctgg ccgcatgtcg gaattctcgc cctctcagac
   145021 ggcgggagcc agctttgttt atgtgcggca actggccatg tccgtagaag cgctaactcc
   145081 tccacatgaa cagctggcta tgataacaca gctgccggga agtcacgcac aactttggtc
   145141 gaagctcctg gaagcggggg aagaagtacg ggcctacagc gaccttgtgc gagctgggca
   145201 gcatgatgtc tgtgcattcc tgctgacgct ttccgacatc aaacgatgtc cgtcgttttg
   145261 ggatcagctg gccgccgagg ccgtgatacg tgagatatca caccaatcac ggggaaaggg
   145321 tctgcaaaaa gaagcaccac tgacagatga caattacatc ccgtttgatt accaaggggg
   145381 tgcaagtact tcctccaatt catccccccc atttagccaa cacggccaca agcaggtggt
   145441 aacctggccc tcgtgcaaaa tttggctgtt tacaaaaggc tctcgtgcag tcctggaggc
   145501 tatggacaat gctgcatatc aggaattgga aagcgggtta ggatctctag attgtggatg
   145561 gggtcctgaa aacgaatgcc ctctaccccg gcctgggaca attgatttgc cgacatccat
   145621 catgcaagcg attgaacagc tctgtccaac atcatccccc attccgaagt acgcttttgc
   145681 gctctctgca cttctccgtt tcctaggact tcgaatacca cccggggtgg tgtctgccat
   145741 cccccgcctc tcgtaccgct gcttagactg cctgcggtgt gtgaggcgca tgcagtacat
   145801 gtgccatgtg ctcacacgag atttttccag ccagctacaa tctgcacggg acataccctg
   145861 cttcccggca tgcgctcccc cgcctggcgt aggaaccccg ctcgacgaag actggaatgg
   145921 gattccagtt ggagacagtc ctgcaaattc cgcggaagga gagcagtgtg gaggctttta
   145981 tcacaataac aatgctcctc acctctcgtc tattacgtgg attgaaggta aacggggttc
   146041 catttcccct ggacggtcgt acctggaaga tttcaagaaa ctgcactatc gttatctgtt
   146101 ttaccaagta cggaagggct tagtcatggc tccgggacat ttccttcccg ccggttccgc
   146161 tcgaccgggc gtcgaactgc cttacgagat acctgtacca gaggagacaa tcccccccgt
   146221 cctctcggcc gcagtccacg aagccggttg tgctctgcaa aacataaagg atcattgtga
   146281 agacatactg cagggtgggt ccgaattcga ggagaccgcc gacaatgcca atgggttcat
   146341 ggttcaacag ctcgcgatgg ccatgctaga attgggcttc ccagcatatg gcccggccat
   146401 cgaaaagcgc ataagaccac tctacgcagc gatcgagaaa tggcgggccg ttatagaagc
   146461 tgcgtcacgt cgctgctttg aagatatgag aaacgaccct gagatggaag actgtgacac
   146521 acccatgttc ccagcactcc ccaagccaga ttggattctc tcccctgcga cacccctccc
   146581 ggctgagaac tccgggggca taaacggtag tggcggatct ccatcctcgc cacatagtgg
   146641 cggagaacga tacgatggct actgtgacaa tagaccgacc cactcgcgca acgaaagccc
   146701 gcctcaccca tcgggtttgg aaaaaccatc cagctcgggt gagagttcca gacaatgcgg
   146761 gtttcacata agccccccct gctcaccttc gccacgaagg gcccgcggtc gtcccttgcg
   146821 tcgtacacgt ccaccgggta catcgtctac gtcctctgca tcattttccc ggtctccgtc
   146881 ggccacgtcg tcaacatcgt cctcgtcctc gtcctcatcc tcgtcatcgt cgcgttcatc
   146941 atcggcaacc cgttcctcgt ctccgtccgt ttccccatcg tcgcgatctt cgtcatctgg
   147001 cacatccgat tcttccgcta catccggctc tgagcggcgc catcgatccg gcctgcaaga
   147061 caacaggaat tcccgtcccc acgggtctgc cagaggccgt gcggcacgtt tatgtccgag
   147121 tgagaagaac ctatccccct caggctcgcc gaccccggga ccatcatgcg ctgcaactcg
   147181 gccccggagt agcgaaccac tgatagaagt tcccgacccc ccccgcggtt cctgttggtt
   147241 cggtggggtc ggcggtcacc gacccggcct ttacaatgcc cccgaagtat tggacgccat
   147301 cgaacgattt gaggcgtctc ccggccccgt tccagtttac gtggaagaaa tggggaaccc
   147361 ccaaaagcaa tatgaggctc ttatcgattt tctgtacact cgcgaaaagg ctatcatgac
   147421 ttggctacat cacgcaagac tgacgagcgc cgaaagtgct ctcgactgtt taatgaacaa
   147481 aaagttccag gcagcacccc gcgtgtcggc atccgctgtg actggggccg ttcacaaatg
   147541 cgtcccccat atagcatcgg ccatgcagac agacaatctg ctttggggtc tgccccatgc
   147601 ggccgcaacc gttgccatga cacgtagata cgacaccgcg cagaaggcgt tcattctccg
   147661 ttctctgaga acggcatacg cgggcatgtt acagtcgggc acacgaccgg agacgggagg
   147721 agagacatcc tccgacggat ctccatcggc tggggcctct aggcgtggcc ccgcggatga
   147781 cgcctttact gtctacgctc gcgtgctgga aggggtcaag ggcatagaac gcgccgtgaa
   147841 aagcggctcc atagacgccc ccgattttac cctccccgta ggccccggag cggctgccgg
   147901 cggctgctcg ggaatacctt tggccgatct ggcagacgct tgcgtcctgg cctgcgatcg
   147961 ggtaatagcg gctttgatgt ccgggccaga cggctttcac aagatcgcta aaatgctatc
   148021 cgcatgcgag ccccgacccc gacgagcccg cctcgccgct tgccagtggg aaaagtgccg
   148081 cgggctacta gtttcttggt gcaacgacct gaaacggctc gagcgcgcca tctacctgtc
   148141 gaatatggga acagccggtg accaaggact cgaaacccgt accgccgcgg cacgccgtgt
   148201 cgctagtagc ggaacggtcg gaccgcttgt cggacatagc gcggaacagt gggctcgcat
   148261 gagctcccgt gatttcacta acattttgct agaggatcac gccactgtag aacccgcaga
   148321 ccctgcgtta tgtaaggcca aacgcctccg ccgcgtggcc gagtggctaa gtcctaaaag
   148381 gggggcgggc gcgcggaaac taccccccgg tgtattcttg ccaccaccta aacccgagca
   148441 gcttttccgt ggcccgggac gccctaggcg accccgccca gataaccacg gacagtctcg
   148501 aacagcgcat aagcgtgctc ctacaccatc tggcccagga tgcatggtcg aatcgaccct
   148561 cgcacatgga acatccgcca gcgatcccgt ggaaactgcc cccaaaaggc gtgccgggac
   148621 tctcgttaca tcctcgggag caaaaagtgc cacccacatt acgggccgat ctggaaaaac
   148681 tgcccaaaca tttgcctcca tcggggactc cccatcatac ccccagtgtc caccagttcg
   148741 cgcccgagaa cggcgcgaat cggacgggcc gtctccgcat ccaccgcagc aaacgcctgg
   148801 ggaggctgcg tctaggaagc gtaaatcagc gcccgcctcg tcaggcagcc ccctcacggc
   148861 ggggcatatg cagccaattg tactggtccg cgatatccgt gcgggtcgcc ggggagaaat
   148921 tgccccgcga tcctccgccc agatcgccaa gctggaagtt gtcccatccc catgcaagaa
   148981 accatgtcat caaccctacc ccacacgcga atcaatactg aacggttccc tacgcccgtt
   149041 aggtaacctt ccggaggatt ctgggggcag gcgatgtcca gtagggagac ttgtgccaga
   149101 aacgaccctc ccgactgata tccgagcgta ctgccctccc gcagccgccg cggcactgat
   149161 ggattttgct aaaatacccg gcccttggcg ccccgccatg ctctacgctc cagaatgcct
   149221 ggcagaaata gccgctgtgg caaacgaggt cccacctaga gcaacctcga ctgtaggggg
   149281 gggcaacgca gaacccagct tggaaacttt aaagagacat actgcgtgga tgcatcacca
   149341 acaacattct cccgaggatg taaaaattgt cgtcctgtat aaagcgctca agggggagca
   149401 tttgttctgc gtgcctaccc ccgatgcggc ttatgggtgg ccccgtttcg aaacaaccaa
   149461 gggaggatta tctttcttat tggcggcaat gtcaaatcgt ttgtgtttac cttccagtgc
   149521 tgcgtgggcg ggcaggtgga aagcagcacc cgatatttcc ccgctaaccc aggccggtgt
   149581 tctgttcctg tccgtaggtg actggggatg ggttggtgcg ctagagtatc tgcagcatct
   149641 aaacatagag aggcaccata agctaatagt cgtggacacc gttgacgaaa attcgcgccc
   149701 gcaggggggg ccgcagttta tatccgaggc tgtacgatat taccggtgtt ggattgaccc
   149761 gcttaaccag tgctgcctca ggtggcccga tgcacccggc ctcgatacag ccgttatgac
   149821 gtctaaagaa gttttgggac ctgtgttgct aactgaggtt gcgctacagt gcacggcaga
   149881 gttctcctgc ccgcaaccga aactctgctg cagcgccaat gtgcgatacg tcgtagatac
   149941 gcacctgggg gatgatatgc ccgtgcctac ctcggcggtg ttctattgcg ccgccactag
   150001 gcaagcatcc gcccagccca acgaacacga tccgttctcg caaccagact tcttgggagg
   150061 ggaagcacac tcgcatcgcg ccgctcgaag atggggtcta ggcgcccccc tcttaccaat
   150121 ttacctaaca gaggcgggcc gtcgtgcaat cgcatccccc tcgctgatct cgaaggtggt
   150181 gcgatacatg tgcgggaaca cggtactccc cccggatccc catggcaccc ccgtggtgat
   150241 caacgttccc gagggaacgt ccgaaactat ggcggagctt actgttgctc acgttgggcg
   150301 caggtctatt gggtggtcga cctccgagtg gcattccgct acaatcctgc agaaagataa
   150361 tgatagtcgg ctggtaatta tacgccccgc agcgtcccct tgtgcggtgg aggacgacga
   150421 ttgaatgaca acttaccggt ccgcagcgcg cacggtgtgc gcgcgtactt ttgccacaca
   150481 tccgttaccc cagtgtcgaa atcgaaccat ccgtggccct tgtaagggag tgttcccgcc
   150541 gacccggctg tgtatttgcg ggacggcctc gaaacatgat gactgagcct tgccgagaac
   150601 cgcttatttt gcctacgtcc gaaggcgctc ctatcgcgaa cggtctgggg gcatgtcgtg
   150661 acagtccgtc tgctcgcgga ccaccgcccg aaaaggagga tatcccccat ccagcgaacg
   150721 cggcaccatc cgctcccgtg cctcaggccc ccgctaatct gcgtcgcacc accagccgaa
   150781 ttttccggcg ggtgattatt tagagtgtac taagaatgaa tcaataaagg cattagcgtt
   150841 ttatgctcgc gggtcgtaaa tgtgatgcga cagaatcgta aataagacaa cttacctacc
   150901 ggataaatca ctcgaaacgc atagaataat gtaactttat atatgcagtt ctttgtcctt
   150961 gcacaagaag tggtatttat tgcaagacta atccgcggcg gagatcagga actgagaaag
   151021 aagcgggaaa cgcggcttcc gcatcctcca gagtagggcg catgcgcagt atagttgtta
   151081 tagcgcgtag acatccggat cc
//

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH