NCBI Nucleotide banner
My NCBI
[Sign In]  [Register]
PubMed Nucleotide Protein Genome Structure PMC Taxonomy OMIM Books
 Search  for    
  Limits Preview/Index History Clipboard Details
 Display   Show    Hide:     
  Range: from   to  Features:  
1:  AJ004801Reports  Bovine herpesviru...[gi:2653291] Links
LOCUS       AJ004801              135301 bp    DNA     linear   VRL 14-NOV-2006
DEFINITION  Bovine herpesvirus type 1.1 complete genome.
ACCESSION   AJ004801
VERSION     AJ004801.1  GI:2653291
KEYWORDS    complete genome.
SOURCE      Bovine herpesvirus type 1.1
  ORGANISM  Bovine herpesvirus type 1.1
            Viruses; dsDNA viruses, no RNA stage; Herpesviridae;
            Alphaherpesvirinae; Varicellovirus.
REFERENCE   1  (bases 99702 to 103033)
  AUTHORS   Wirth,U.V., Fraefel,C., Vogt,B., Vlcek,C., Paces,V. and Schwyzer,M.
  TITLE     Immediate-early RNA 2.9 and early RNA 2.6 of bovine herpesvirus 1
            are 3' coterminal and encode a putative zinc finger transactivator
            protein
  JOURNAL   J. Virol. 66 (5), 2763-2772 (1992)
   PUBMED   1313901
REFERENCE   2  (bases 103034 to 111027; 127191 to 135300)
  AUTHORS   Schwyzer,M., Vlcek,C., Menekse,O., Fraefel,C. and Paces,V.
  TITLE     Promoter, spliced leader, and coding sequence for BICP4, the
            largest of the immediate-early proteins of bovine herpesvirus 1
  JOURNAL   Virology 197 (1), 349-357 (1993)
   PUBMED   8212570
REFERENCE   3  (bases 111028 to 114234; 123984 to 127190)
  AUTHORS   Schwyzer,M., Wirth,U.V., Vogt,B. and Fraefel,C.
  TITLE     BICP22 of bovine herpesvirus 1 is encoded by a spliced 1.7 kb RNA
            which exhibits immediate early and late transcription kinetics
  JOURNAL   J. Gen. Virol. 75 (PT 7), 1703-1711 (1994)
   PUBMED   8021599
REFERENCE   4  (bases 66900 to 96900)
  AUTHORS   Vlcek,C., Benes,V., Lu,Z., Kutish,G.F., Paces,V., Rock,D.,
            Letchworth,G.J. and Schwyzer,M.
  TITLE     Nucleotide sequence analysis of a 30-kb region of the bovine
            herpesvirus 1 genome which exhibits a colinear gene arrangement
            with the UL21 to UL4 genes of herpes simplex virus
  JOURNAL   Virology 210 (1), 100-108 (1995)
   PUBMED   7793062
REFERENCE   5  (bases 1 to 31444)
  AUTHORS   Schwyzer,M., Styger,D., Vogt,B., Lowery,D.E., Simard,C.,
            LaBoissiere,S., Misra,V., Vlcek,C. and Paces,V.
  TITLE     Gene contents in a 31-kb segment at the left genome end of bovine
            herpesvirus-1
  JOURNAL   Vet. Microbiol. 53 (1-2), 67-77 (1996)
   PUBMED   9010999
  REMARK    Accession# Z54206
REFERENCE   6  (bases 1 to 135301)
  AUTHORS   Schwyzer,M., Paces,V., Letchworth,G.J., Misra,V., Buhk,H.J.,
            Lowery,D.E., Simard,C., Bello,L.J., Thiry,E. and Vlcek,C.
  TITLE     Complete DNA sequence of bovine herpesvirus 1
  JOURNAL   Unpublished
REFERENCE   7  (bases 30801 to 67800)
  AUTHORS   Schwyzer,M., Vlcek,C., Lowery,D.E., Bello,L.J., Meyer,G. and
            Misra,V.
  TITLE     Gene contents in a 37-kb segment centered in the UL part of the
            bovine herpesvirus 1 genome: the last gap
  JOURNAL   Unpublished
  REMARK    Accession# Z78205
REFERENCE   8  (bases 96901 to 99695)
  AUTHORS   Letchworth,G.J. and Kutish,G.F.
  TITLE     DNA sequence of the BHV-1 UL1 to UL3.5 genes
  JOURNAL   Unpublished
REFERENCE   9  (bases 114235 to 122983)
  AUTHORS   Goltz,M., Buhk,H.J., Broll,H., Lewin,M., Mankertz,A., Boerner,B.,
            Borchers,K. and Weigelt,W.
  TITLE     Nucleotide sequence of the HindIII O and K fragments located in the
            US region of the bovine herpesvirus 1 genome
  JOURNAL   Unpublished
  REMARK    Accession# Z98199
REFERENCE   10 (bases 121402 to 123983)
  AUTHORS   Schwyzer,M.
  TITLE     Glycoprotein E and US9 genes of BHV1
  JOURNAL   Unpublished
REFERENCE   11 (bases 1 to 135301)
  AUTHORS   Schwyzer,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-SEP-1997) Institute of Virology, Faculty of
            Veterinary Medicine, University of Zurich, Winterthurerstrasse
            266A, Zurich CH-8057, Switzerland
FEATURES             Location/Qualifiers
     source          order(1..4014,102918..111027,127191..135300)
                     /organism="Bovine herpesvirus type 1.2 (strain K22)"
                     /virion
                     /mol_type="genomic DNA"
                     /strain="K22"
                     /db_xref="taxon:31519"
     source          order(4015..9664,15010..22094,26636..102917,
                     114235..123983,135301)
                     /organism="Bovine herpesvirus type 1.1 (strain Cooper)"
                     /virion
                     /mol_type="genomic DNA"
                     /strain="Cooper"
                     /db_xref="taxon:10323"
     source          9665..11962
                     /organism="Bovine herpesvirus type 1.1 (strain P8-2)"
                     /virion
                     /mol_type="genomic DNA"
                     /strain="P8-2"
                     /db_xref="taxon:10324"
     source          order(11963..15009,22095..26635)
                     /organism="Bovine herpesvirus type 1.1 (strain 34)"
                     /virion
                     /mol_type="genomic DNA"
                     /strain="34"
                     /db_xref="taxon:31517"
     source          order(111028..114234,123984..127190)
                     /organism="Bovine herpesvirus type 1.1 (strain Jura)"
                     /virion
                     /mol_type="genomic DNA"
                     /strain="Jura"
                     /db_xref="taxon:31518"
     intron          <1..472
                     /note="3'part of intron spliced out from transcript over
                     covalently joined genome ends, leading to immediate-early
                     RNA 1.5 and circ protein"
     repeat_region   235..430
                     /rpt_type=DIRECT
                     /rpt_unit_range=235..248
     mRNA            466..1280
                     /product="LR1.1 (circ)"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="transcribed from alternative late promoter"
     CDS             486..1229
                     /note="immediate-early and late myristylated protein
                     (virion)"
                     /codon_start=1
                     /product="circ protein"
                     /protein_id="CAA06078.1"
                     /db_xref="GI:2653292"
                     /db_xref="InterPro:IPR010741"
                     /db_xref="UniProtKB/TrEMBL:Q4LDG8"
                     /translation="MGARASAPAAGPPPAHAVLLDALSGGTIDLPGGDEAVFVSCPTT
                     RPVYHHMRRGRTAHTTPVHFVGRAYAILPCRKFMLYLMRGGAVYGYEPTTGLHRLADS
                     LHDFLTTAGLQQRDLHCLDVTVLDAQMDPVTFTTPEILIELEADPAFPPPPSARARRS
                     TLRRASMRRPARTFCPHQLLAEGSILDLCSPEQAAAPGCSLLPACDSGDAACPCDAGE
                     TARDCTADAARAPSPGALSRYSSVRSVFF"
     gene            1259..1264
                     /gene="circ"
     polyA_signal    1259..1264
                     /gene="circ"
     gene            complement(1649..1654)
                     /gene="UL52"
                     /note="synonyms: UL53, UL54"
     polyA_signal    complement(1649..1654)
                     /gene="UL52"
     gene            complement(1658..2860)
                     /gene="UL54"
     CDS             complement(1658..2860)
                     /gene="UL54"
                     /note="early BICP27 affecting mRNA processing (cell
                     nucleus)"
                     /codon_start=1
                     /product="UL54 protein"
                     /protein_id="CAA06079.1"
                     /db_xref="GI:2653293"
                     /db_xref="GOA:Q4LDG7"
                     /db_xref="InterPro:IPR008648"
                     /db_xref="UniProtKB/TrEMBL:Q4LDG7"
                     /translation="MADPEIATLSTASESDDLSLFGSDREEDDEAPSLAPALRSVVGQ
                     VRKRKLEGAEDEPMPAEPPGEGAASGDGGPAEAPPARRARVRPRRPRRRPRRRQPAGE
                     QRSRGPAAKREAALATSSHGGGGAAARSIGSSLRLARSLAEAAQRATAERVTAVFAGA
                     RLDLMRPVQNGGFRAAGVSPWAAVLDFGAEQFVPEGRRVTWETLMFHGRDLYRMFEVR
                     PHAAQAARALRDLVLRSANLVDALASADECLTWCKFIATKNLRLRTKDPIVATAGAVL
                     ENLRLKLAPFLRCYLRGRGLPSLEELCAARRLSLATCPASYMFVMLARLSRAVRSGAE
                     CVPLLEVTVGDAPFEEYIPGTCVAGLIDALDTHKQACDSMTCKLVANFTLVPVYMHGK
                     YFYCNEIF"
     gene            complement(3040..4038)
                     /gene="UL53"
     CDS             complement(3040..4038)
                     /gene="UL53"
                     /codon_start=1
                     /product="glycoprotein K"
                     /protein_id="CAA06080.1"
                     /db_xref="GI:2653294"
                     /db_xref="GOA:Q77CE8"
                     /db_xref="InterPro:IPR002567"
                     /db_xref="UniProtKB/TrEMBL:Q77CE8"
                     /translation="MLLGGRTVNLAALALLTAHLALALWVALAARCQRCACVRATARN
                     GSLRWELRSPGAVYVWGGANNATLAADAPCRHAVVQHIPPGLLDGDEALHGRVRAVAG
                     ARDCRAYLWCAQARGGLLAWLLYVAFVYLRQERRMFGLCRNDADFLSPGGYTLNYAAA
                     ALAAVVGHGPYTKLARLMCELSARRRALAVDFRLDPLGCAWRPRAALPLLAEGFARLG
                     ARIAAAGSVGITHPCAAAYPLYLKIWAWVHVALFAGLELVSLLYRKPRRRGGTCAGDG
                     GDGGESGIRKVCVNCCSTLLAGLLVKALYLAAIVGGVIALLHYEHNLRLRLLGAQT"
     gene            complement(4013..7237)
                     /gene="UL52"
     CDS             complement(4013..7237)
                     /gene="UL52"
                     /codon_start=1
                     /product="component of DNA helicase/primase complex"
                     /protein_id="CAA06081.1"
                     /db_xref="GI:2653295"
                     /db_xref="GOA:Q77CE7"
                     /db_xref="InterPro:IPR004340"
                     /db_xref="UniProtKB/TrEMBL:Q77CE7"
                     /translation="MDGPAALEDALQILYATDGCAIGFSLMLLTGQEEPGRGAYVVSY
                     NWPGRLAACLGGESPNDVALALADARPLVAFYLLGGPPGGSAAATPRLARLRVHLQQR
                     AGRARARRRTAPRQGPTRARAARAPRRGRHLCAARGHDHALLVATEQLAPRTGRTADD
                     ARYVEGQTTVRSALRARPAGRRGLASLYIHHEHKTVAAYRRLYSNSGATPFWFLSKFG
                     PGEKTLVLATRFYVFQAERAGDAATYDLQAVRDCLATYAVAAPPNPSGLAFPDLVSFA
                     ALAAFCCRSGYARGAVAAGAPAYVAARIEADLAEVRCLREYIDHDRRSLKVADPEFVA
                     YVYLAYFEGFNRRQITEHLRAVTATEPPDGGEALAPRLAGVSRLRERAVDAFFRHVRA
                     QFNVQSYIEQNVAVAVVRLPPATAEAYARARTYARLLAATANGPGRTICDGAAALRAA
                     LDHLEGQAARFGWVLHAPGAPSASAVPGPGLDAALRVGAPDGGASPDATPACCGVSKR
                     LLELAAAAARDGAHPLDGLFGARGTAAPTPVYRVELPRGHQAFAVADGDDWAAVTSVA
                     ALDPDEVAVEVAAAAAAAAESGRDALVERDARLTALLTERAACAAGRSDRRSLGPAAP
                     RDQYYVNRNELFNARLAVTNIVLDVDFRLKRPLPRGDLHGAMRSFRRGALAALAALFP
                     EIAADAWPAHPCFFYKSACPSAAASNLGDGDASPSWAAPDRDAGWDEYESALAREGEA
                     QYSCEDVSDPAGARPEETGGAEGAGSAAALTTACGCDDKMGFRVAVPVPAPYIIAGGP
                     TLKGIARLVQHAVMLERPFAEAMSRYLRDFAFVDAAVYTHGHSLRLPFFGKPDAASNV
                     GRWLLPFYVVPERCDDVAAFVAAHRDPHHFHFHAAPPAGGRREARRAHVGGEYVSFFE
                     RKAAVNRAAFHGVRVSLRRALAAVGVDGGDRGAVEEFIADVIEAELAPYMAEHYPQAA
                     REYQGAGARLVAAKADWLLAQLVPARAGTAQGFGCLRAAHGRAAQNKARSLVSLSVDS
                     HDRLCASLIQQCFATKCGSNRLGTVFTVDLSGRAARYAARGADC"
     gene            join(7236..7967,7976..7981)
                     /gene="UL51"
     CDS             7236..7967
                     /gene="UL51"
                     /codon_start=1
                     /product="virion protein"
                     /protein_id="CAA06082.1"
                     /db_xref="GI:2653296"
                     /db_xref="InterPro:IPR007625"
                     /db_xref="UniProtKB/TrEMBL:Q77CE6"
                     /translation="MALQRLVGWLCGRGGGTRDAPQYEPLARRLSGPTLFRLQEAVVA
                     VSALLPAPLTVEDVARSADGTRRLAKAQSLARTYYICQRNIECLSKHQAACSDASITA
                     VVTKHIQDAQRMRDTCLAALLQMYHSVGAVEGTTDSMVDQAIRMAAESNIVMADVAVL
                     ERALGIQAQGAGAEAAARASPTAVGAEARAPPPLPRQPAASAPVAVSPAPPVAPAEAA
                     ATKPPSRAGRAAAAASSPAVLQLAA"
     polyA_signal    7976..7981
                     /gene="UL51"
     gene            complement(join(8029..8034,8045..9022))
                     /gene="UL50"
     polyA_signal    complement(8029..8034)
                     /gene="UL50"
                     /note="noncanonical ATTAAA"
     CDS             complement(8045..9022)
                     /gene="UL50"
                     /codon_start=1
                     /product="deoxyuridine triphosphatase"
                     /protein_id="CAA06083.1"
                     /db_xref="GI:2653297"
                     /db_xref="GOA:Q77CE5"
                     /db_xref="HSSP:P16088"
                     /db_xref="InterPro:IPR008180"
                     /db_xref="UniProtKB/TrEMBL:Q77CE5"
                     /translation="MANSAAATTATMSGDRGILVVELNAEAAPWRLESCCEPDSLALW
                     GPIAPAAKRDETAPSGSLLYSRLINLNMKAAAPGGYAIIMSQMRSGDTHMPRPPAVAV
                     GIVDSGYSGILRAIVWAPESAAAAPPAGLALRLTLARLTTTLPRLIAVDDDANAGTEA
                     GVEVPFFATFAPKRDEDAGYDIAMPYTAVLAPGENLHVRLPVAYAADAHAAAPYVFGR
                     SSCNLRGLIVLPTAWPPGEPCRFVLRNVTQEPLVAAAGQRVAQLLLLARRLEWLPSGL
                     NDREPFPTSPRAAPPAPGAPRLRWRRVADLAAAVPPSARGPRGFGSTGL"
     gene            8970..9260
                     /gene="UL49.5"
     CDS             8970..9260
                     /gene="UL49.5"
                     /codon_start=1
                     /product="virion protein (membrane)"
                     /protein_id="CAA06084.1"
                     /db_xref="GI:2653298"
                     /db_xref="InterPro:IPR008647"
                     /db_xref="UniProtKB/TrEMBL:Q77CE4"
                     /translation="MPRSPLIVAVVAAALFAIVRGRDPLLDAMRREGAMDFWSAGCYA
                     RGVPLSEPPQALVVFYVALTAVMVAVALYAYGLCFRLMGASGPNKKESRGRG"
     gene            9384..10160
                     /gene="UL49"
     CDS             9384..10160
                     /gene="UL49"
                     /codon_start=1
                     /product="virion protein (tegument)"
                     /protein_id="CAA06085.1"
                     /db_xref="GI:2653299"
                     /db_xref="InterPro:IPR006908"
                     /db_xref="UniProtKB/TrEMBL:Q77CE3"
                     /translation="MARFHRPSEDEDDYEYSDLWVRENSLYDYESGSDDHVYEELRAA
                     TSGPEPSGRRASVRACASAAAVQPAARGRDRAAAAGTTVAAPAAAPARRSSSRASSRP
                     PRAAADPPVLRPATRGSSGGAGAVAVGPPRPRAPPGANAVASGRPLAFSAAPKTPKAP
                     WCGPTHAYNRTIFCEAVALVAAEYARQAAASVWDSDPPKSNERLDRMLKSAAIRILVC
                     EGSGLLAAANDILAARAQRPAARGSTSGGESRLRGERARP"
     gene            10224..10229
                     /gene="UL49"
                     /note="synonym: UL49.5"
     polyA_signal    10224..10229
                     /gene="UL49"
     gene            10275..11897
                     /gene="UL48"
     CDS             10275..11792
                     /gene="UL48"
                     /function="tegument protein which transactivates IE genes"
                     /codon_start=1
                     /product="alpha-TIF protein"
                     /protein_id="CAA06086.1"
                     /db_xref="GI:2653300"
                     /db_xref="GOA:Q77CE2"
                     /db_xref="HSSP:P06492"
                     /db_xref="InterPro:IPR003174"
                     /db_xref="InterPro:IPR011077"
                     /db_xref="UniProtKB/TrEMBL:Q77CE2"
                     /translation="MSGRIKTAGRALASQCGGAAAATMDPYDAIEAFDDSLLGSPLAA
                     GPLYDGPSPARFALPPPRPAPLAALLERMQAELGFPDGPALLRAMERWNEDLFSCLPT
                     NADLYADAALLSADADAVVGAMYLAVPGDAERLDLNAHANQPLPAPPASEEGLPEYVA
                     GVQAHFLAELRAREERYAGLFLGYCRALLQHLRATAARGRGAAGAGAQADRLRQLVAA
                     RYYREASRLARLAFAHMYVATAREVSWRLHSQQSQAQGVFVSLYYAWPQRRQFTCLFH
                     PVLFNHGVVALEDGFLDAAELRRLNYRRRELGLPLVRAGLVEVEVGPLVEEPPFSGSL
                     PRALGFLNYQVRAKMGAPAEAGGRLAPEREHSYARPRGAINYGTTPEAMLRPPSPSEV
                     LPCDPAPAATVRVASPATHLAQAPSAKGAAPAEFAALAGLAKPGPAPLAAAPAQAPFA
                     AALALAEPAAALAPAPLAAAPAEPAAAVAGPSPANPFGGTYDALLGDRLNQLLDF"
     polyA_signal    11892..11897
                     /gene="UL48"
                     /note="noncanonical TATAAA"
     gene            11963..14182
                     /gene="UL47"
     CDS             11963..14182
                     /gene="UL47"
                     /function="helper function for alpha-TIF"
                     /codon_start=1
                     /product="virion protein (tegument"
                     /protein_id="CAA06087.1"
                     /db_xref="GI:2653301"
                     /db_xref="GOA:P36338"
                     /db_xref="InterPro:IPR005029"
                     /db_xref="UniProtKB/Swiss-Prot:P36338"
                     /translation="MDAARDGRPERRRAVSGTYRTHPFQRPSARRSAGRPARCGRRGR
                     GAPRVRRPRPYFQRPPDEDTSEDENVYDYIDGDSSDSADDYDSDYFTANRGPNHGAGD
                     AMDTDAPPERAPEGGAPQDYLTAHLRAIEVLPESAPHRSLLERTARTVYAQQFPPRDL
                     SAGSKAPAQRARRSLRGFPRGGGGGQEPGPDDEGDDAADLREDLVPDEAYAHLERDER
                     LSEGPPLLNMEAAAAAAGERSVVEELFTYAPAQPQVEVPLPRILEGRVRPSAFFAQMS
                     LDALCRTPPNDQRVARERRAWEMAGTPHGLLITTWSTVDPEFSIGGMYVGAPEGTRPR
                     LVWRRAMKQAMALQYRLGVGGLCRAVDGAACRPLRRCSFWRDALLRECATAIFCRGRG
                     ARAAPRRLPRPAVGLLAATQFTPPDASPHATLFRGSMGSLIYWHELRVMLTAVPALCA
                     RYAGAGLQSAELYLLALRHSEAPGYTANERYALSAYLTLFVALAERGLRWLYLAGAHL
                     LGPHPTAAAFREVRAKIPYERLPLGSATLHDAEVETVDSATFQEALAFSALAHVYGEA
                     YVAVRTATTLLMAEYAVHAERRDVRQMTAAFLGVGLIAQRLMGSLNLLLNCVAGAAVY
                     GGRRVTVREGTLARYSLLADAALPLVRPVFLVEFREARDGVMRELRLRPVASPPLAGK
                     RRVMELYLSLDSIEALVGREPLGSRPVLGPLVDIAEALADHPHLVTGDGRGPRLGGR"
     gene            14314..16560
                     /gene="UL46"
     CDS             14314..16560
                     /gene="UL46"
                     /codon_start=1
                     /product="virion protein (tegument)"
                     /protein_id="CAA06088.1"
                     /db_xref="GI:2653302"
                     /db_xref="GOA:Q77CE1"
                     /db_xref="InterPro:IPR005051"
                     /db_xref="UniProtKB/TrEMBL:Q77CE1"
                     /translation="MAWPAASRGLIERRAEKGCLLPTLADATAAAVVALQEATEPLCG
                     APLFGAERAAALLGVRSNAVPEALVLSDSAKDADDEYRLEYDRAAARVLAGARLSKDA
                     VWRAVIGSYWKYLKASSGADVNIDGAAGGAAMEQAQLTNVMLFAPTYARRASRSPFKH
                     KQDNAAYKTAAAELRGALRAVEKYMYYMRPGDPMVESPDTEARLQEILAYAATAYRWL
                     LWFMDALDGTVLRKLGKRPSAAVGPREPRPPGELCERHLTGGPGIACGSGAALMLTAL
                     TAAVLALLLRVGAAWTESSWKSNTQGVTGAIVAAVELASAVHHHLQYLLNMAFVGYAC
                     WLRAGVRDPYMIAAIRAQCRFAHFTGQLMPTMTSASWAALERGTASWFKLALLKSVAA
                     HGAQTRYYSNIVESMRLGGSRGLLAPVRARPSGRGRRCPQSLAARPLPSLPAAAAAPP
                     GSGSGSGSGSDSDSDLDLGFAPAVGVYASMRNLEGAYADAGGPLSPAASAARREAAVY
                     ENEGEGEFAPLPSAFAEDGSSDSADELAIDGPMPAPPPRGGRGADELAIDGPMPAPPP
                     RGGRGADELAIDGPMPAPPPRGGRGASAGRLQYADSRAVSSDDDEDEGKDEDENKAGA
                     TAPLAADPESELARAMRRCSLRVPASAPAPAPAPCTERPGNPTRSYSRSRPRLRALDD
                     RHGLEALAAAGAAHTARHNRDVWQRFSRVCEAGDDYENYDEARGAERGHLSCASRARP
                     EVERVTSL"
     gene            16594..16599
                     /gene="UL46"
                     /note="synonym: UL47"
     polyA_signal    16594..16599
                     /gene="UL46"
     gene            complement(16613..16618)
                     /gene="UL43"
                     /note="synonym: UL44"
     polyA_signal    complement(16613..16618)
                     /gene="UL43"
     gene            complement(16683..18209)
                     /gene="UL44"
     CDS             complement(16683..18209)
                     /gene="UL44"
                     /codon_start=1
                     /product="glycoprotein C"
                     /protein_id="CAA06089.1"
                     /db_xref="GI:2653303"
                     /db_xref="GOA:Q77CE0"
                     /db_xref="InterPro:IPR001038"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="UniProtKB/TrEMBL:Q77CE0"
                     /translation="MGPLGRAWLIAAIFAWALLSARRGLAEEAEASPSPPPSPSPTET
                     ESSAGTTGATPPTPNSPDATPEDSTPGATTPVGTPEPPSVSEHDPPVTNSTPPPAPPE
                     DGRPGGAGNASRDGRPSGGGRPRPPRPSKAPPKERKWMLCEREAVAASYAEPLYVHCG
                     VADNATGGARLELWFQRVGRFRSTRGDDEAVRNPFPRAPPVLLFVAQNGSIAYRSAEL
                     GDNYIFPSPADPRNLPLTVRSLTAATEGVYTWRRDMGTKSQRKVVTVTTHRAPAVSVE
                     PQPALEGAGYAAVCRAAEYYPPRSTRLHWFRNGYPVEARHARDVFTVDDSGLFSRTSV
                     LTLEDATPTAHPPNLRCDVSWFQSANMERRFYAAGTPAVYRPPELRVYFEGGEAVCEA
                     RCVPEGRVSLRWTVRDGIAPSRTEQTGVCAERPGLVNLRGVRLLSTTDGPVDYTCTAT
                     GYPAPLPEFSATATYDASPGLIGSPVLVSVVAVACGLGAVGLLLVAASCLRRKARARL"
     gene            complement(18388..19524)
                     /gene="UL43"
     CDS             complement(18388..19524)
                     /gene="UL43"
                     /codon_start=1
                     /product="virion protein (membrane)"
                     /protein_id="CAA06090.1"
                     /db_xref="GI:2653304"
                     /db_xref="GOA:Q77CD9"
                     /db_xref="InterPro:IPR007764"
                     /db_xref="UniProtKB/TrEMBL:Q77CD9"
                     /translation="MFASVRVSGCAGARAGCGPCALAATGALVAMGTHTGLMAAALAT
                     VGRAQDPAAALALTATAAAALVCWRPAAQTLRRRLAPLGRLAQALAVAAALAVWATDP
                     APAVLRGVTTGAAAAYVVCGVPVHCAHFVTAASGTGAHFRTALLTMTCGLLLGLSAGR
                     WGARPEALAAAGAAAALVVAATDAAAALEDTCHYKIWRYAALRTLAPLGEAACPADPC
                     GAREDAVPMRALARAAAAELALSAAALAAAAALWAPGRALGLEGGGRWRTRGAVLLSV
                     AGGHGVALAEHLCLRYARADAADGALMAHVGICALGAALPLCGADGGAPAALASAAAG
                     TLVACVWVRRCGRGTARLAAAHVAKALHAALCFCVGACWVCADE"
     gene            complement(19582..20823)
                     /gene="UL42"
     polyA_signal    complement(19582..19587)
                     /gene="UL42"
     CDS             complement(19597..20823)
                     /gene="UL42"
                     /codon_start=1
                     /product="processivity factor for DNA polymerase"
                     /protein_id="CAA06091.1"
                     /db_xref="GI:2653305"
                     /db_xref="GOA:Q77CD8"
                     /db_xref="HSSP:P10226"
                     /db_xref="InterPro:IPR003202"
                     /db_xref="UniProtKB/TrEMBL:Q77CD8"
                     /translation="MLQPPSHLRADEGEARLTAGLSDGGNGNPIASASLIGRQLADVS
                     ALLSPFGASLRNAFLVFSREGMLVHSGLYDEQVYVAVPAEKFTSFQWAPARDDARAVF
                     LANVDSRRGLLDAFRADKTRTVQNVAFLITGEPPASVLTQVTYFREADALLQASLVKH
                     ELGEYSIMLPTRGADLAVSLSRPQLSKLQAVAKDPNEAVVFAYRRARCLSAESASGRA
                     SFAARHEGGESGAELQLALAPSAGSERIFARAQGGGRRAALLEVRCSGGAPDFRLELE
                     SPSGFRRLLQKVRQVGGDALVRFYLAPASAAMMSVSTAAPEGLTVFFFCRPATATASA
                     DDADDCAEPAPRLPAKRPAASGQPRRGAGAGIQTDGAHPVAVSGGRARKRPRADAGAP
                     GPSSGPDRGGEGGETP"
     gene            21068..22448
                     /gene="UL41"
     CDS             21068..22447
                     /gene="UL41"
                     /codon_start=1
                     /product="virion host shutoff factor (tegument)"
                     /protein_id="CAA06092.1"
                     /db_xref="GI:2653306"
                     /db_xref="GOA:Q77CD7"
                     /db_xref="InterPro:IPR002927"
                     /db_xref="UniProtKB/TrEMBL:Q77CD7"
                     /translation="MGLFKLLRYAYGNRLVKHDAITTPPGVMTPIAVDLWNVMYTLLE
                     RFCGDAPGGVGDAAATARCFLSLLRMLLKRSYYPIFVADRGIHGDRRATRGAKAIVAQ
                     TMRAVGGSGRLGRLVSDDYTSEDEVLGAYEYPVPHADAAADDDEEATAKEFAGRASAG
                     AARANAPKLAHRVCVSLIRFLGYAYVDAAEMEADDVCANLFHTNTVAHIYTTDTDMIL
                     MGCDLILDAAPLFPPTLRCRDVLASLGLTYGQFLATFVRCHTDLHQPPMLRSVQQVVR
                     GLRRAAEAEPATTETESGSEREPESELGRPGAGPRRRLPPAVDDPLKTTTPATVEAHS
                     VRMKYTSRYPPIAQTCADALRLLPASQTRGGVLERKFVKHVVDTIAPRMRGRWAVLKR
                     VPIAQDAPDPRLVYDTIVSAVGSAAEADTLMGLFWKHIPTPPPFAKVLADYWDEAPAG
                     PGSRRTTRQ"
     polyA_signal    22443..22448
                     /gene="UL41"
     gene            complement(22494..22499)
                     /gene="UL39"
                     /note="synonym: UL40"
     polyA_signal    complement(22494..22499)
                     /gene="UL39"
     gene            complement(22563..23507)
                     /gene="UL40"
     CDS             complement(22563..23507)
                     /gene="UL40"
                     /codon_start=1
                     /product="ribonucleotide reductase small subunit"
                     /protein_id="CAA06093.1"
                     /db_xref="GI:2653307"
                     /db_xref="GOA:Q01319"
                     /db_xref="InterPro:IPR000358"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012348"
                     /db_xref="UniProtKB/Swiss-Prot:Q01319"
                     /translation="MAEAADAATLTRKYKYFYETECPDLDHLRSLSVANRWLETEFPL
                     ADDAKDVARLSGAELEFYRFLFAFLSAADDLVNVNLGDLSELFTQKDILHYYIEQESI
                     EVVHSRVYSAIQLLLFRNDAVARAGYVEGALGDPAVRRKVDWLERRVAAAESVAEKYV
                     LMILIEGIFFSSSFAAIAYLRTHNLFVVTCQTNDLISRDEAVHTAASCCIFDNYLGGE
                     RPPPARIYELFREAWKLSASLFGCAPRGSHILDVEAISAYVEYSADRLLAAIQLPPLF
                     GTPPPGTDFPLALMTAEKHTNFFERRSTNYTGTVINDL"
     gene            complement(23526..25889)
                     /gene="UL39"
     CDS             complement(23526..25889)
                     /gene="UL39"
                     /codon_start=1
                     /product="ribonucleotide reductase large subunit"
                     /protein_id="CAA06094.1"
                     /db_xref="GI:2653308"
                     /db_xref="GOA:P50646"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR008926"
                     /db_xref="InterPro:IPR013346"
                     /db_xref="InterPro:IPR013509"
                     /db_xref="UniProtKB/Swiss-Prot:P50646"
                     /translation="MASDAFMQTACPADAAEQLEAEHAEWAQLGCGAVPPPPAAASRP
                     SRAAVAAYVGEVVDRMRAQSRADERVYVKCGQLVHLRVRARSVPLDDWLTSAELALVS
                     EVAEPVRANRAFVEVSLRYFELTEYATLRALGLQSALKYEEMYLAKLEGGAIESMGQF
                     FVRIAATAATWTMREPAFGRALVGEGATWCAVFNAYLTALYRQLVVPATPIMLFAGRA
                     RGSLASCYLLNPQVSSSTEAVEAITTEVARILLNRGGIGISFQSFDRAVSRDCKRGIM
                     GALKLLDSMAMAINSDSERPTGICVYLEPWHCDVRAVLNMRGLLARDESTRCDNLFSC
                     LWVPDLLFDRYLAHLEGREGVVWTLFDDRASHLSRLHGPAFTAEYERLEREGLGVETV
                     PVQDLAFLIVRSIVMTGSPFVMFKDACNRHYHMDTAGDALTGSNLCTEIVQRASPDAH
                     GVCNLASVNLPRCVREGEGGALAFDFAALSTAAATAAIFVNAMMLGGQYPTEKAARGV
                     ARHRSLGIGFQGLHTLLLELGMDMLSPAARRLNVEIAERLLLAVMATSATLCEYGCAP
                     FEDFARSKFARGLMPFDGYEGVVLSLPRAWARLREKVARHGLYNAQFVALMPTVSSSQ
                     VTEGSEGFSPVFTNMFSKVTMSGELLRPNLPLMRALRKHFTREASRLGAVRALDREQW
                     SVAAALGDLAPGHPLAKFKTAFEYDQERLIDLCADRAPFVDQSQSMSLFVTEPMDGKV
                     PASQIMNLLVYAYKKGLKTGLYYCKIRKATNNGVFTGGDLVCSGCHL"
     gene            complement(26202..27655)
                     /gene="UL38"
     polyA_signal    complement(26202..26207)
                     /gene="UL38"
     CDS             complement(26231..27655)
                     /gene="UL38"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="CAA06095.1"
                     /db_xref="GI:2653309"
                     /db_xref="GOA:Q77CD6"
                     /db_xref="InterPro:IPR004999"
                     /db_xref="UniProtKB/TrEMBL:Q77CD6"
                     /translation="MAAPNGSSSYIQIGNHLRMRLPAAAPPFSGVPAAAAAAAEASAA
                     EAGVQSVTAPAVGGARGRAPRGYNPWAGGMLHVSDATVTIQNMSGIQIVTPRQIAVDT
                     PAGTAVLSPGGQPHIRLSRQVTLTDFCDPQLERPGAPVLTLKHPADIIGLAAAAAPPG
                     RQFRDVEEAWRDLGDASSVGAVPPGGLRASLVSFSFLAAACAAEYGNRAAADALRAHL
                     ISNSGDRRMALRLDRFYACLQAMIRCRAFPHQALGCLGGLLSWTTQDKLASVTAVVCG
                     AQEGARTDQAAHPRSTAHVPACAFLDVDAELRLEPAGVKFVYLVFVYTQRLEHEGFRA
                     HVAVSKLNETTFASGLSYLLHRTRAENVLRGTAGDAAEVAGAADEFPLPALANSRAAY
                     RCPVSRLGDCDATAFLPRWAPDAAGRPTRESCMYAAFARLGTLPHDSPRVTCRSERYQ
                     SCDVPVVKIEGLVWGTGDWVECFY"
     gene            27871..30945
                     /gene="UL37"
     CDS             27871..30945
                     /gene="UL37"
                     /codon_start=1
                     /product="virion protein (tegument)"
                     /protein_id="CAA06096.1"
                     /db_xref="GI:2653310"
                     /db_xref="GOA:Q77CD5"
                     /db_xref="InterPro:IPR005655"
                     /db_xref="UniProtKB/TrEMBL:Q77CD5"
                     /translation="MSGDPVRALWAALERLDGEVAGPAALAEARAAVSEFLLASGPSS
                     LDFVAPRWAALQRAACRAYERLHTPDAALLAENLPGLVLWRLPGAARDTADFMAGVRD
                     LANSMIAEAPLGYLAAARLRATAAFGPVNMQRVVVEWASLFLEIYAREDAACVGVLGP
                     DPACRSPAGSAAVIRPLLQSRFRLLYDMPFFQAGLSALAHAANWKVPMAAVARRAADA
                     AAPPLARALFAVALVDEYFPEPDDEDTAPGLAEAFAEIADLVPPEALVPAGEANAFAR
                     SSHDVRVSAALAYRDPFVRGAAAGSVAARVRADAGLLADDTLLGRDAVAVHAGAVVRL
                     LERAAARATPAALGRVAEHAAAVWDAVQASATPDQAVETLAAAGFTPGTCAMLERAVL
                     AQLSRPEPRAPADVLQAVGCVAVAGGVLFKLFDAYGPSADYLAHYTATIANLHPYYAD
                     VLPLLGLPDGGLEQTIRHCMAPRPRTDYVAAIRAALAAEAAAADKRAASASARAAVEN
                     SGDRAAAGAAAREALLTWFDLRASERWGVAPPAAEAPPAAEAARSPAAGGASAAELAR
                     AARALEFPRTDAVPAAVLRDPAFAPHFAAAVLSDVLVAADALPFSANGVAQLMALIAW
                     ARDCGAGAVANVDGYRTKLSALAAGLWPFVDASAPAPTTTQVRNAEAVLGELHTVATT
                     AAECLPPEVRPPVPARPRVGGCVFLASMYLHAAFARLQGYVAETEALAASMAAAVGDV
                     AGAVARLGVLFDCHFASVPGQQMLAIYATRGAPCALGAWRSADLADAVRGARAEAARA
                     RAEVRVSLAALQRAAAQTTQALQECEAADARPPGGGLDDEHRALLAGHSALVRAQTAL
                     ALAAGKLVAGAEAPGLHEVGRFLQRWDAIGAALGRALDDSAGERDVAELVARLRGVWD
                     EVQEDRRVAAPGPPRSAANAAAAEEAVLALLEGYPEVRGDEGSPALLDARADVADWAG
                     VDRGPLQRRASAGADAAASAAAANTAAGPWLTTEDLLAEVDGVCASRPAAAR"
     gene            30908..40651
                     /gene="UL36"
     CDS             30908..40651
                     /gene="UL36"
                     /codon_start=1
                     /product="very large virion protein (tegument)"
                     /protein_id="CAA06097.1"
                     /db_xref="GI:2653311"
                     /db_xref="InterPro:IPR005210"
                     /db_xref="InterPro:IPR006928"
                     /db_xref="UniProtKB/TrEMBL:Q77CD4"
                     /translation="MAFAPVARPQPGEARAGGAAGGLRINGAARAVPPSTPVEQRSGT
                     MSGVAGARAPATPADVAVAAVGFRNQYDAALGPGSAVACLRSSLSFLRLAFAGGVDAA
                     LGADAIDGALAEGAAWARESGARPEMCSIVHLPNRITDQAGAGSGLCCVFSRVYGECG
                     FYTPPAERALSTQVPAREFVDAVWQPRRTSLALVIVGAMGVGVFRAGDAVYLFDPHGS
                     GDVPQAFVARMPPRALYAYLALRACGQPESRWAGALVHFVSAGPEPARPEELRAAVSA
                     LYGASETYLDDEPYVERRVVSVHPRAPANTACLTAVAVGGAGAECEDPTFARPGSPAL
                     LPAEPVARMPPQITAAAAARAAGKRTSLPRRRRAPWTPPSSREDLRAPAARARAGKPP
                     RKVRGAETAGAGEDWGEGGNAAAARPPPALGAAAPAHAATACAAELGARAAEVTAALD
                     AVQAHAASIAADADACVARAVRVARPRDAAAERDPLEHAIAGLFERVLAFLVQNGART
                     RHDAPSAVQPLFGAVAQALPQHTPASAFITSSGMVLEGLAAYTRLSEAMRAQPSALGD
                     LADAKLRLVAAAVAADTERLHDAVDELEGEVDGAGGAGPLELCGAVSARFMERLSASG
                     RRLFSRAALRDGRPLDARVRALFERARAREARVAAETAALAREILALEGTVRAARERL
                     DAVPPDDPRAVPADSAVADLAAELAAGRAAVVARSAAALSAELDALAAEALRQYFLRG
                     AQYSARAILADRGGGERFRVASAAVAPLQRLAGSAPDLAARVARLGAAPGAAAPPLPR
                     SARKGELLRDLLAAGATAHTEDGLAAWVALLHEAQAEGAAAKKELDAVLSDVAAINGR
                     SASRASLEASMARFEAMSAAAARAAAGAAAEAPGAGAEEAADAAEAAVRGADDVLRQL
                     DALATGAAADREARARVAAARAGLEAQALAARRRVAELGERRAELYQRLDALLLPLQG
                     FAGLRAAPGALERLCADAGAQSAEDCARFLQEAPPRVAAGVQDRLWQLFGRYREALEN
                     PSALAPGALAGLGPAFAAVLGTALGQAMGPAARAFFEGHAERVAAAVARAAAEPAAPA
                     AVAAAASALREAAEALRAGGAHVPPEFAFLDALQAQYAARREAQTGARRLGAALAAVS
                     EASGALASAASALKNAMTAGADAAETTAAAAAADAALGAAEEVLRAADEAAVAAGGED
                     ADGGEDASEADADGAGDAPPAGRLGPQAAKLHADLRKARALARRRAEEVRRLRAEAER
                     RAEGAAAQRQEERWREDLRAALERVEANSAFDAAELARLRAAAAARGYDPRPLARQAD
                     RALEASAQRATAAIEAVLAFNPHAPENAKIDVPPPLAQLRGIAWWDAFSLAAPALSAL
                     FPAADVGQLTRLMHIATGLLTFAASGGGEPRYYDAVTYLEGDLAAVPRLAKYVAFYRR
                     GHAAFEEERARLGALRADVLQAAGGRAAEISRARRGNVLRSPAERRALEAGVRLELPS
                     EALIASALAQLERFDHARFAGSAYEAQMLSTVRRDAAAAREALEAAKAARAEATARAE
                     RILGEVVAAEAARDRDEGAGLANLKNLLRITPPPAALGPALDRAASAADVVTQAALLL
                     AAVEEAPELDVAAVEWLQQARSIIDSHPLTARIDDRGPMEPFAERIDALRELRRHLDA
                     LRRQLESAAAAWDGAWELFVAARRRAAASREDHEGAKARAAALQAAAGVVLGLRADEH
                     YARLPAAFTGALDARLAERGDALGAFHEAARAADAGLQRLQATLAAVRGEAAYEGLRA
                     LLAAFDAQVAELPAWAAQAHAPFRDLLVLRMRLYEAYFKLVPRAAARARGAAAARAAR
                     AAATVHSRADPATRAVAARAARLCERDLHLRGRVAALLGDEAAVCTLREADSEIDALA
                     PRAYLDADGTPLCYRVCYRAVGDKLAVALCSQVGASMRPPLDESGVVEAASVAAVNVL
                     NEIVNLRLEIERARDADFGAFCRFVRHRRADWGLADVRSAAAELYAGLLATTLPRRHG
                     VASLGALCFSLAERGLRPARAPASGPAPSGGGALELTPADLVVAALMGAFMHLVNFTR
                     LDLVQKQEYMCKTLDGVLTEALTSRVAVNSLAPGEPGARRPVPLGGGADDPADGALFA
                     IRAADWDAGRLSPSDVLAVWRHAPDAATRATVAELARLIPGGALTTISVLARMCIPGD
                     LLAALWTTLAVDSLGAQTQSYDAFLARRLDAPSTVHATGGPSEDAAALAAAAAAAGGR
                     PALFCPTGSSVTFTLVRQPPSEVQTVNALDLVTCALLLGAPVVVAMENPDVFSEGSRL
                     IMCLRLFDTRPGGRDADAPAAVSSDLNSWGERLLALDENIIENACLTAQLEQLSALIA
                     SKPLRSAPPCLIMLDTHLQLARVLWARAAAPPLAMLKIAEDDVLRDLPSLTLDYEDAL
                     PPAASAADPLFTHIISENNVPDFAAASGDPLYAHPPVFQHATDNLFPHARAAAGGGSG
                     NRVANARAVAAAARPPTPASAPAPAPALAPASAEPALAWGADEWLDDEIGDAYPPAPA
                     HDAYPPAPAHDAYPPAPAHAQGKPALLAAPAAGAAEAPGVERARRLTRRTGPRKSMPA
                     ALPWRRPPPASLVSAAPPVPPGPRLPPAPPLPPPAPPLPPPAPPLPPPAPPLPPPAPP
                     LPPPAPPLPPPAPSTAPVPAPPLPPPALTPALTPAPTPAPTPAPPLPLPAPITVLVPA
                     PVPAPAPIPAPAPTPAPAPTPAPPLPPPAPDGAMGALSATRRPTRRAGARKSLPAAQP
                     RQRLLRSRSPASVPAPGSELVPPPSGGALGSPPSFVPSRPPSLEPVPGLPLPPSRVQA
                     PVDAPAPPPAPERPAPPPAPERPAPPPAPERPAPPPAPERPAPPPAPERPAPPPAPER
                     PATAVQSGSKIPAPSNALVGQVAPALLRRGPSPRGKPGAPARPTGGANIARKNTRAVD
                     PTVIGSGSALSGLGSAEEDADFGASGMYVAPPGPAPLAAPPAPSALPAPRLEAPAAAS
                     LPAPPIAPPIAPPIAPPIAPPIAPPIAPPIAPPIAPPIAPPAMPAPPSAAPATAGSSA
                     PPIAPPATPAPLIAPLAAPVPRLVGAAARGRVIGHMRAAAPKPRGLRAAERPPMRSWA
                     SRGNLHTQDLLASAEARICELPAPPKVPLGADSDATDSSLDGSGPETEEETEAEAGGD
                     GPGQDAPKARVVPANSLLKRQYLRGTGISVLALLLEACEKIARRLRATRDVLRQRAAE
                     VTADIFALRLLLG"
     gene            40728..40733
                     /gene="UL36"
                     /note="synonym: UL37"
     polyA_signal    40728..40733
                     /gene="UL36"
     gene            complement(40769..40774)
                     /gene="UL34"
                     /note="synonym: UL35"
     polyA_signal    complement(40769..40774)
                     /gene="UL34"
     gene            complement(40812..41186)
                     /gene="UL35"
     CDS             complement(40812..41186)
                     /gene="UL35"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="CAA06098.1"
                     /db_xref="GI:2653312"
                     /db_xref="GOA:Q77CD3"
                     /db_xref="InterPro:IPR007584"
                     /db_xref="UniProtKB/TrEMBL:Q77CD3"
                     /translation="MSAPAGIDPSAPATITPDTLRDLLPVQILHVLNAAARPLQDGTT
                     PEQVSAARRNLLVGTSLAMVDLRRRHEKAVVPRVPMFATYDHAHWARPTIGLKRTFLP
                     RVVQLPPEYEEDAGAAASAART"
     gene            complement(41231..42013)
                     /gene="UL34"
     CDS             complement(41231..42013)
                     /gene="UL34"
                     /codon_start=1
                     /product="virion protein (membrane)"
                     /protein_id="CAA06099.1"
                     /db_xref="GI:2653313"
                     /db_xref="InterPro:IPR005209"
                     /db_xref="UniProtKB/TrEMBL:Q77CD2"
                     /translation="MHGRERDCDGEGEGEGSSRSLMARIRLLVAGNLQCGEGDVPQPW
                     DPRRPPARCVFQFNGQDGSNESFPLEYILRLMASWAQTDCDPYVRVQNTGVSVLFQGY
                     FSRPPGAPLAAITAEQNNATLASTQSTGLSLSALEKIKARGGIDPRPFRAMMSVSCFV
                     RMPRVQLSFRFMGPGDSHRTGRLLDRAVRERLSERDVRSRRASACGHSERELEPAGGA
                     GNVAHYAGALLTARRQKMAALATLVGGVCGILAILRLFWAPS"
     gene            complement(join(42086..42091,42124..42450))
                     /gene="UL33"
     polyA_signal    complement(42086..42091)
                     /gene="UL33"
                     /note="noncanonical TATAAA"
     CDS             complement(42124..42450)
                     /gene="UL33"
                     /note="involved in genome cleavage/packaging"
                     /codon_start=1
                     /product="UL33 protein"
                     /protein_id="CAA06100.1"
                     /db_xref="GI:2653314"
                     /db_xref="GOA:Q77CD1"
                     /db_xref="InterPro:IPR005208"
                     /db_xref="UniProtKB/TrEMBL:Q77CD1"
                     /translation="MRLRELIPPEALATEDVAELERRYLQSEGAAVEIWFEDVAPREL
                     EVLLPTTDAKVNYLAFSARLASTIAHGSGGRAACSHTRALEARKERFATVINKFLDLH
                     QILHDA"
     gene            42431..44236
                     /gene="UL32"
     CDS             42431..44236
                     /gene="UL32"
                     /note="involved in genome cleavage/packaging (cytoplasm)"
                     /codon_start=1
                     /product="UL32 protein"
                     /protein_id="CAA06101.1"
                     /db_xref="GI:2653315"
                     /db_xref="GOA:Q77CD0"
                     /db_xref="InterPro:IPR002597"
                     /db_xref="UniProtKB/TrEMBL:Q77CD0"
                     /translation="MSSRSRMFARADDGAGGGDGARSWAEGAFRAPYVAFDPALLKEN
                     GQLLEELVFAAHLMEVPSPRDDGDEDGGGDRDGAAAEGGGSADVVPFVEEAAAALAID
                     RPCAVCRTIDAYRREFGLAPPWVADYAMLCAKSLAAPPCAVAIVVAAFEFVYLMDRHF
                     LAAHRATLVGAFATRVLTLVDVHKHFFLHVCFRTDGGVPGNNAGNAAGGARRAAEKVR
                     YSNYSFLIQSATRALLARRRRRPEAPAVPADGAGPRALRPQSLATALLSWKECARLVD
                     CSAPLPGGGGGARAARRPGGTCCDAARARAAEYEARAAVLPSPRGGDADEASAASAAD
                     GAPADRWAYADLALLLLAGVATRGDGAVAERAIASRRAAVDRYWAARAGFLAANTAPR
                     FARFAAGDARPSVALGPVLATALKHITGRGRTTGECVLCNLLLTPAHWRALRALRADV
                     VAHSANNAGLFDCILPVLDARAGAPVEGDGGRFFAALALLEPEAVYKHLFCDPMCAAC
                     ELQADPEVLFAFSDGDARDADELDLYKARVASENSFEGRVCAGLWALAYAFKTYQRFP
                     PKPTACAAFVRDAGQLLRRHGVALVSLEHTLCHYV"
     gene            44229..45314
                     /gene="UL31"
     CDS             44229..45314
                     /gene="UL31"
                     /codon_start=1
                     /product="UL31 protein"
                     /protein_id="CAA06102.1"
                     /db_xref="GI:2653316"
                     /db_xref="InterPro:IPR003868"
                     /db_xref="UniProtKB/TrEMBL:Q77CC9"
                     /translation="MSDRGERRRAREPSPDFGCGRGAERAGDWATAPASTPAPAPGRR
                     SLISPRLCSRSRSRSRSRSPFAPQGRSRSRGPATRRERLRSRTGARRAARARDSYLMY
                     FRFLASSPADELAAVRELAVPLIRTTPVVLPFDLSRTVADNCLSLSGMGYYLGIGGCC
                     PACTVTGEPRMGRADRALILAYVQQLSNIYEYRAFLASIRALGGTDDGGFGGCAPGPG
                     GPTERALAEVLAQPELFFAYHVLRDGGVRDARVLFYRDLDCSGFMMYVVFPGKAIHLH
                     HRLLDHLLTACAGYKIVAHVWQTMFVLVVRRDGGGGRQQSATDAEVPAVSAGDLYCKM
                     SDLNFDGELLLEYRRLYAAFDDFAPPA"
     gene            complement(join(45217..45222,45238..48978))
                     /gene="UL30"
     polyA_signal    complement(45217..45222)
                     /gene="UL30"
     CDS             complement(45238..48978)
                     /gene="UL30"
                     /codon_start=1
                     /product="DNA polymerase"
                     /protein_id="CAA06103.1"
                     /db_xref="GI:2653317"
                     /db_xref="GOA:Q77CC8"
                     /db_xref="HSSP:P26811"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q77CC8"
                     /translation="MDRDCEQGTAPPRAGFFNPYLAPRGRGAPARQGPDIPDGAGEAP
                     ADEAAGRGGGRAAESYCTAASSFRFIAPRCLDADGADGGTDDEAAGAAAPRRRGVHIG
                     TAERAPKVYLDGEEHDILDFAGHCCWPRRVSVWAGRAAPERAALDPRFERFHVYDIVE
                     TTEYPSAGDASRFAAEARPGGATVVTLLGMSEDGKRVAVHVYGVRHYFYMEKAAVDLA
                     CGVRDEGQLIDAMVAALRSSALAAGAAQQDAAGRAGARRPGGYLGRASRDSLSVAVVE
                     AADVYFYDTRPQLFYKVSSASARLGGYLCDNFLPGVTKYEGHVDVTTRFLLDNEGFTS
                     FGWYRLRPGRAGARALRAPAQHATSCDVEVNCTADNLEPIAGAEADAWPDYKLLCFDI
                     ECLSCAGDGLAFPAAANAEDLVVQISCLTYSLRTQRHEHTLLFSLGSCDLPPAFLGAC
                     AAAGLPAPAVLEFDSEFELLLAFMTFLKQYSPEFVTGYNIVNFDWAYISEKLTAVYDV
                     RLDGYGKLNRGGLFRVFDAGQNRFQKQSKVKINGVVSLDMYRTAVEKLKLPSYKLNAV
                     AEEALRERKVDLDYKDIPRHFAAGPEGRGVIGEYCIQDSALVGKLFFKYLPHLELSAV
                     ARLAGITVSRAIFDGQQIRVFTCLLRLARARGFLLPDTQKRLAGAEAGAARGAGRGRG
                     ERFACWADAARGEEEEEDEGGEEDGGNEGRAGAADRPRAAGGRAVGYQGAKVLDPESG
                     FHVDPVMVLDFASLYPSIIQAHNLCFTTLVRREAAPAGLTPGADYATFDVGGRALHFV
                     RAHVRESLLSVLLRDWLAMRKAIRARIPTAAPEEAVLLDKQQAAIKVVCNSVYGFTGV
                     SNGLLPCLAVAATVTTIGRDMLLETRRYIHERWATPEALVRDFPAAGPAAAAAGRYRV
                     RVVYGDTDSVFVKFAGMPYDAVCALGDGMARRVSAALFRPPIKLECEKTFAKLLLITK
                     KKYLGLVGGGKMLMKGVDLVRKNNCRFINAYTRRLVDVLMHDDAVSRAAAEASAVPPS
                     EWPGRQLPPGFARFGAVLAEAHAKIADPALDIGDFVMTAELSRPPEAYANKRIAHLTV
                     YYKLLLRSEARPNVKDRIPYVIVAPGEGVERDAAAVNALRGTAPSAPPGGGARPGRLL
                     ISDMAEDPGYARAHAVPLNTDYYFSHLLGTVGATFKALFGNDTRTTENLLKRFIPETR
                     ACDRRLQGRLAAAGFAALTPAAQSRQTLRTAFGILAAAPHQS"
     gene            45379..45384
                     /gene="UL31"
                     /note="synonym: UL32"
     polyA_signal    45379..45384
                     /gene="UL31"
     gene            49233..52953
                     /gene="UL29"
     CDS             49233..52844
                     /gene="UL29"
                     /codon_start=1
                     /product="major DNA binding protein"
                     /protein_id="CAA06104.1"
                     /db_xref="GI:2653318"
                     /db_xref="GOA:Q77CC7"
                     /db_xref="HSSP:P04296"
                     /db_xref="InterPro:IPR000635"
                     /db_xref="InterPro:IPR011029"
                     /db_xref="UniProtKB/TrEMBL:Q77CC7"
                     /translation="MDAAAKTVALAPGPAGFVYVCDAARLDLDKLALLAARSRDSLLA
                     VLPLVRGLTVETAFAPNVAVVAGTKTTGLGGAGLTAKLTPSHYHPNVFVFHGGERLRA
                     STAAPNLTRACEQARRRFGFSAFAGAPVDGAVETTAEDICRAVGASPETALVFLATTE
                     AFKETVYMCNTFLHYGGAAPVQVGAGEAVRVPLYPVQLYMPDVNRVNLEPFNARQRAI
                     GEQLAYPRPFYNAALCELLHGYVLGPAAVALRVRTLDAVARGAAHLAFDESHEGAVLP
                     PDVCFTVFDQPAGRGGGRGSARGADPGAAKAAAPGGVERRLASVMAADTAVSIEAAMS
                     TSVFDEDVACVDDWPMLQGAADDAAKLDALGAYVGRLAGLVGAMVFSSNSVLHMTEVD
                     DGGAADAKDGAAAGFHRFYQIAAPYAAGNPRCDKDGKPLPQTGAGPAVSINGAGQEFA
                     LDHLALACGFCPQLLARMLFYLERCDAGAFAGRNDMDALKYVASTLEGDVPCGLCSRD
                     DRHACAHTTLHRLRHRLPRFGAPTRSPLGVFGTMNSAYSDCDVLGNYASYSALRRPGA
                     DENARSIMQATYRAAVENVLAELDQQRLLAHDAQSAAQLERAITDHASFRGALAAIQN
                     TVEQATEAFVRGLVEDRDFKMREALYEANHTLSLALDPYSTAVCPATAFLFRRSVLAV
                     VQDLALSQCHGIFCGQPVDGRNFRAQFQPVLRRRFMDLLNGGFLTTRTVTVTLAEAAV
                     AAPNLAAAQTEPPARDMDGDISKVSLEVFKEMRVKNRVMFSAGNANMSEAARARVLGL
                     AGAYQKPESGGVNILSGPLGFLVKQFHRKLFPNGKPPGSPTPNPQWFWTLLQRNQMPA
                     RLLSKEDIETIGAVKRFSDAYAAINYVNLTPGNVAELAQFYMANLVLRHCDHKQFYIN
                     GLTAIVAGARRPRDPAAVMHWVRRRIADAPDAAAAAEEVLREAEARPEVWAGTFAASN
                     LVRSVMATRPAVVLGLSISKYNGSAGNNRVFQAGNWSGLNGGKNVCPLLCFDKTRRFV
                     LACPRAGFVCATAGAGGANRDNTLVEALREIINGSNGALAQTAVYGAVLQALGPRVEH
                     MDLDDWAALVEDEFFAQSMVELTERAAARPGGWSPEGAADMLRELELEAAAEAEPAGG
                     AFDFGACASAAPDATYAFGGPVAGAGPAAPGAKRPDLDELFEMGVPDKRPALTIDMV"
     polyA_signal    52948..52953
                     /gene="UL29"
     gene            53058..55538
                     /gene="UL28"
     CDS             53058..55538
                     /gene="UL28"
                     /codon_start=1
                     /product="ICP18.5 assembly protein"
                     /protein_id="CAA06105.1"
                     /db_xref="GI:2653319"
                     /db_xref="GOA:Q77CC6"
                     /db_xref="InterPro:IPR000501"
                     /db_xref="UniProtKB/TrEMBL:Q77CC6"
                     /translation="MAEPTAAAAARSGLGSEPGPALGPDAEPGSAFGGAAARQRLLAI
                     LGQVQTYNFQLALLGRCDPAVARRHLDAVKLNALMVRWLRRRLGGALRAQARVRLTPL
                     TYALDLALDHAAAESDALLAAAGTASAPAEFFARTMGLEGACRFHRRARLALYGGETI
                     DIEIQFLHDVENFLKQLNFAHLLASTDAALAALGDVDAFLRATVAGGGVAPPELHDFA
                     QPCLVCFEELCVTANQGESVGRRLALCACDHVTRQLRVRTELCSVGQYLPHVQGVSRA
                     RLAAAAAALAALAAPTAAGAGGPPVLATAPPGGDGDGGSVREAAASVLDAHHVFRPAP
                     RWLYAVSELQFWMSSSARGEAAASAVAAFAGNLEALAAREAQHRLQVAAAEMALFGRS
                     PEHFDRALADKLAQLDGVDCLLVGSAAVAPDERLEALIRACYDHHMSASLIRRLTRPD
                     QRNEDALRELLRRAAAGEAGAAAVGLGGPGRDEGGGDEPEEEGGTDNDGGAGAGVGGG
                     GAGPSGGADGGGGAEDDGPAGWAALAARARADADVRRQRYAERLSKRSMDSLGRCIRD
                     QRRELEKTLRVSVYGDVLLNVYVAVHNGFCARRAFRAALASAGTVVDNRASDATFDAH
                     RFMKEALLRHAVDPATWPALTHQFFDLVNGPLFDGSAHNFAQPPNTALYFSVENVGLL
                     PHLKEELAAFMLAAAGGGWAVSDFQQFFCFASARARGVTAAQRLAWQYIRELVLARAV
                     FASVFHCGRVPLLRADRTAPGPDGRQSCPSGVYLTYEESWPLAAVLNAPRAPETVGED
                     SVVIYDRDVFSLLYAVLQRLAPAGRAPR"
     gene            55394..58192
                     /gene="UL27"
     CDS             55394..58192
                     /gene="UL27"
                     /codon_start=1
                     /product="glycoprotein B"
                     /protein_id="CAA06106.1"
                     /db_xref="GI:2653320"
                     /db_xref="GOA:P12640"
                     /db_xref="InterPro:IPR000234"
                     /db_xref="UniProtKB/Swiss-Prot:P12640"
                     /translation="MAARGGAERAAGAGDGRRGQRRHLRPGRVLAALRGPAAPGAGGA
                     RAALAAALLWATWALLLAAPAAGRPATTPPAPPPEEAASPAPPASPSPPGPDGDDAAS
                     PDNSTDVRAALRLAQAAGENSRFFVCPPPSGATVVRLAPARPCPEYGLGRNYTEGIGV
                     IYKENIAPYTFKAYIYKNVIVTTTWAGSTYAAITNQYTDRVPVGMGEITDLVDKKWRC
                     LSKAEYLRSGRKVVAFDRDDDPWEAPLKPARLSAPGVRGWHTTDDVYTALGSAGLYRT
                     GTSVNCIVEEVEARSVYPYDSFALSTGDIIYMSPFYGLREGAHREHTSYSPERFQQIE
                     GYYKRDMATGRRLKEPVSRNFLRTQHVTVAWDWVPKRKNVCSLAKWREADEMLRDESR
                     GNFRFTARSLSATFVSDSHTFALQNVPLSDCVIEEAEAAVERVYRERYNGTHVLSGSL
                     ETYLARGGFVVAFRPMLSNELAKLYLQELARSNGTLEGLFAAAAPKPGPRRARRAAPS
                     APGGPGAANGPAGDGDAGGRVTTVSSAEFAALQFTYDHIQDHVNTMFSRLATSWCLLQ
                     NKERALWAEAAKLNPSAAASAALDRRAAARMLGDAMAVTYCHELGEGRVFIENSMRAP
                     GGVCYSRPPVSFAFGNESEPVEGQLGEDNELLPGRELVEPCTANHKRYFRFGADYVYY
                     ENYAYVRRVPLAELEVISTFVDLNLTVLEDREFLPLEVYTRAELADTGLLDYSEIQRR
                     NQLHELRFYDIDRVVKTDGNMAIMRGLANFFQGLGAVGQAVGTVVLGAAGAALSTVSG
                     IASFIANPFGALATGLLVLAGLVAAFLAYRYISRLRSNPMKALYPITTRALKDDARGA
                     TAPGEEEEEFDAAKLEQAREMIKYMSLVSAVERQEHKAKKSNKGGPLLATRLTQLALR
                     RRAPPEYQQLPMADVGGA"
     gene            58223..58228
                     /gene="UL27"
                     /note="synonym: UL28"
     polyA_signal    58223..58228
                     /gene="UL27"
     gene            complement(58564..58569)
                     /gene="UL24"
                     /note="synonyms: UL25, UL26, UL26.5"
     polyA_signal    complement(58564..58569)
                     /gene="UL24"
     gene            complement(58678..60543)
                     /gene="UL26"
     CDS             complement(58678..60543)
                     /gene="UL26"
                     /codon_start=1
                     /product="serine protease (capsid)"
                     /protein_id="CAA06107.1"
                     /db_xref="GI:2653321"
                     /db_xref="GOA:P54817"
                     /db_xref="InterPro:IPR001847"
                     /db_xref="UniProtKB/Swiss-Prot:P54817"
                     /translation="MADAPDGGSADARVDAEPSALARASMPVYVGGYLALYGMGDEGE
                     LVLTREQVARALPPAAPLPINIDHASACEVGAVLALADDDAGLFFVGVINCPQLADTL
                     AGVAHPAFFGADAPSLTPRERFLYLVSNYLPSVSLSSRRLAPDEEADGTLFAHVALCV
                     LGRRVGTIVTYDATPDACVAPFRRLSPRARAALLANAEAARAALGDRAWPVPREALAQ
                     TLLSTAVNNMLVRDKWDTVSRRRREAGIAGHTYLQASAVFPLPTGGEGPERTGGRERA
                     QKSAVAGGVCIALPVAGGRARQPELPPAPPPPPPPPAMSAAHQAGAASAHPLPAGDYV
                     YVPTAQYNQLVVSQARGAAMTAAPPPAPYFLPAAAAAAAAPPPMPGWYGAAGAAPWHP
                     GYGFPPPGLESQIMALAGAIADGRRVQAHGADGSGYDGPLDRRPLAKRRRYNWDHPRG
                     RSGGGDDDEAYYPGEGAPAELPPHHHSPPPPHPPPSHALSKLASAVSSLQQEVSQLRA
                     GYPYGPAFAAAQHPPAAHLPCLPQQYTAPPRVGAGPAQVPTLAPAQAPAQALSVPAVA
                     AAPATVAAAAAVGPPEEPGVAATVDASAMASLPPAQPPQACDPAEIFVAQMMRQR"
     gene            complement(58678..59604)
                     /gene="UL26.5"
     CDS             complement(58678..59604)
                     /gene="UL26.5"
                     /codon_start=1
                     /product="substrate of serine protease (capsid)"
                     /protein_id="CAA06108.1"
                     /db_xref="GI:2653322"
                     /db_xref="GOA:O39491"
                     /db_xref="InterPro:IPR001847"
                     /db_xref="UniProtKB/TrEMBL:O39491"
                     /translation="MSAAHQAGAASAHPLPAGDYVYVPTAQYNQLVVSQARGAAMTAA
                     PPPAPYFLPAAAAAAAAPPPMPGWYGAAGAAPWHPGYGFPPPGLESQIMALAGAIADG
                     RRVQAHGADGSGYDGPLDRRPLAKRRRYNWDHPRGRSGGGDDDEAYYPGEGAPAELPP
                     HHHSPPPPHPPPSHALSKLASAVSSLQQEVSQLRAGYPYGPAFAAAQHPPAAHLPCLP
                     QQYTAPPRVGAGPAQVPTLAPAQAPAQALSVPAVAAAPATVAAAAAVGPPEEPGVAAT
                     VDASAMASLPPAQPPQACDPAEIFVAQMMRQR"
     gene            complement(60602..62398)
                     /gene="UL25"
     CDS             complement(60602..62398)
                     /gene="UL25"
                     /note="involved in genome cleavage/packaging"
                     /codon_start=1
                     /product="UL25 protein"
                     /protein_id="CAA06109.1"
                     /db_xref="GI:2653323"
                     /db_xref="HSSP:P10209"
                     /db_xref="InterPro:IPR002493"
                     /db_xref="UniProtKB/TrEMBL:O39492"
                     /translation="MALGRLEFACLGVDIHAVADRVFVPDERNFIAPAFPLRFWDEPV
                     FARIGDADAPARELAAARARNQAAAAAADNLLAKQRAAGAEVDARIRPIEARVAEVAA
                     VLADLEEAARRAEEADAAAESARAGRAAADAEEGGGGAGALEAVRARRVQIAKNDPPL
                     EYDTTLAADLLAMVYTARAGGGSAGIVFGTWYRTLQDRLIAERPLATRGMDYRDGRMS
                     RTFMAAAVAALQSSGRMYVGNRAYSAFECAVLCLHLAHRAVAGGSQSPVTFVGLVEQI
                     PAYLDALARAIDEGAARRVQYAFDLERLPRGQFQAPGGGAGRYERGALEAHAVVAALQ
                     RLRVLPAIPGALGGGAAPARAADADGVAYVDDVHRAAGAYLARAQNLFLAEDQSLLRA
                     TVDTITALLLVRRLLWNGNVYADKLRNNFQIGTLVPGAAAPGDVTRGADGGLDGAVGA
                     RSGDANLTFLCARYVARVYEACPEVEVTQLFPGAAALALDALAPRSAAGAPRAISVSG
                     GRHQGGLLRLVALELENRHRAAPAPVVEVVAAHDAVALQYERGLGVLMQQPRLRRALD
                     ETRRLSQFNVASDYDLLYFLCLGFVPLFTSAV"
     gene            complement(62380..63261)
                     /gene="UL24"
     CDS             complement(62380..63261)
                     /gene="UL24"
                     /codon_start=1
                     /product="virion protein"
                     /protein_id="CAA06110.1"
                     /db_xref="GI:2653324"
                     /db_xref="InterPro:IPR002580"
                     /db_xref="UniProtKB/TrEMBL:Q77CC5"
                     /translation="MARDRDRRARLRAGIRCHSRFYEALACDARAAVGAQKLRPRLAQ
                     LLGKFGAPEVFKQVVGVSLSFEVNLQSRRPDCVCLLRVAEAGHARAVCLIVELKTCRF
                     STNMNTPSKMDQRLGGLRQLRDSARLVRDLAPPGPDPVVLAPVLVFVSQRGMRVLRVT
                     RLPAQTIASNAARLEAIIAGLAEYAPFARARSRRAGRSPRGKRKAEQPRPRRQKGQPL
                     PLATGKRAAVAATPRPPAGDPGPAEAGESGRPVGGSRHAGNSAGGCAKDASGGAACLG
                     EISALFVAASGPWRSGV"
     gene            63260..64339
                     /gene="UL23"
     CDS             63260..64339
                     /gene="UL23"
                     /codon_start=1
                     /product="thymidine kinase"
                     /protein_id="CAA06111.1"
                     /db_xref="GI:2653325"
                     /db_xref="GOA:Q77CC4"
                     /db_xref="HSSP:P24425"
                     /db_xref="InterPro:IPR001889"
                     /db_xref="UniProtKB/TrEMBL:Q77CC4"
                     /translation="MAEPARALRVVRIYLDGAHGLGKTTTGRALAAASTAGEGVLFFP
                     EPMAYWRTMFGTDALSGILAASARCAAASHGSARGAGGPAHRADADAAGLVAYYQARF
                     AAPYLILHARVSALLAPPGPAPGGTVTLVFDRHPVAACLCYPFARYCLREINAEDLLM
                     LAAAMPPEAPGANLVVCTLPPAEQQRRLAARARPGDRADAGFLVAVRNAYALLVNTCA
                     FLRAGGAWRDGWDALEWADANALAALADPSCDECKMAPAPALRDTLFAALKCRELYPG
                     GGTGLPAVHAWALDALAGRLAALEVFVLDVSAAPDACAAAVLDMRPAMQAACADGAAG
                     ATLATLARQFALEMAGEATAGPRGL"
     gene            64455..66983
                     /gene="UL22"
     CDS             64455..66983
                     /gene="UL22"
                     /codon_start=1
                     /product="glycoprotein H"
                     /protein_id="CAA06112.1"
                     /db_xref="GI:2653326"
                     /db_xref="GOA:P27599"
                     /db_xref="UniProtKB/Swiss-Prot:P27599"
                     /translation="MRRPLCAALLAAAVLALAAGAPAAARGGAGGRSREHRDARYEIE
                     EWEMVVGAGPAVHTFTIRCLGPRGIERVAHIANLSRLLDGYIAVHVDVARTSGLRDTM
                     FFLPRAAVDNASAADIPDTPAVQSHPGLFGAAFSWSYLQTRHLVDYDLVPSRPLQDWY
                     FSQARAESNAARPPPAPRVTPTPAGRVAAFDINDVLASGPEHFFVPVRADRKRRERHV
                     ADFAAVWPVSYIPAGRAVLSCERAAARLAVGLGFLSVSVTSRDLLPLEFMVAPADANV
                     RMITAFNGGGAFPPPGPAAGPQRRAYVIGYGNSRLDSHMYLTMREVASYANEPADFRA
                     HLTAAHREAFLMLREAAAARRGPSAGPAPNAAYHAYRVAARLGLALSALTEGALADGY
                     VLAEELVDLDYHLKLLSRVLLGAGLGCAANGRVRARTIAQLAVPRELRPDAFIPEPAG
                     AALESVVARGRKLRAVYAFSGPDAPLAARLLAHGVVSDLYDAFLRGELTWGPPMRHAL
                     FFAVAASAFPADAQALELARDVTRKCTAMCTAGHATAAALDLEEVYAHVGGGAGGDAG
                     FELLDAFSPCMASFRLDLLEEAHVLDVLSAVPARAALDAWLEAQPAAAAPNLSAAALG
                     MLGRGGLFGPAHAAALAPELFAAPCGGWGAGAAVAIVPVAPNASYVITRAHPRRGLTY
                     TLQGIDVANPLLVTFVRGTSCVSASGAVEARRLAVPGPLDACAYCGSVFVRYLPSGAV
                     MDIVLIADKRTEVEFSRGANSSMPVFNPRLHSGRSRAMLLFPNGTVVSVLAFAGHEAP
                     TFSPAYVWASVGGALVAGTTIYAIAKMLCSSVPLARGYSSVPVF"
     gene            67031..67036
                     /gene="UL22"
                     /note="synonym: UL23"
     polyA_signal    67031..67036
                     /gene="UL22"
     gene            complement(67092..68857)
                     /gene="UL21"
     polyA_signal    complement(67092..67097)
                     /gene="UL21"
                     /note="noncanonical AATAAT"
     CDS             complement(67133..68857)
                     /gene="UL21"
                     /codon_start=1
                     /product="virion protein"
                     /protein_id="CAA06113.1"
                     /db_xref="GI:2653327"
                     /db_xref="InterPro:IPR004936"
                     /db_xref="UniProtKB/TrEMBL:Q77CC3"
                     /translation="MELAYHSVVAHNGVSFYVSAAGDVAYFVYAGTVVSVARRGGEAV
                     KFGLELRGWGRSDRAVANYVRAELARAVPLAPSGATDGEDDPDGGGAFVDCLARLRPR
                     GGAPAAGADLCGRFDVPVGDPYLAECFVSLGVASGLVLTTGYHDAERRVLHLFDVPTI
                     TNALSGFVYAPNRECFALMQACLRPRRGPCAPYCAGFLSRRCRGGLRRGAGEGADARS
                     PATTEVIVTTARAAAFAPPQARREAAVSSFVQVRLIPRTYNAWAMTGPPLSAATPCRG
                     CVPSCCADAVVLKSDHWAGIDETLNEARGDLVAAATALFGPRGRRGFVGESVADYGFS
                     FCQRFALCQFLLSRWGMASCYGALEHLAESYAANYPHRAAAPLDEGTVADAANDILRE
                     LCVLGRFAEALARADLGEPPAPAEKGGAGGDGGGYDYDCDCDDAAAAARALDLEMTAV
                     LSLASRHTRRRIVETGSADELRRAEGHVRAMLLHLYAGGAAGAGARARDALGTAAPHV
                     TLMEAEQLTAFDRAPAARHGVCYLRALVDRRLGAAGITPPSDSEYEDGNSDGEGEGEG
                     EAGAGTEP"
     gene            68969..69684
                     /gene="UL20"
     CDS             68969..69664
                     /gene="UL20"
                     /codon_start=1
                     /product="virion protein (membrane)"
                     /protein_id="CAA06114.1"
                     /db_xref="GI:2653328"
                     /db_xref="GOA:Q77CC2"
                     /db_xref="InterPro:IPR007629"
                     /db_xref="UniProtKB/TrEMBL:Q77CC2"
                     /translation="MLGPESAALLRAPEPPLGGADAEEGAAGASPGDSGSDDEEDELL
                     RCVALSAYGGDVDFLTRSPRLAPRADGRAAFSAYVVFGAASAFGLNPACCLLFLYYYR
                     TFGDATFAVAGAAATLAYYARLAAAAGFLYAGVRADRLPFGRGPRALLAALVLARAAV
                     FAAVALPAAFAGPALFLRLSAAVADGGARAAAAGLLLAGLAAYTADLVCDVIGFFAPR
                     AWMRVCLGGHVAV"
     polyA_signal    69679..69684
                     /gene="UL20"
                     /note="noncanonical TATAAA"
     gene            69737..73894
                     /gene="UL19"
     CDS             69737..73894
                     /gene="UL19"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="CAA06115.1"
                     /db_xref="GI:2653329"
                     /db_xref="GOA:Q77CC1"
                     /db_xref="HSSP:P06491"
                     /db_xref="InterPro:IPR000912"
                     /db_xref="UniProtKB/TrEMBL:Q77CC1"
                     /translation="MDRQSEPPRAPAYTGGLVSGQVLSNIEVACHRALFSFFQQVRSD
                     DNGLYAAAFDALLGTYCNTLTLVRFLELGLSVACVCTKFPELNYVHEGTIQFEVQQPM
                     IARDGPHPVDQPVHNYMVKRINRRSLSAAFSIAAEALGLLAEEASDGTQVSSAMRMRA
                     IQQLARNVQTVLDSFERGTADQLLRVLLEKAPPMSLLVPLSLYREDARLAGSRRAALV
                     SELKRPVRDDAFFLNKSEGAPGRELALAKITDLVGCTAASVAVPRLTHCDTRGRPVDG
                     VLVTTAGIKQRLLGGVLALADSEADVPVTYGEFVISGLNLVTALTMGKALRGLDDVAA
                     HLLGLEGTAGPGLAVAADYDAPAVARVKADLVAVGDRLVFLEALEKRVYQATRVPYPL
                     VGNMDLTFVMPLGLYKPPADRYSRHSGSFAPPPGHPDPRMFPPRSVFFFNKDGALTEV
                     SFGAAMGTLCHPSFLDVDPVLAALGRRGQRREAEWCLFGAYVADPGEQELADQVRHFL
                     DAWHALLPPRPRWVMECAMTPEQMVAPGNPNMPLELHPAFDFFLGPADVELPGPPNPP
                     QVMPAMQAMPRIINGNIPVPLCPVDFRDGRGFELSVDRHRLSPATVAAVRGAFRDPNY
                     PMAFYIIEAVIHGSERTFCALARLVMQCVTSYWRNSRCAAFVNSFPMVMYINAYLGNG
                     ELPEDCTAVYKDLLEHLHALRRLVDEYTVPHAPLGGEQEHAALNHALLDPVLPPPLIW
                     DCDAVMALQRRTRRAARARVNGAAPHVVARRELAEANFRNVGPDLVHNRPVRGGGPGA
                     YPVPHHGDEWLVLAKIFYYAVVPAFARGACCSMGVHYDRVYPLVQSVVVPDLPPDEEP
                     PAGPEHPRHPLHPTNLVANSFNVLLHNARVAVDADALLVLQEAVTNMAERTSVVVVDA
                     GPDAGTATAATRNMRTLDAALHHGVLMMAYQRNDETLLDGAFFYPAPVHALFACPDHL
                     HAMRGLGQNALLAARHVPPVPHFVGANYYATVRQPVAHHAAQSRADENTLTYALMGGY
                     FKLSPLALTHQLRTGLHPGFGLTVVRQDRFATENMLFAEKASESYFVGQLQVARHEAV
                     GGVGFTLTQPHARVDLGVGYTAAYAAAAMRTPLTDLGNTPQNLYMTRGDPPMVNGDAD
                     GFVRTVNAGSRIRPQGPAPLFGPIMPAAPAGTARGQAAVCEFIATPVSADLAYFRSPC
                     NPRGRSAGAAYAGDGESDADDLMFDHGQGDPAHPHRATVNPWASQRHSYGDRLYNGQY
                     NMSGASPVYSPCFKFFTPAEVSAKDRCMSRLIAEVGAGVSRSTSDTELQFKQPPGTGE
                     LVEDPCALFQEAYPPLCASDAALLRDRLAAPGGAAAGVEGRLEEGHFAQYLIRDASPV
                     RGCLPVG"
     misc_feature    complement(70868..72949)
                     /product="putative antisense ORF overlapping UL19"
                     /standard_name="UL19.5"
     gene            73983..74933
                     /gene="UL18"
     CDS             73983..74933
                     /gene="UL18"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="CAA06116.1"
                     /db_xref="GI:2653330"
                     /db_xref="GOA:Q77CC0"
                     /db_xref="InterPro:IPR002690"
                     /db_xref="UniProtKB/TrEMBL:Q77CC0"
                     /translation="MAQPEAFEVEIVLPGDLSHGDLAALQKCEGKVVFFTTLRRRVPL
                     ADVALASFSVNGVAPDTLGLMAAYRCRFPAVVLRVAPGRMMAAPLGVGPMPRGAFLQN
                     TGPFDLCNGDAVCLLPPLLGPARALALASAGAELLFPMTVPLPQARALVARVVARAVE
                     ALGDRAAAARARAADVMYHNGRRYQVTPDVLCREGADAAARTLVLNMVFNVNEGSLLL
                     LSLIPNLLTQGLQDGVANAIVQLGSASREAGQLLRLEPAEPRQDGGRRFCLYGALAAW
                     ISSATRLGDAVGARPLAKVCTFDGPSVVRVGEKAPIVVPL"
     gene            74988..74993
                     /gene="UL18"
                     /note="synonym: UL19"
     polyA_signal    74988..74993
                     /gene="UL18"
     gene            complement(join(75042..75047,75077..76261,76262..79632,
                     79633..80655))
                     /gene="UL15"
     polyA_signal    complement(75042..75047)
                     /gene="UL15"
     CDS             complement(join(75077..76261,79633..80655))
                     /gene="UL15"
                     /function="involved in genome cleavage/packaging"
                     /codon_start=1
                     /product="UL15 protein"
                     /protein_id="CAA06117.1"
                     /db_xref="GI:2653331"
                     /db_xref="GOA:Q77CB9"
                     /db_xref="InterPro:IPR003498"
                     /db_xref="InterPro:IPR003499"
                     /db_xref="UniProtKB/TrEMBL:Q77CB9"
                     /translation="MFGGAVGEQSARYFQRLLRERQRRAAERGARPDGGGGARGEDDA
                     RVPFLDFAVAAPKRHQTVVPGVGTLHGYCELAPLFAATASRLLLTSMARAEAGLNTGT
                     GEAHVSRELAGVLSALRFAAHPPAEAAAHCNAYHSVMAALESMRASGAFAQVAAFVAR
                     FSRLVGTSFSHLGGGDDADPPRAKRARVEPPSGQTRGALELFQKMILMPATYFVAATL
                     LGEHAERIGAFLRVAFNTPDFSDAAVAHFRQRATVFLVPRRHGKTWFLVPLIALALAT
                     FKGIKIGYTAHIRKATEPVFEEIVARLRQWFGGERVDHVKGEVISFSFPDGARSTIVF
                     ASSHNTNGIRGQDFNLLFVDEANFIRPEAVQTIVGFLNQASCKIIFVSSTNTGKASTS
                     FLYNLKGASDGLLNVVTYICNEHTPRVAAHGGATACSCYVLNKPVFITMDAAARNTAE
                     TFLPNSFMQEIIGGGEVARRAEPAAVFTRAAGEQFLLYRPSTAAARGPWPERLYMYID
                     PAFTSNARASGSGIAVVGRHRGSWLVLGLEHFFLPALTGSSAAEIARCAVRCFAQVMA
                     VHRRRLDGLFVAVEGNSSQDSAVAIALGVRRELDSLAASGAVPMPAETRFYHCRPPGS
                     AVAYPFFLLQKQKTAAFDHFIRLFNSGRVVASQDLASLTVRLQTDPVEYLFEQLQNLT
                     ESTAGPGGARAFSGKRRGAADDLMVALVMAVFVGSLPPTDGAFCPLAPRPPAD"
     intron          complement(76262..79632)
                     /gene="UL15"
     gene            76332..78437
                     /gene="UL17"
     CDS             76332..78437
                     /gene="UL17"
                     /function="involved in genome cleavage/packaging"
                     /codon_start=1
                     /product="UL17 protein"
                     /protein_id="CAA06118.1"
                     /db_xref="GI:2653332"
                     /db_xref="GOA:Q77CB8"
                     /db_xref="InterPro:IPR007640"
                     /db_xref="UniProtKB/TrEMBL:Q77CB8"
                     /translation="MEAHLANETKHCLARGRSAAGTVVHLIISSDCLRAAGADPGRLF
                     TASGGAPGAAAGAPRGGSARADFSAAAQTRFHGSGACSAWEPVFAAYVPAGALASVLL
                     PTQPAARPPIFAAAGGGEDRGGLFVSLPVALPEGGEGAFFDPFTRAALRLEMADGELV
                     DLLFAYEELLPAGTRYEADVPRLAALCWQFVHYTRRHAGLPAAAVAAAEHMEACLTEG
                     GRAPPLPPGGQIRPERLLAEGGFDDPAAVARLEDSDQEVLALIRRAAEVVAARHPLRR
                     ARAPIGGPRAVAAGLLQGARATAAACAATAPVLPPDAATALLPATEPRAAGPGLGAVA
                     RALAGDTLVATAATRQARTLTEWFDAGHCALLGGDTPCDAWRRRPLSLVARRHYETGE
                     GFVVVAYEQSAGWGGRRAPGPARRPESVAGELARACEREGVAHPRALSAAARAELARR
                     HPFLAAPLGEDGAPPVEAFDAGAEVLLAERFKAACARALVRAWRACEARPDLPQRFHY
                     DVREAQRGCLEDVARRVPAFLRALASALGALSAREFLNSALCAAAVAHLSATSPGGRG
                     VLPYHRACFSLLAGGERALLFDYFSFGGEVIKVSRSPLAATTAQESGRRPGSIRLLDA
                     GAKSGRAPACGSYPPGESYAYACVGFSRRLRCTVVFPGGFALEADVAAHLDWPARLCE
                     AVLGRLGRPLPAPPGAPAP"
     gene            78471..79490
                     /gene="UL16"
     CDS             78471..79490
                     /gene="UL16"
                     /codon_start=1
                     /product="virion protein"
                     /protein_id="CAA06119.1"
                     /db_xref="GI:2653333"
                     /db_xref="InterPro:IPR004286"
                     /db_xref="UniProtKB/TrEMBL:Q77CB7"
                     /translation="MAEDPAAAGALLARALTEELGCLHLVRTDSRVKIYVAVATLGRL
                     LARLVSPEDASPGAAVRVTLYITRPRSLELPPRHFHVLVLFGGAVARACVAGVRTRAL
                     VPGSTRVRAVFRDAVAVPAPADLPDPSAEVVPPAPAEHVDPFAFTAFARPPRDAADCF
                     QLAPGVWWSYADRRLYLVQMDEALLALCPAGWRSRSLGGVLGRLLSHPGGCAACTAKW
                     HIDALNAAPEPGACDVCPCAAPCLWKKARRQDVPVAGDSSLFRVLFTDAVARVRILGS
                     RRRPRITGALPELLAGVGPRGEAVPVNGAGWQLRVMDDDVTRLLASSCRAMRSCAAAR
                     GSPWG"
     gene            79577..79582
                     /gene="UL16"
                     /note="synonym: UL17"
     polyA_signal    79577..79582
                     /gene="UL16"
     gene            80718..81386
                     /gene="UL14"
     CDS             80718..81386
                     /gene="UL14"
                     /codon_start=1
                     /product="function unknown"
                     /protein_id="CAA06120.1"
                     /db_xref="GI:2653334"
                     /db_xref="InterPro:IPR005207"
                     /db_xref="UniProtKB/TrEMBL:Q77CB6"
                     /translation="MATAALAGDPAPGSRTAARRRRLRLEEAHRREAIFKSRVVDLVR
                     AGADRDDPAFIHAFTAAKAARRDLGGQIRAAARVEAVRQHARDIETRVAAQAAVAAVL
                     AENRRFLRGDFLRAFDDAEDALLDQEERMGDAAADCGGDVGVGGAWLDGDDESLLAQW
                     LLQSAPRVGPDVLSDDWPAAPLGGLAAAPAGARVDAGSAAAAAGQAGPAAAFRERRPP
                     HSTP"
     gene            81301..82779
                     /gene="UL13"
     CDS             81301..82779
                     /gene="UL13"
                     /codon_start=1
                     /product="virion serine/threonine protein kinase"
                     /protein_id="CAA06121.1"
                     /db_xref="GI:2653335"
                     /db_xref="GOA:Q77CB5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q77CB5"
                     /translation="MQARRQRRRARLGLPLLSGRDGRPTAPPDPRAGSSAPPLRRARG
                     RRPPRGGCGAAALAASGRRIRATPRADPPREPPAARSRAHILRLAAVERPGCPVFVAD
                     ASLRIRSAAELAGPAQLRGAGGYGSVVVHEAAGVAVKTFASAADFEHELLVTLLAGEC
                     SLRALRHARADAIIRPCGFSLRRRQLALPAYDADLVAYAEAAGRAVLSPAALAAIERA
                     FVGLGRAVVFLNASCGLAHLDIKGGNIFVNTAGALITRAVLGDFSLMTLTAQSALADA
                     EFLVSTDDGNSDGASDAVAGGRLRLRLPPDARMPDPEIVMGHCATRPSEMLLDFLNRH
                     GLRGRPEPLPADLGLAIDLYALGHALLELVLTGARETPEVQCARRQGALHMSARRVTC
                     GLVIGILAHRCALLPLVFPATPRTAACGVPWDEPAAVRAAIGNVAIRAAFDRTTEAHR
                     ARYTERVREALAAAPVRRALELAALFCHPNPRARRAALVLWS"
     gene            82776..84239
                     /gene="UL12"
     CDS             82776..84239
                     /gene="UL12"
                     /codon_start=1
                     /product="deoxyribonuclease"
                     /protein_id="CAA06122.1"
                     /db_xref="GI:2653336"
                     /db_xref="GOA:Q77CB4"
                     /db_xref="InterPro:IPR001616"
                     /db_xref="UniProtKB/TrEMBL:Q77CB4"
                     /translation="MSRAPLAKRARFELDSARRPRWSACRKGLWRAAWTSFWPRRRAK
                     ATATTRSFAARRTSGTCSPVRARRSQAAARGARGLFLAVEAATRGQAACDLWWLLRRS
                     LATASSVRWGAAGPRPLVRLGRGAAEERNTAATAFGRDNEPLARALVRACCVPPGDLP
                     TPDGLADGGGRADELGPVFVFDAAAGAAAESAAGAGAEAHTCGLLIDPRTGALGASID
                     MLVCDRDARGELAPHPTQTALGVFEIKCRAKYAFDPDDGARRRARTPPCCGRSAAALR
                     AFLRSVRRPGVEHCPPDGCPGAAEALASCADAWAPPPPAGAAPARRCSEFDWRHLALN
                     RSVTSRVWLFNEPAAHSGAIGLATWDTGEAALEAPLFANPRHANFKQILVQSYVLAGH
                     FPERAAALHLVTFIGRQRRAREQGPLEVRAGPGAETCTVPREGAVPVLLIATPVVVDG
                     ELARESLEQPAREAFRAAVKESWDRRRRAADAAATAS"
     gene            84191..84460
                     /gene="UL11"
     CDS             84191..84460
                     /gene="UL11"
                     /codon_start=1
                     /product="myristylated protein (tegument)"
                     /protein_id="CAA06123.1"
                     /db_xref="GI:2653337"
                     /db_xref="UniProtKB/TrEMBL:Q77CB3"
                     /translation="MGQAASCSRCRRNRILTRAGDLVALDAAAFEDFSLDDLQALTAG
                     AAAGEEGGEDKKNADDDWSDVITSAPRRGQRPPVKPYRPQRREVY"
     gene            84490..84495
                     /gene="UL11"
                     /note="synonyms: UL12, UL13, UL14"
     polyA_signal    84490..84495
                     /gene="UL11"
     gene            complement(84529..85846)
                     /gene="UL10"
     polyA_signal    complement(84529..84534)
                     /gene="UL10"
     CDS             complement(84530..85846)
                     /gene="UL10"
                     /codon_start=1
                     /product="glycoprotein M"
                     /protein_id="CAA06124.1"
                     /db_xref="GI:2653338"
                     /db_xref="GOA:O39493"
                     /db_xref="InterPro:IPR000785"
                     /db_xref="InterPro:IPR011034"
                     /db_xref="UniProtKB/TrEMBL:O39493"
                     /translation="MAGSAQPAAVHWRLWLAQVGVFAGLALLLLITLIGAASPGAGLP
                     CFYAAIVNYNARNLSADGGAWAQRELGARHPALFLETPTTAAFSAYTAVVLLAVAAFD
                     VAAAIIIRRENSGGFAAAYHMNALATLATPPGALLLGALAAWTLQAAVLLLSHKIMVL
                     AAATYLAHLAPPAAFVGLFCTAGLPGAEYAQAVHALRERSPRAHRLLGPGRAVMINLA
                     GGLLALIIGTAPLMLGQLLGAGLGLSLAQTVVAGVTVFCLAAVLFLVLTELVLSRYTQ
                     VLPGPAFGTLVAASCIAVASHDYFHQLRGVVRTQAPRAAARVKLALAGVALLAVAMLV
                     LRLVRACLHHRRKGSAFYGHVSAARQQAARYIARARSSRGMAPLEGDAAALLDRGVAS
                     DDEEAVYEAHAPPRPPTIPLRRPEVPHSRASHPRPPPRSPPPAHVK"
     gene            85845..88424
                     /gene="UL9"
     CDS             85845..88424
                     /gene="UL9"
                     /codon_start=1
                     /product="replication origin binding protein"
                     /protein_id="CAA06125.1"
                     /db_xref="GI:2653339"
                     /db_xref="GOA:P52377"
                     /db_xref="InterPro:IPR003450"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="UniProtKB/Swiss-Prot:P52377"
                     /translation="MTATPGAAADAVRVEGAGACSDGGEEARYASSASLARMLYGADL
                     SERVRRRHPAVCVEHQSGRPVALPSPLAADARRVTVVRAPMGSGKTTALLRWLGEALG
                     ATDASVLVVSCRRSFTRTLHERLRDAALPAFATYFDARSYVMTGAAYRRLLVQVESLH
                     RVDEELLGDYDILVLDEVMSTLAQLYSPTMGRLHRVDALLHRLLRRCPRIVAMDATVN
                     AQLVDLLAALRGAGSVHVVICDYASAGFLQRRCTVARRLGARVLAARLKGDAEDGAED
                     GGASFFTRLRARLEAGHNVCVFSSTVLFSELAARFCLTFTPSVLVLNSTRPAEGDVSR
                     WRDVRVLIYTTVITVGLSFDHSYFHAMFAYVKPMSHGPDMVSVYQSLGRIRSLVDNEL
                     CVYFDSSAARPEPVFTPMLLNHVVAEDGGWPATFSEVTNLLCCSFRAACAPAFRGARG
                     LALFPRFKYKHLFERCTLASASDSLNILHALLENNRVGFQLEALRSAHRRGILPLSRG
                     RARRRPAAAADLRALAAGIPSPVSAEGLAEHPAVAAFADKYLRAGGAPPAALEELLRA
                     LNGPAARARFVNLAVLGGCLHVPAAAESLEVFAGIYRHYASGEVPVLTEAGAVETAAL
                     APGLRWKPTALFGLRRMARALGLLRRRGGGEADDVADAAHGLTEPAIVELVGPPGGHD
                     YAQCLLEIARCNITPAGVMARGPVVAVAARLSGRGFAQGRGVGLGAAAHAVSVFKVIW
                     EEVFGARLQKSTQTFPGHARVKNLRKHEIVALLDLAGIDRAGRDTHRELYRLLMSHKA
                     RFASPKYSLRLPKWGRLLGFAARGPEPGPDAPPEASLEAALARVPALHWPCAAGAVDF
                     CAL"
     gene            88485..90731
                     /gene="UL8"
     CDS             88485..90731
                     /gene="UL8"
                     /codon_start=1
                     /product="component of DNA helicase/primase complex"
                     /protein_id="CAA06126.1"
                     /db_xref="GI:2653340"
                     /db_xref="GOA:O39494"
                     /db_xref="InterPro:IPR004996"
                     /db_xref="UniProtKB/TrEMBL:O39494"
                     /translation="MPVSHSNGCVCGVSLYSAWAAGPDRARVLLALLCRMDDGGCDAK
                     FALVNVCARGVTALARGARDVTAARLEDLARAAAAPRALPLATLGHAATWKALYVSAL
                     AALRAQIGPFRFYRETRFGVDNDTGLLVSAEEPPDAADAAPRAAVLRSALRLAVEEDA
                     VRAAAAAAPAGGGSLARARLCAMRDGHADLSAPGNVVEFELTTKTARFYRIFADIAQP
                     PRKRAGRLADVFAHREYRVRTEGSAAPVVVRALVPVNFDCVVADARAFSPMAAMLVFA
                     QWHAALFTDGPAQVLGFLGPQLNPGGEERDYCFLLGFPGVPLVVSAADAGAVRDDLDA
                     HVLTDGLWPAFGVHVYHALGPWNFLDGAAVASLNRRIAAARAALPPGGSDGSDWPAGR
                     VSTILNSPACVRGLWLAKFDFSAFFPTLYAHLVPEHARLARAICARRDGRPGLKPSLL
                     TFFGGLRHVHAPAYEAVIALANAVAAAVERAANARNFAVCTYVKDGFWGAFGDAAPEV
                     VPREAALAAALALRDDCQRAAEAVLRAAGLHPAEGAELHLRFEGLFTHAVSWSANKYW
                     LWDATAGGAEGELFVGFPCRTEFGRMAKRSLAGLLRRAVAQPERPSDTVAAAAAACDA
                     LVHAAFERRGDVRFWSATAPIADWGAVPRSALSGGDLLDADHGPRPYVLVAGHEAAPF
                     PLPWALYRSPVLLPDIACRAHMAPVLQELARMLNGALAALAAREGDDEPPIEEFEYNL
                     ADFDFLFA"
     gene            complement(90719..90724)
                     /gene="UL6"
                     /note="synonym: UL7"
     polyA_signal    complement(90719..90724)
                     /gene="UL6"
     gene            90761..90766
                     /gene="UL8"
                     /note="synonym: UL9"
     polyA_signal    90761..90766
                     /gene="UL8"
     gene            complement(90784..91683)
                     /gene="UL7"
     CDS             complement(90784..91683)
                     /gene="UL7"
                     /codon_start=1
                     /product="UL7 protein"
                     /protein_id="CAA06127.1"
                     /db_xref="GI:2653341"
                     /db_xref="InterPro:IPR002600"
                     /db_xref="UniProtKB/TrEMBL:Q77CB2"
                     /translation="MAEAYDGLTLGVPLEGSTLESLLQDAREGSGGPPQVLDDLVWTL
                     PRFVCEVREIPAGPPTFTSSSITHLRVEPSTGALLLTLDGRAEEVDCDAYRAECEAMP
                     AFRGFAFAVLTAMEDAVFATTVPAAVLPYRLALCRPKTREDFALCVVQMFLEGCSEAR
                     VGAALFVQLSCLLRRLRPPPARKMSRLLYVGAMRVLNTAMCMAGYSPFESQLVLPHYA
                     VARLLLAAGNPPSVITAIYHTGGAARRGGPAPERCPPGVINARPGLLNGPLAAQAFRD
                     AVYHWWTRIPDKLTPDKMFVSYD"
     gene            complement(91640..93706)
                     /gene="UL6"
     CDS             complement(91640..93706)
                     /gene="UL6"
                     /function="involved in genome cleavage/packaging"
                     /codon_start=1
                     /protein_id="CAA06128.1"
                     /db_xref="GI:2653342"
                     /db_xref="GOA:Q77CB1"
                     /db_xref="InterPro:IPR002660"
                     /db_xref="UniProtKB/TrEMBL:Q77CB1"
                     /translation="MAECERVVSERALNLAGSARNPGAPGPPGEWVRIHPTRGTRLFK
                     EILLGELGYTEGQGVYSAVRCTETVIRQVQATILSTTLNAARYEDVARDWRAYTRARG
                     LRAADIAARYGPRGEAEVVRLAEHVFDTWRRTLQMSLVECVRGVAAAFPAGGAGSPAS
                     FARYVDWLVCLGLVPLRRIGLAVPAPSRRRGPLPALARAGPAPGRCRRVLAECEAFAA
                     DLLRCAGAVTVLDYDRTEILYNFRKKQFAVREAVTGEEGECFVLWAPVWRGGDVLFES
                     PMQRLHGEVLACHALREHARLCQLLNTVPLKVLVGRRAEALRAKPPGAPSVEKLLGEG
                     EDAAASSSAARLIKLIVNMKGMRHIGDISETVRSYLDDTAAGLFDVSDVDTSQPGFGA
                     AGGRAGGGADSRSRTAFRASVVHSINGMLEGYVSNLFKTIESLKGANRDLADKLRAKS
                     ASCRRLESARCWPPKRPTPRAGGAGRRPARVRCRRAPRTAELGHEVIDISGLMGPDSY
                     VANSFQSRYIPTYADDVERLSRLWEQELLRCFKLARTANNQGQEVSVVYSNSSISLIL
                     APYFFSVLRVRRFGFLIAHQEACRSEEELCGAVFKKTRLETYLAELAAIFTADARRAL
                     QLGLASRGARERSGSRSRSRSRSRERGRSKSRSRSRSRSREEKRRRERREDGRGVRRT
                     YAGRAP"
     gene            93756..96272
                     /gene="UL5"
     CDS             93756..96272
                     /gene="UL5"
                     /codon_start=1
                     /product="component of DNA helicase/primase complex"
                     /protein_id="CAA06129.1"
                     /db_xref="GI:2653343"
                     /db_xref="GOA:Q77CB0"
                     /db_xref="InterPro:IPR003840"
                     /db_xref="UniProtKB/TrEMBL:Q77CB0"
                     /translation="MEREAFSAEVFLNFTSMHEIQPIVKRIRQLEAARLPAAARPPLG
                     WFRAAAAAESPLDFAPRELPFAAYLITGNAGSGKSTCIQTLSETLDCVITGATRVAAQ
                     NVYLKLAAAYHSRHINTIFQEFGFRANHVQAQLGRHQYVCAASPPSIQDVQFRDLVYY
                     WEVLGDISRRLLGAAASRGQFEALRAAELAAGRPRGAVERLAPCVHGSLPAFARSNVI
                     VIDEAGLLGRHILTAVVYCWWLINAAHDSAQYRDGAMPVVVCVGSPTQTDSLESTFEH
                     HKLKCRVRSSENVLTCLITNPTLREYAAIPHNWTIFINNKRCQEYEFGELLKTLEYGL
                     PVTEEHLALVDKFVVPDAFINNPANLQGWTRLYSSHREVSAYMSRLHAHLKVAEGRSR
                     FVVFTLPVYTFVNIRTFEDYRTATGQPGLGVEKWLQANSGRITNYSQSRDQDAQSPHC
                     EVCSAKGLVVARSDVTYVLNSQVTVTTRLKKLVFGFSGTFADFIAVLRDDGFVRAQSE
                     TSVEYAYQFLAALLFGGMIAFYNFLRTPGLDPGRVDEAYRRLARATQEALGPAADDAV
                     DWRGLAADRAAGSEAGAGDNDDDLVFAALDEGTLDLLYCNYEFQRPTSAHEIYAQFLL
                     LKNLFAARFDVCRTLFGAAFADAPFEAYVDNLSFKGCEVFTGSLRGGLVSMALQTDTY
                     TLMGYAHAPPSLLSEEPGRRRLPDGVAELLSTLDVPNIVVRDQRGFVSVLHTNVSEFV
                     EALDDKELEMAVSVDYGISSKLAMTIARSQGLSLDKVAVCFARGNLRLNAVYVALSRS
                     VSSRFLRMNLNPLREPHERDTMISEHILAALRDENVHIVY"
     gene            96293..96850
                     /gene="UL4"
     CDS             96293..96850
                     /gene="UL4"
                     /codon_start=1
                     /product="virion protein"
                     /protein_id="CAA06130.1"
                     /db_xref="GI:2653344"
                     /db_xref="InterPro:IPR004958"
                     /db_xref="UniProtKB/TrEMBL:O39495"
                     /translation="MALAAPGPGTTTLIAYSLYEIKMAPLWALPHCEQVVCECAAGDR
                     SVSVGGGLACDALPAGTLVLQHGPAATLVAVDCGSEYCSYAFTHASACNSLSLREGSV
                     FVVPFDEWAATDRARRLCSRARGLLAVCLGARRDIHVTITVYGQSTAPATAPPPGDVL
                     EAILQESEIRDCDARPSGSRPCGEE"
     gene            96352..96357
                     /gene="UL5"
     polyA_signal    96352..96357
                     /gene="UL5"
     gene            96864..96869
                     /gene="UL4"
     polyA_signal    96864..96869
                     /gene="UL4"
     gene            complement(96883..96888)
                     /gene="UL1"
                     /note="synonyms: UL2, UL3, UL3.5"
     polyA_signal    complement(96883..96888)
                     /gene="UL1"
     gene            complement(96914..97294)
                     /gene="UL3.5"
     CDS             complement(96914..97294)
                     /gene="UL3.5"
                     /codon_start=1
                     /product="UL3.5 protein"
                     /protein_id="CAA06131.1"
                     /db_xref="GI:2653345"
                     /db_xref="UniProtKB/TrEMBL:Q77CA9"
                     /translation="MARVRAGSVFGEARVATVADYTQFLAANRAAAAKLRAAAAAVGE
                     SSPDAAARRVRRAPSLRAARRPEGPEAAVPANEERLPPAEARAARLYAAASPARARRS
                     LPSADRRPPPPPTRPFPPNYRTFQ"
     gene            complement(97297..97911)
                     /gene="UL3"
     CDS             complement(97297..97911)
                     /gene="UL3"
                     /codon_start=1
                     /product="phosphoprotein"
                     /protein_id="CAA06132.1"
                     /db_xref="GI:2653346"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR005035"
                     /db_xref="UniProtKB/TrEMBL:O39496"
                     /translation="MRRVEPVLSLLAAGGWQVSAAAAASASAPADDGERSSGPALAGP
                     GLAAAGLGPNPDCVAFDTLFMVSSIDELGRRQLTDTIRKDLKRTLAKYTIACTKTSSF
                     SGAQARGLSARPWRGCGARLRSNKSLQMFLLCQRAHAQRVRDQLHSVIQSRKPRKYYT
                     RSSDGGTRPAVPVYVYEFSAAGPVYIHRDNTLGPDSRPGEQPHR"
     gene            complement(97958..98863)
                     /gene="UL2"
     CDS             complement(97958..98863)
                     /gene="UL2"
                     /codon_start=1
                     /product="uracil DNA glycosylase"
                     /protein_id="CAA06133.1"
                     /db_xref="GI:2653347"
                     /db_xref="GOA:O39497"
                     /db_xref="HSSP:P10186"
                     /db_xref="InterPro:IPR002043"
                     /db_xref="InterPro:IPR003249"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="UniProtKB/TrEMBL:O39497"
                     /translation="MPRPRPRPRLRPRLRPRLRPRLRPRLRPRLRPRLRPKRAESLCP
                     RLRGAAPPKRRRPNGLPACVTALEDQRAITWGAFAAEFGVHEAWRRVLEPELAMPYTR
                     HALREYERRSRVEQVLPPKADIFAWTRYAAPEDIKVVILGQDPYHSRGQAHGLAFSVN
                     RGVPVPPSLQNIYAAVQKNFPGAPRPSHGCLEDWARRGVLLLNTSLTVRSGAPGSHSS
                     LGWGRLVHAVLARLSAESGPLVFMLWGAHAQRAFGAAGKRHLVLTYSHPSPLSRAPFV
                     HCTHFAEANAFLEQHGRGGVDWSIV"
     gene            complement(98866..99342)
                     /gene="UL1"
     CDS             complement(98866..99342)
                     /gene="UL1"
                     /codon_start=1
                     /product="glycoprotein L"
                     /protein_id="CAA06134.1"
                     /db_xref="GI:2653348"
                     /db_xref="InterPro:IPR007923"
                     /db_xref="UniProtKB/TrEMBL:O39498"
                     /translation="MAPAVARACAWALLAALLWLPPAGATRRADSAESILAERCRGNL
                     LLADRPQHEEAAPGLAGIFIRGRCSPPEAALWYEDTGETYWANPYAVARGLAEDIRRV
                     LADTPVYRDLAIQVLNSAFGLPHEVRAPLPPPPRGCVLPPRYHTTGPCGPGDGIYR"
     gene            99239..99532
                     /gene="UL0.7"
     CDS             99239..99532
                     /gene="UL0.7"
                     /codon_start=1
                     /product="UL0.7 protein"
                     /protein_id="CAA06135.1"
                     /db_xref="GI:2653349"
                     /db_xref="UniProtKB/TrEMBL:O39499"
                     /translation="MDSALSARLVAPAGGSHSSAASSAQAQARATAGAMPLVVAAGAG
                     VYLRRPTCDVYMHAHRRPPGAEAKGWAAGRILAPATQPSTHCVCVGEKPQGTR"
     gene            99827..100090
                     /gene="UL0.5"
     CDS             99827..100090
                     /gene="UL0.5"
                     /codon_start=1
                     /product="UL0.5 protein"
                     /protein_id="CAA06136.1"
                     /db_xref="GI:2653350"
                     /db_xref="UniProtKB/TrEMBL:O39500"
                     /translation="MRKPLRGCVGRPGSEPPRLWAGGSGLWCGVGAAGGRLVLCVARP
                     RPRTVLMPAFAPRRERSTLLPRGRRNGPRPVHPTSHNRQIFVH"
     gene            100132..100137
                     /gene="UL0.5"
                     /note="synonym: UL0.7"
     polyA_signal    100132..100137
                     /gene="UL0.5"
     gene            complement(join(100475..100480,100670..102700))
                     /gene="BICP0"
     polyA_signal    complement(100475..100480)
                     /gene="BICP0"
     gene            join(100489..101034,102209..102214)
                     /gene="LRORF2"
     CDS             100489..101034
                     /gene="LRORF2"
                     /codon_start=1
                     /product="product of latency-related gene"
                     /protein_id="CAA06137.1"
                     /db_xref="GI:2653351"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="UniProtKB/TrEMBL:Q77CA8"
                     /translation="MRDLGHKSPAHARAVTFGLGMTAATAARKLSMQAGGRKYTAVRC
                     GGLRVAEWVGGEPAAAIIAARRCRRCSGRAARPGSGPGDRLAAAPGPRCCGGGSPGGF
                     LAPRRPLPFRCAASSAPSSRGRGPGRPAPWRSLAFSPGRGCHCGRPRPGRLRPGPERR
                     PAGGRRQGRGRRETGSGLGWK"
     CDS             complement(100670..102700)
                     /gene="BICP0"
                     /codon_start=1
                     /product="immediate-early transactivator protein with Zn
                     finger (cell nucleus)"
                     /protein_id="CAA06138.1"
                     /db_xref="GI:2653352"
                     /db_xref="GOA:P29128"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/Swiss-Prot:P29128"
                     /translation="MAPPAAAPELGSCCICLDAITGAARALPCLHAFCLACIRRWLEG
                     RPTCPLCKAPVQSLIHSVASDECFEEIPVGGGPGADGALEPDAAVIWGEDYDAGPIDL
                     TAADGEASGAGGEAGAADGSEAGGGAGGAEEAGEARGAGAGRAAGAAGGRAGRGADAA
                     QEFIDRVARGPRLPLLPNTPEHGPGAPYLRRVVEWVEGALVGSFAVTARELAAMTDYV
                     MAMLAECGFDDDGLADAMEPLIGEDDAPAFVRSLLFVAARCVTVGPSHLIPQQSAPPG
                     GRGVVFLDTSDSDSEGSEDDSWSESEESSSGLSTSDLTAIDDTETEPETDAEVESRRT
                     RGASGAARARRPAERQYVSTRGRQTPAVQPAPRSLARRPCGRAAAVSAPPSSRSRGGR
                     RDPRLPAAPRAAPAAQARACSPEPREEGRGAGLGVAAGETAGWGAGSEEGRGERRARL
                     LGEAGPPRVQARRRRRTELDRAPTPAPAPAPAPAPISTVIDLTANAPARPADPAPAAA
                     PGPASAGAQIGTPAAAAAVTAAAAAPSVARSSAPSPAVTAAATSTAAAISTRAPTPSP
                     AGRAPAADPRRAGAPALAGAARAEVGRNGNPGRERRPASAMARGDLDPGPESSAQKRR
                     RTEMEVAAWVRESLLGTPRRSSAALAPQPGGRQGPSLAGLLGRCSGGSAWRQ"
     polyA_signal    102209..102214
                     /gene="LRORF2"
     intron          complement(102705..108190)
                     /note="alternative intron spliced out to produce
                     immediate-early RNA 2.9 and BICP0"
     misc_feature    102918..114234
                     /note="internal repeat of the short segment IRS"
     gene            complement(103627..107704)
                     /gene="BICP4"
     polyA_signal    complement(103627..103632)
                     /gene="BICP4"
     CDS             complement(103673..107704)
                     /gene="BICP4"
                     /codon_start=1
                     /product="immediate-early transactivator protein (cell
                     nucleus)"
                     /protein_id="CAA06139.1"
                     /db_xref="GI:2653353"
                     /db_xref="GOA:Q4LDG6"
                     /db_xref="InterPro:IPR005205"
                     /db_xref="InterPro:IPR005206"
                     /db_xref="UniProtKB/TrEMBL:Q4LDG6"
                     /translation="MSSPGRLELATLDLYDLIESADLGPTGGSEEDPALLDAARRAEA
                     RERRRAARAELAELWRMVGGEDAESSEDDGAGDAGATEGAEAEDAEIGEDAGARDAGG
                     AEDADVAECAEAEGAEGAEDADSAWAAARALAVAVEAAAAGAEAAAAEAAVIAAAIEA
                     EAGAAPLKAEAGTEAGGGGALGARTEAGDVGPEDCSDAGSEDSGPEDCSDAGPEDDGG
                     EAREGSTDADAEAEAEAEAGTGAGTRTKAAPREAGAGPGAPRGRAPGPPAPSPPETAP
                     PPPRRQRGRATGARAGYAAAPRDGPPPLEGPLLTPSGEAWPGSAPPPPGRVRFGGAGD
                     TREGLWDCPEIREAAARYAAAAGPAAVFVPEMGDAGKQYAALVDLVYARRDAMAWLQS
                     AKLAGPDLQLARLLQRRVQGCRGHSSFITGSVTAPLPPVGDAMAAQNALWALPHVAAC
                     VAMSRRYDCDQKLFLLQSLRRAYAPMAYPEAGAGGSGARAALAELRAVLAGRAAPAPL
                     PPASTARAARERLRELADRCAVACREALEAARRAAGAAGLPVLSAAAGRGLPAAACAP
                     DALAAHPERVLRAAELLGAARDAVERARLQRAAPAALRAEAAAALEAAALAARTVAPL
                     ARYSTRGAAARASAWALARALFSPPAEVPARLAAALAALEAAGGGAGAGAAAPGRGPV
                     EVEVEDMRAGAPRADPEDGSEAEDGEDGEDEEAEEEEEEEKEEEEEEEEEEEEEEEGR
                     PGPAAGAPPGPREGRRAEEEEEEEEEEEGDGDGDGEAAALPAAAGGPSGEDDSGPRRR
                     RKAAAADAAGPARREPPLPARVLGPMPPGGPAADGGFRRVPPGDYHTPAPSAAALAAY
                     CRPEVAARLADHPLFPEPWRPALAFDPEALAEIAARRRAGPAGRSPPPLRRRVAWMSQ
                     IADPEDVRVVVLYDPLPGEALAAPPGEDERRRPEWPPRRGGLSHALAALGNRLLLSAD
                     SHAWAGRWTGAPDVSALGAQGVLLLSTRDLAFRGAVEYLCARLAAARRRLIVLDAVDP
                     ENWPRDGPAVGQAHVYLRAAVLPRRSAPRAGPSGALARAVLASRRVFGPGAFARAEAA
                     YARLYPEAPPLRLCRGGNVRYTVATRLGPRTAVPVPPREYRQRVLPALDGRKDMAAQG
                     AALGLGEPDFVEGEAASHRAANRWGLGAPLRPVYLACGRRALELAPDELPAAAVAFCA
                     AALPEPRAEAPPLVLEAAAAPPAAAAPGVDWDADQGPRETLVLLRRAAGGGLVERVPP
                     PAAEAPPARVPAQSSPGAGSGFPAPAGGGRRPRRPRRGPPPRVEVLSSSSSSSSSSSS
                     AASSPASSDDDEAGAAGGGPASP"
     intron          complement(107731..108190)
                     /note="alternative intron spliced out to produce
                     immediate-early RNA 4.2 and BICP4"
     misc_feature    111080..111300
                     /note="origin of DNA replication (ori s), duplicated"
     intron          111681..111802
                     /note="for immediate-early RNA 1.7 encoding BICP22"
                     /number=1
     intron          112069..112745
                     /note="for immediate-early RNA 1.7 encoding BICP22"
                     /number=2
     gene            112768..113737
                     /gene="BICP22"
     CDS             112768..113670
                     /gene="BICP22"
                     /codon_start=1
                     /product="immediate-early and late transrepressor protein
                     (cell nucleus)"
                     /protein_id="CAA06140.1"
                     /db_xref="GI:2653354"
                     /db_xref="InterPro:IPR003403"
                     /db_xref="UniProtKB/TrEMBL:Q77CA7"
                     /translation="MSHGQPCPTCDGSCRLCRSPDRVVSGPAPADEHARRGPGAFCPE
                     DWRPEALRLAIDVNTLFRCIATGSAFVTADTRALRRALVGFFLLGYTGATPTDACWEA
                     LLQLSPEQAGPLRRLLRAAAAAGPRARPLSPPARLPGPLFGAECDVSGSDSSSEDYEE
                     DEEADEEGEENGGEGAAAESPPRCRPRAAVLSSASPAASAVSFVSSPTASSSTSSSSL
                     SSFSASDGDDDVFFPGPGDPRPAGAGPGAGGPPARAGRRRPAPCWRWSSGSSPGSSPY
                     PSPGGSPSGRARARPAPAKRRQRV"
     polyA_signal    113732..113737
                     /gene="BICP22"
     gene            complement(113789..113794)
                     /gene="US1.67"
                     /note="synonym: US2"
     polyA_signal    complement(113789..113794)
                     /gene="US1.67"
     gene            complement(114213..114944)
                     /gene="US1.67"
     CDS             complement(114213..114944)
                     /gene="US1.67"
                     /codon_start=1
                     /product="US1.67 protein"
                     /protein_id="CAA06141.1"
                     /db_xref="GI:2653355"
                     /db_xref="InterPro:IPR010447"
                     /db_xref="UniProtKB/TrEMBL:O39501"
                     /translation="MYRQGTPNRVVISTVPLSREATATATAGTGPGCEGGLGGWRLFK
                     ACRHEQEDGLYAMLPPDYFPVVPSSKPLLVKVPAPGASPDRTGGAVHFECVPAPRRPL
                     QFFRQLYDGTFVKLPHNFPDECYEDEAPLADRFYLNADVDPQSLPVGNMSQYFTRLPD
                     AFQRELRAKVPGPARTPLPHRRYVLRLGSERVAGERYTEDCFELIDTRMLRLERAPSE
                     RAPLHAGANSRRARVRASLPRDPRP"
     misc_feature    114235..123983
                     /note="unique short region US"
     gene            complement(115001..115663)
                     /gene="US2"
     CDS             complement(115001..115663)
                     /gene="US2"
                     /codon_start=1
                     /product="US2 protein"
                     /protein_id="CAA06142.1"
                     /db_xref="GI:2653356"
                     /db_xref="InterPro:IPR003485"
                     /db_xref="UniProtKB/TrEMBL:O39502"
                     /translation="MVTIVTCADRRGALPGASPDVPARVWRFLAEQSRALTASRLGTT
                     VVVFDHALVKTAKGCTSTSTSTPAAGWLLSTQRPWPAPGGAGLARHRQPAEWVSVVDG
                     YNLLNSGRARARPFHMWVFGAADLYAPIFAHIAATTRLVYAQLDCTFAGAAWRLPRRG
                     PAIASPWPPYDTPTLPELVAGGVLFRLVYEVVDRGAAPRPAKREPPCPRGSPPRAPCA
                     IL"
     gene            115796..117202
                     /gene="US3"
     CDS             115796..117202
                     /gene="US3"
                     /codon_start=1
                     /product="virion serine/threonine protein kinase"
                     /protein_id="CAA06143.1"
                     /db_xref="GI:2653357"
                     /db_xref="GOA:O39503"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:O39503"
                     /translation="MERAAERLARQRARGLWRSRFACCVAAEPSGEPARPERSRSRCG
                     SARCAAAGSADLYLAVNNEGPEVAPPARTGPPDADGIEGGAAVGNEQGGVAAGNERRA
                     AIGDKKKSASGGENESESESESESESGSESGADDGDWDDDDDAGPAGGVTREEAEGAA
                     RALNFRIIRRLTPGSEGRVFEATGPAPAQEHVVLKIGASASTLAEAMLLRTLDHANVV
                     KLKAVLFHGELVCVVLARYREDLHTHLWRINRPLALPAALAVTRAVLRGLAYLHSRRI
                     AHRDVKTENVFLNGPGDVCLGDFGAAHGPVTEPRYYGLAGTLETNSPELLARARYDCR
                     TDVWSAGVVAYEMLAYPRALFDSPAGPQGEDAEASGPPTILGDRDCARQLLRVIRRLA
                     VHAEEFPPSPTDRLTRNFKRHASTRREPHSPYRCLAVLRLPCDADRLLHQMLTFDFRA
                     RPTAAELLEHPVFGAASG"
     gene            117337..118671
                     /gene="US4"
     CDS             117337..118671
                     /gene="US4"
                     /codon_start=1
                     /product="glycoprotein G"
                     /protein_id="CAA06144.1"
                     /db_xref="GI:2653358"
                     /db_xref="InterPro:IPR003363"
                     /db_xref="UniProtKB/TrEMBL:O39504"
                     /translation="MPAARTGTLAAVALILLCGAAVLGRPAPDDLCFADVRRTGMAPS
                     RPLGPVLNLAASDLTSRVSVRAVDASRGCALALLDMAETVVPGGPRAADVVDVGWAYQ
                     DGDCMVPLAYRQYFNCTGGALPGQNVCAGLSETRIRGGFGTSDYALYGTSLVLRPGLY
                     DRGTYIYFLGYGPDDIYVGSVTLMVGADIHKYPCGLDRGLGVALHHKSGPARPLTEDD
                     ATGDWACGCFPALVEVDAVWGNVSAAELGLADPIDYADEGGEVEVLEDEAGSASGNLP
                     QDDPDPDLADCRTVGLFSESDMFRTASGPESLLIGAVAKDVLTVPLNLPPGRSYEALR
                     NASLECNSRPRETGDAAVVVMSLQEPARLERRPDARATDPEFGLFGLPDDPAVRRGIL
                     IGLAIALLVLLFSLVIVLVCACRLARAAKAARRARAATFAKSNPAYEPMLSV"
     gene            118717..118722
                     /gene="US3"
                     /note="synonym: US4"
     polyA_signal    118717..118722
                     /gene="US3"
     gene            118896..120149
                     /gene="US6"
     CDS             118896..120149
                     /gene="US6"
                     /codon_start=1
                     /product="glycoprotein D"
                     /protein_id="CAA06145.1"
                     /db_xref="GI:2653359"
                     /db_xref="GOA:P24906"
                     /db_xref="InterPro:IPR002896"
                     /db_xref="UniProtKB/Swiss-Prot:P24906"
                     /translation="MQGPTLAVLGALLAVAVSLPTPAPRVTVYVDPPAYPMPRYNYTE
                     RWHTTGPIPSPFADGREQPVEVRYATSAAACDMLALIADPQVGRTLWEAVRRHARAYN
                     ATVIWYKIESGCARPLYYMEYTECEPRKHFGYCRYRTPPFWDSFLAGFAYPTDDELGL
                     IMAAPARLVEGQYRRALYIDGTVAYTDFMVSLPAGDCWFSKLGAARGYTFGACFPARD
                     YEQKKVLRLTYLTQYYPQEAHKAIVDYWFMRHGGVVPPYFEESKGYEPPPAADGGSPA
                     PPGDDEAREDEGETEDGAAGREGNGGPPGPEGDGESQTPEANGGAEGEPKPGPSPDAD
                     RPEGWPSLEAITHPPPAPATPAAPDAVPVSVGIGIAAAAIACVAAAAAGAYFVYTRRR
                     GAGPLPRKPKKLPAFGNVNYSALPG"
     gene            120287..121435
                     /gene="US7"
     CDS             120287..121435
                     /gene="US7"
                     /codon_start=1
                     /product="glycoprotein I"
                     /protein_id="CAA06146.1"
                     /db_xref="GI:2653360"
                     /db_xref="InterPro:IPR002874"
                     /db_xref="UniProtKB/TrEMBL:O39505"
                     /translation="MRCLLLWMVVLAARAAPARSLVYRGEAVGLRADGPVAFAVHPTD
                     ATLALRGRLIFLEHQLPAGRRYNGTVELLRYHAAGDCFVMLQTTAFASCPRVANDAFR
                     SCLHADTRPARSERRASAAVENHVLFSIAHPRPIDSGLYFLRVGIYGGTAGSERRRDV
                     FPLAAFVHSFGEPGDPEAAAAHPGAVEAVATRCERGLDASSASLYDRALAAFPAGAAT
                     TPGPTASSGSGAATPERVDETTEVKAATRAGSAFALTTPPAGLTASPAASPSRAFSAA
                     APAAAAQPAGDTPARFRRQLASILVPLCVLVLLLLALCAATVNCALRRRLLPCSRRVY
                     KPRTCATCGSGTCAGRPPCRGAAPSAPATVVALGSRPKAPPLATISEE"
     gene            121431..121436
                     /gene="US6"
                     /note="synonym: US7"
     polyA_signal    121431..121436
                     /gene="US6"
     gene            121714..123506
                     /gene="US8"
     CDS             121714..123441
                     /gene="US8"
                     /codon_start=1
                     /product="glycoprotein E"
                     /protein_id="CAA06147.1"
                     /db_xref="GI:2653361"
                     /db_xref="GOA:O39506"
                     /db_xref="InterPro:IPR003404"
                     /db_xref="UniProtKB/TrEMBL:O39506"
                     /translation="MQPTAPPRRRLLPLLLPQLLLFGLMAEAKPATETPGSASVDTVF
                     TARAGAPVFLPGPAARPDVRAVRGWSVLAGACSPPVPEPVCLDDRECFTDVALDAACL
                     RTARVAPLAIAELAERPDSTGDKEFVLADPHVSAQLGRNATGVLIAAAAEEDGGVYFL
                     YDRLIGDAGDEETQLALTLQVATAGAQGAARDEEREPATGPTPGPPPHRTTTRAPPRR
                     HGARFRVLPYHSHVYTPGDSFLLSVRLQSEFFDEAPFSASIDWYFLRTAGDCALIRIY
                     ETCIFHPEAPACLHPADAQCSFASPYRSETVYSRLYEQCRPDPAGRWPHECEGAAYAA
                     PVAHLRPANNSVDLVFDDAPAAASGLYVFVLQYNGHVEAWDYSLVVTSDRLVRAVTDH
                     TRPEAAAADAPEPGPPLTSEPAGAPTGPAPWLVVLVGALGLAGLVGIAALAVRVCARR
                     ASQKRTYDILNPFGPVYTSLPTNEPLDVVVPVSDDEFSLDEDSFADDDSDDDGPASNP
                     PADAYDLAGAPEPTSGFARAPANGTRSSRSGFKVWFRDPLEDDAAPARTPAAPDYTVV
                     AARLKSILR"
     polyA_signal    123501..123506
                     /gene="US8"
                     /note="noncanonical TATAAA"
     gene            123548..124429
                     /gene="US9"
     CDS             123548..123982
                     /gene="US9"
                     /codon_start=1
                     /product="virion protein (tegument)"
                     /protein_id="CAA06148.1"
                     /db_xref="GI:2653362"
                     /db_xref="InterPro:IPR009278"
                     /db_xref="UniProtKB/TrEMBL:O39507"
                     /translation="MESPRSVVNENYRGADEADAAPPSPPPEGSIVSIPILELTIEDA
                     PASAEATGTAAAAPAGRTPDANAAPGGYVPVPAADVDCYYSESDSETAGEFLIRMGRQ
                     QRRRHRRRRCMIAAALTCIGLGACAAAAAAGAVLALEVVPRP"
     misc_feature    123984..135300
                     /note="terminal repeat of the short segment TRS"
     polyA_signal    124424..124429
                     /gene="US9"
     gene            complement(124481..125450)
                     /gene="BICP22"
     polyA_signal    complement(124481..124486)
                     /gene="BICP22"
     CDS             complement(124548..125450)
                     /gene="BICP22"
                     /codon_start=1
                     /product="immediate-early and late transrepressor protein
                     (cell nucleus)"
                     /protein_id="CAA06149.1"
                     /db_xref="GI:2653363"
                     /db_xref="InterPro:IPR003403"
                     /db_xref="UniProtKB/TrEMBL:Q77CA7"
                     /translation="MSHGQPCPTCDGSCRLCRSPDRVVSGPAPADEHARRGPGAFCPE
                     DWRPEALRLAIDVNTLFRCIATGSAFVTADTRALRRALVGFFLLGYTGATPTDACWEA
                     LLQLSPEQAGPLRRLLRAAAAAGPRARPLSPPARLPGPLFGAECDVSGSDSSSEDYEE
                     DEEADEEGEENGGEGAAAESPPRCRPRAAVLSSASPAASAVSFVSSPTASSSTSSSSL
                     SSFSASDGDDDVFFPGPGDPRPAGAGPGAGGPPARAGRRRPAPCWRWSSGSSPGSSPY
                     PSPGGSPSGRARARPAPAKRRQRV"
     intron          complement(125472..126149)
                     /note="for immediate-early RNA 1.7 encoding BICP22"
                     /number=2
     intron          complement(126416..126537)
                     /note="for immediate-early RNA 1.7 encoding BICP22"
                     /number=1
     misc_feature    complement(126918..127138)
                     /note="origin of DNA replication (ori s), duplicated"
     intron          130028..>135301
                     /note="5'part of intron spliced out from transcript over
                     covalently joined genome ends, leading to immediate-early
                     RNA 1.5 and circ protein"
     intron          130028..130487
                     /note="alternative intron spliced out to produce
                     immediate-early RNA 4.2 and BICP4"
     gene            130514..134591
                     /gene="BICP4"
     CDS             130514..134545
                     /gene="BICP4"
                     /codon_start=1
                     /product="immediate-early transactivator protein (cell
                     nucleus)"
                     /protein_id="CAA06150.1"
                     /db_xref="GI:2653364"
                     /db_xref="GOA:Q4LDG6"
                     /db_xref="InterPro:IPR005205"
                     /db_xref="InterPro:IPR005206"
                     /db_xref="UniProtKB/TrEMBL:Q4LDG6"
                     /translation="MSSPGRLELATLDLYDLIESADLGPTGGSEEDPALLDAARRAEA
                     RERRRAARAELAELWRMVGGEDAESSEDDGAGDAGATEGAEAEDAEIGEDAGARDAGG
                     AEDADVAECAEAEGAEGAEDADSAWAAARALAVAVEAAAAGAEAAAAEAAVIAAAIEA
                     EAGAAPLKAEAGTEAGGGGALGARTEAGDVGPEDCSDAGSEDSGPEDCSDAGPEDDGG
                     EAREGSTDADAEAEAEAEAGTGAGTRTKAAPREAGAGPGAPRGRAPGPPAPSPPETAP
                     PPPRRQRGRATGARAGYAAAPRDGPPPLEGPLLTPSGEAWPGSAPPPPGRVRFGGAGD
                     TREGLWDCPEIREAAARYAAAAGPAAVFVPEMGDAGKQYAALVDLVYARRDAMAWLQS
                     AKLAGPDLQLARLLQRRVQGCRGHSSFITGSVTAPLPPVGDAMAAQNALWALPHVAAC
                     VAMSRRYDCDQKLFLLQSLRRAYAPMAYPEAGAGGSGARAALAELRAVLAGRAAPAPL
                     PPASTARAARERLRELADRCAVACREALEAARRAAGAAGLPVLSAAAGRGLPAAACAP
                     DALAAHPERVLRAAELLGAARDAVERARLQRAAPAALRAEAAAALEAAALAARTVAPL
                     ARYSTRGAAARASAWALARALFSPPAEVPARLAAALAALEAAGGGAGAGAAAPGRGPV
                     EVEVEDMRAGAPRADPEDGSEAEDGEDGEDEEAEEEEEEEKEEEEEEEEEEEEEEEGR
                     PGPAAGAPPGPREGRRAEEEEEEEEEEEGDGDGDGEAAALPAAAGGPSGEDDSGPRRR
                     RKAAAADAAGPARREPPLPARVLGPMPPGGPAADGGFRRVPPGDYHTPAPSAAALAAY
                     CRPEVAARLADHPLFPEPWRPALAFDPEALAEIAARRRAGPAGRSPPPLRRRVAWMSQ
                     IADPEDVRVVVLYDPLPGEALAAPPGEDERRRPEWPPRRGGLSHALAALGNRLLLSAD
                     SHAWAGRWTGAPDVSALGAQGVLLLSTRDLAFRGAVEYLCARLAAARRRLIVLDAVDP
                     ENWPRDGPAVGQAHVYLRAAVLPRRSAPRAGPSGALARAVLASRRVFGPGAFARAEAA
                     YARLYPEAPPLRLCRGGNVRYTVATRLGPRTAVPVPPREYRQRVLPALDGRKDMAAQG
                     AALGLGEPDFVEGEAASHRAANRWGLGAPLRPVYLACGRRALELAPDELPAAAVAFCA
                     AALPEPRAEAPPLVLEAAAAPPAAAAPGVDWDADQGPRETLVLLRRAAGGGLVERVPP
                     PAAEAPPARVPAQSSPGAGSGFPAPAGGGRRPRRPRRGPPPRVEVLSSSSSSSSSSSS
                     AASSPASSDDDEAGAAGGGPASP"
     polyA_signal    134586..134591
                     /gene="BICP4"
     misc_feature    135301
                     /note="In the linear genome, G 135301 forms a single base
                     3' overhang; the complementary C is attached to the other
                     genome end (also a single base 3' overhang). Upon
                     circularization, the genome contains 135301 basepairs."
ORIGIN      
        1 ggcccagccc ccgcgcgggg ggcgcggaga aaaaaaaaat tttttccgcg cggcgcgtgc
       61 attgcggcgg gcgggggcgg ggtgggggat gggcgcggag cgcgagggta gggttggcac
      121 actgccaaga tcaccaagca tgtgcgcggc catcttgctt ccaaactcat tagcataccc
      181 cgcccattat tccattctca tttgcatacc caccgttgca catgccgcca tattgctcct
      241 cctccctcgc tcctcctccc tcgctcctcc tccctcgctc ctcctccctc gctcctcctc
      301 cctcgctcct cctccctcgc tcctcctccc tcgctcctcc tccctcgctc ctcctccctc
      361 gctcctcctc cctcgctcct cctccctcgc tcctcctccc tcgctcctcc tccctcgctc
      421 ctcctccctc gctcctcttc aaaacactac cgcgggcgtc cgctctcact agcttcggcg
      481 ccgtcatggg tgcccgcgcc tccgcgcctg ctgccggccc gcccccagcc cacgctgttc
      541 tactagatgc gctctccggg ggcacgattg acctgcctgg cggcgacgag gccgtctttg
      601 tgtcctgccc gacgacgcgc cccgtgtacc accacatgcg ccgcggccgc acggcccaca
      661 ctacacccgt gcacttcgtt ggccgcgcct atgccatctt gccctgccgc aagtttatgc
      721 tgtatctgat gcgcggtggt gccgtttacg gctacgagcc caccactggc ctgcaccgcc
      781 tcgccgattc actgcacgac tttcttacta ctgccggact acagcagcga gacctacact
      841 gcctcgatgt cacggtgctt gacgcgcaga tggacccggt gacgttcacc acccccgaga
      901 tcctcatcga gctcgaggcg gacccggcct tcccaccgcc gccctcggcc cgcgcgcgcc
      961 gctccacgct gcgccgggcg tctatgcgcc ggcccgcacg caccttctgc ccccaccagc
     1021 tgctagcaga gggctccatt ctggacctct gctcgccaga gcaagcggcg gcgccgggct
     1081 gttcgctgct ccccgcctgt gactctggag acgccgcgtg cccctgcgac gctggcgaga
     1141 ccgcccgtga ctgtactgcc gatgccgcgc gcgctcccag ccccggcgcc ttatctcgct
     1201 atagctccgt gcgctcggtg ttcttttagc gcgcgggcgc ccgtgtggga catacattaa
     1261 taaatgcagc gtttcttact ctactgtagt ggctggccgt ttgcttcttt ttgggattgg
     1321 caatttagcg ttccgtcgac gccacatctt ttgcctttct gtttcccgtt gcgtgcgcgt
     1381 gtgtcgccga gccgacttgc cccgacaaca caggcaggca cgcggccccg cgccccgcca
     1441 ggcactattt gcgctcgggt gcattgagct tgactttgac tcgcttttgt gccgacgccc
     1501 aattatttgc cttggcccgt tgtgttcccc ccgcgcgcgc ttgtgccgcc caagcccgcc
     1561 cgcccgatag cgcgcccgcg cctgtgtccc caacaagtac tatacacact cgagtatatc
     1621 gggttcaaat caatgttgac aggttgactt tattagctta gaagatctcg ttgcagtaaa
     1681 agtattttcc gtgcatgtac acgggaacca gggtgaaatt agcgacgagc ttgcacgtca
     1741 tgctgtcgca agcctgtttg tgtgtgtcca gggcatcgat gaggcccgcc acgcaggtcc
     1801 cggggatgta ctcctcgaaa ggcgcgtcgc ccacagtcac ctccaacagc ggcacgcact
     1861 ctgcgccgga gcgcaccgcg cggcttagac gcgccaacat cacgaacatg tacgatgcgg
     1921 ggcaggtggc gaggcttagc cggcgcgcgg cgcagagctc ctccagcgag ggcagcccgc
     1981 gcccgcgcag gtagcagcgc agaaaaggcg ctagcttcag ccgcaggttt tccagcacgg
     2041 cgccggccgt ggccacgata gggtctttgg tgcgcaggcg caagttcttg gtggcgatga
     2101 acttgcacca cgttaggcac tcgtcggccg aggccagtgc gtctaccagg tttgcgctgc
     2161 gcagcaccag gtctcgcagc gcccgcgccg cctgggcggc gtgcgggcgc acctcaaaca
     2221 tgcggtagag gtcgcggccg tggaacatga gcgtctccca ggtgacgcgg cggccctcgg
     2281 gaacgaattg ctccgcgcca aagtccaaga cggctgccca tggcgacacg cccgctgcgc
     2341 ggaacccgcc gttttgcacg ggccgcatga ggtccagtcg cgcgcccgcg aagacggcgg
     2401 tgacgcgctc ggccgtggct cgctgcgccg cttcggccaa gcttcgcgcc agccgcagcg
     2461 agctcccgat cgagcgggcg gcggcgcccc cgccgccgtg tgaagacgtc gcgagggccg
     2521 cctcgcgctt tgctgccggg ccgcgggacc gctgctctcc ggcgggctgt cttcggcgcg
     2581 ggcgcctgcg cggccgccgc ggccgcacgc gagcccgccg cgccggaggt gcttcggcgg
     2641 gaccgccgtc gccgcttgcg gcgccttcgc ccggcggctc ggccggcatc ggctcgtcct
     2701 ccgcgccctc cagcttgcgc ttgcgaacct gccccaccac ggagcgcagg gcgggagcga
     2761 gcgagggcgc ctcgtcgtct tcttcgcggt cagagccgaa gaggctcaag tcgtcgctct
     2821 cgctggccgt gctgagggtt gcgatctcgg ggtccgccat gccgctgcga ctcgcgggcg
     2881 tcgtcgtcgg gccgggtgcg tcgccgttcg ggccggacgg tcggtgtctc gcgtttctaa
     2941 aagagggctc gcactccggc gccgtgttcg cactgagacc ggcattttat gttcgccggc
     3001 cccaccctgc gcggcagcag cgccgcccaa taggggcggt cacgtctgcg cgcccagcag
     3061 ccgcaggcgc aggttgtgct cgtagtgcag cagcgcgatg acgcccccca cgatagcggc
     3121 caggtagagc gcctttacga gcagccccgc gagcagcgtg gagcagcagt taacgcacac
     3181 ctttctgatc ccgctctcgc cgccgtcgcc gccatcgccg gcgcacgtgc ctccgcgccg
     3241 ccgcggcttg cggtacagca gcgagaccag ttccaatccg gcaaagaggg cgacgtgaac
     3301 ccacgcccag attttcaggt acagcgggta ggcggccgcg caggggtgcg ttatgccgac
     3361 gctgccggcc gccgcaatcc gcgcgccgag ccgcgcaaag ccctccgcaa gcagcgggag
     3421 agcagcccgg gggcgccagg cgcagcccag ggggtcgagg cggaagtcga cagcaagcgc
     3481 gcgccggcgc gccgagagct cgcacatgag ccgcgcgagc ttcgtgtacg ggccgtggcc
     3541 gactacggcc gcgagcgcgg cggcggcgta gttgagggtg tagccgccgg ggctgaggaa
     3601 gtcggcgtcg ttgcggcaaa gaccaaacat gcgccgctcc tggcgcaggt acacgaacgc
     3661 gacgtacagc agccatgcca gcaggccgcc gcgagcctgc gcgcaccaca ggtaggcgcg
     3721 gcaatcgcgc gcgccggcca cggcgcgcac gcggccgtgc agcgcttcgt cgccgtcgag
     3781 cagcccgggc gggatgtgct gcacgacggc gtgccggcac ggggcgtcgg ccgcgagcgt
     3841 ggcgttgttc gcgccgcccc agacgtagac ggcgccgggg ctgcgcagct cccagcggag
     3901 cgagccgttg cgcgcggtgg cgcggacgca cgcacagcgc tggcagcggg cggcgagcgc
     3961 gacccacagc gccagcgcga ggtgggccgt gagcagcgcc agcgcggcca agttaacagt
     4021 ccgccccccg agcagcatac cgcgccgcgc gccccgagag atccacggtg aacacggtac
     4081 cgaggcggtt gctgccgcac ttggtagcga agcactgctg gatgagcgag gcacacaggc
     4141 ggtcgtgcga gtcgacactg agggacacca gcgagcgggc cttgttttgg gccgcgcgcc
     4201 cgtgggccgc gcgcaggcag ccaaagccct gcgcggtgcc ggcgcgcgcc ggcacgagct
     4261 gcgccagcag ccagtcggct ttggcggcca cgaggcgcgc gccggcgcct tggtactcgc
     4321 gcgccgcctg cgggtagtgc tccgccatgt agggcgccag ctcggcctcg attacgtcag
     4381 caataaactc ttcgacggcg ccacggtcgc cgccgtcgac gccgacggcg gcgagcgcgc
     4441 gccgcaggga aacgcgcacg ccgtgaaagg ccgcgcggtt gacggcggcc ttgcgctcaa
     4501 aaaagctaac gtattcgccg ccaacgtgcg cacgacgtgc ctcgcggcgg ccgcccgcgg
     4561 gtggcgcggc gtggaagtgg aagtggtgcg ggtcgcggtg cgcggcgacg aaggcggcca
     4621 cgtcgtcgca gcgctctggg accacgtaga agggcaggag ccaccgcccg acgttgcttg
     4681 cggcgtctgg cttgccaaaa aagggcaaac gcaggctgtg cccgtgcgtg tagacagccg
     4741 cgtcaacgaa ggcaaagtcg cgcaagtagc ggctcatggc ctcggcgaag gggcgttcca
     4801 gcatgacggc atgctggacg aggcgcgcga tgcccttgag cgtggggccg ccggcgataa
     4861 tgtatggcgc cgggacgggc acagccacgc ggaagcccat tttgtcgtcg catccgcacg
     4921 cggtcgttag ggccgccgcg cttcccgcgc cctccgcgcc gcccgtctct tcaggccggg
     4981 cgcccgcggg gtcgctgacg tcctcgcagc tgtattgcgc ctcgccctcg cgcgcgaggg
     5041 cgctctcgta ctcgtcccag cccgcgtcgc ggtcgggcgc ggcccaggac ggcgacgcgt
     5101 cgccgtcgcc taggttgcta gcggcggccg aagggcacgc gctcttgtag aagaagcagg
     5161 ggtgtgcggg ccaggcatcg gcggcgattt cggggaacag cgccgcgagc gcggcaagcg
     5221 cgccgcgacg gaagctgcgc atggctccgt gcaggtctcc gcgggggagg gggcgcttga
     5281 ggcgaaagtc cacgtccagg acgatgttgg ttacggcgag gcgggcgttg aacagctcgt
     5341 tgcggttcac gtagtactgg tcgcgcggcg cggccgggcc caggctccgg cggtccgagc
     5401 ggccggcggc acaggccgcg cgctcagtga ggagcgcggt tagccgcgcg tctcgctcca
     5461 caagcgcgtc ccggccgctc tctgcggcgg cggcagcggc cgccgcaacc tcgaccgcca
     5521 cttcgtcggg gtctagggcg gcgacgctcg tgacggcggc ccagtcgtcg ccgtccgcga
     5581 cggcaaatgc ctggtggccg cgcggtagct ccactcggta gacgggcgtg ggcgccgcgg
     5641 tcccgcgcgc gccaaagagc ccgtccagcg gatgcgcgcc gtcgcgcgcg gcggcggccg
     5701 ccagctcaag tagccgcttg gacaccccgc agcaggcggg cgtcgcatca ggggacgcac
     5761 cgccgtccgg cgcgccaacg cgaagcgcgg cgtctagccc cgggcccggc accgcgcttg
     5821 cgcttggcgc gccgggtgcg tgcagcaccc acccgaagcg agccgcctgg ccctcgaggt
     5881 ggtccagcgc tgcgcgcagg gcggccgcgc cgtcgcagat tgtgcgcccg ggcccattag
     5941 cggtcgccgc gagcaagcgc gcgtacgtac gcgcgcgcgc gtaagcctcg gctgttgcgg
     6001 ggggcagccg aacaacggcg accgccacgt tctgttcgat gtagctttgg acgttaaact
     6061 gcgcgcgcac gtgccgaaaa aaagcgtcaa cggcgcgctc gcggaggcgc gagacgcccg
     6121 cgaggcgcgg cgcgagcgcc tcgccgccat cggggggctc ggtggcggtg acggcgcgca
     6181 ggtgctcggt gatctgccgg cgattaaagc cctcaaagta ggccaagtat acgtaggcca
     6241 cgaactccgg gtcggccact ttaagactgc gacggtcgtg gtcgatgtac tcgcgcaggc
     6301 agcggacctc ggcgaggtcg gcctcgatgc gcgcggccac gtacgcgggt gccccggcgg
     6361 caaccgcgcc gcgggcgtag ccgctgcggc agcagaaggc ggcaagcgcc gcgaaggaaa
     6421 ccaagtcggg gaaggcgagt cccgaggggt taggcggcgc ggcgacggcg tacgtggcca
     6481 ggcagtcccg cacggcctgc aggtcgtagg tagcggcgtc gccggcgcgc tcagcctgga
     6541 acacgtagaa gcgcgtggcc aacaccaagg ttttttcgcc gggcccaaac ttggagagga
     6601 accagaaggg agtcgcaccg ctgttggagt aaagccgccg gtaggcggcg accgttttgt
     6661 gctcgtggtg gatgtagagc gaggctaggc cgcggcggcc ggccgggcgc gcgcgcaggg
     6721 ccgagcgcac tgtagtctgg ccctcaacat agcgggcgtc gtctgcggtg cggccggtgc
     6781 gaggcgccag ctgctccgtg gccaccagca gcgcgtgatc atgtccgcgt gcagcgcaaa
     6841 ggtgacgtcc tcggcgaggt gctcgagcag cacgcgcgcg ggtagggcct tgccgaggag
     6901 cagtgcgtcg gcgagcgcgc gcgcgccctg cgcgctgttg aaggtgcaca cgaagacggg
     6961 ccaggcgcgg ggtcgcggcg gcgcttccgc ccggcgggcc gcccagcaga taaaacgcga
     7021 cgagcggccg cgcatccgcc agcgccagcg ccacgtcgtt tgggctttcg ccaccaaggc
     7081 acgcggcgag ccgcccgggc cagttgtagg agaccacgta ggcgccacgg ccgggctcct
     7141 cctggcccgt gagcagcatc agcgaaaacc cgatcgcgca gccgtcggtg gcgtacagga
     7201 tttggagcgc gtcctcgagc gcggctgggc cgtccatggc gctgcagcgg ctggtcgggt
     7261 ggctgtgcgg gcgcggcggg ggcacgcgag acgctccgca gtacgagccg ctggcgcggc
     7321 gcctgagcgg accgacgcta tttcgcctgc aagaagcggt ggtagccgtc agcgcgctgc
     7381 tgccggcgcc gctgacagtg gaggacgtgg cgcgctcggc agacggcacg cggcggcttg
     7441 ccaaggcgca gtcgctagcg cggacctact acatctgcca gcggaacatc gagtgcctct
     7501 caaagcacca ggccgcgtgt agtgacgcaa gcatcaccgc cgtcgtgacg aagcacatac
     7561 aggatgctca gcgcatgcgc gacacctgcc tggccgcctt gcttcaaatg taccactcgg
     7621 tgggcgctgt ggagggcacg acggacagca tggtggacca ggccatccgc atggcggccg
     7681 aaagcaacat tgtaatggcc gacgttgcgg tgctggagcg cgccttgggc attcaggcgc
     7741 agggcgcggg cgcggaggcg gcggccaggg caagcccgac ggccgttggt gccgaggctc
     7801 gggccccgcc gcccctgccg cggcagccgg ccgcctcggc gccggtcgcc gtgtctccgg
     7861 caccgccggt ggcgcctgca gaggcggccg ccacaaaacc acctagccgc gcggggcgcg
     7921 cggcggccgc cgcttcttcc cccgccgttt tgcagcttgc ggcgtagccc ggtgcaataa
     7981 aagcaaaata agtatacgca aaacacgtgt gtggtggagt cggtgtactt taatgtgctt
     8041 tgttttacag cccggtggac ccaaagccgc gcggcccgcg cgcagagggg ggcaccgccg
     8101 cggcgagatc ggcgacgcgg cgccagcgca ggcgcggggc cccaggggcg ggcggtgctg
     8161 cgcgagggct agttgggaag ggctcgcggt cgttgaggcc ggacggaagc cactcgaggc
     8221 gccgtgccag cagaagcagc tgcgccacgc gctggcctgc ggcagcaacg agcggttcct
     8281 gcgtgacgtt tcgcaagaca aagcggcagg gctccccggg gggccaggct gtcggcagga
     8341 cgatcagccc ccgaaggttg caggacgatc gaccaaacac gtagggcgcg gcagcgtggg
     8401 cgtctgccgc gtaggctacg ggcagccgca cgtgtaaatt ttccccgggt gccaagacgg
     8461 ccgtgtatgg catggcaata tcgtacccgg cgtcctcgtc gcgtttgggg gcgaacgtgg
     8521 caaagaaggg cacttcgacg cccgcctctg tcccggcgtt tgcgtcgtcg tcgacggcga
     8581 tgaggcgagg cagcgtggtg gttagccgcg cgagcgtcag ccgcagcgca agccccgccg
     8641 ggggagcggc cgctgcggac tcgggcgccc agacgatggc gcgcaagatc cccgagtagc
     8701 ccgagtcgac gatgccgacg gccacggctg gtgggcgggg catgtgtgtg tcacccgagc
     8761 gcatttgcga cattataatg gcatatccgc cgggcgcggc cgccttcatg tttaaattaa
     8821 tcagccggct ataaaggaga gatcccgacg gggctgtttc atctcgcttt gctgctggcg
     8881 caattgggcc ccagagcgcc agcgagtcgg gctcacagca gctttccaac cgccaggggg
     8941 ccgcctccgc gttgagctct acgacgagga tgccgcggtc gccgctcatc gttgcggttg
     9001 tggccgccgc gctgtttgcc atcgtgcgcg gccgcgaccc cctgctagac gcgatgcggc
     9061 gcgagggggc aatggacttt tggagcgcag gctgctacgc gcgcggggtg ccgctctcgg
     9121 agccaccgca ggccctggtt gttttttacg tggccctgac cgcggtaatg gtcgccgtgg
     9181 ccctgtacgc gtacgggctt tgctttaggc tcatgggcgc cagcgggccc aataaaaagg
     9241 agtcgcgggg gcggggctga ttgaccgcaa cgctgcggag taacttgtat ataaagctcg
     9301 cggtcccggc gaccgctgcc tttttcgcac tcggcccgac ccgctttgag ctgcacgccc
     9361 gccggcccgc cgactcgctt gccatggccc ggttccacag gccctccgaa gacgaggacg
     9421 attacgagta cagcgacctt tgggtgcgag aaaacagcct ctatgactac gagtccggct
     9481 cggatgacca cgtatacgaa gagctgcgcg ccgcgacgag cggacccgag ccgagcgggc
     9541 ggcgcgctag cgtccgtgcg tgcgccagcg ctgcagccgt ccagcccgcc gcccgcggcc
     9601 gcgatcgagc cgcagccgcg gggacgaccg tagctgcgcc cgccgccgcg ccggcccgcc
     9661 gctcgagcag ccgggcgtcc tcgcgcccgc cgcgagctgc cgccgacccg cccgtcctcc
     9721 ggccagccac gcgcgggtcc tccggcggcg ccggggcagt cgccgtcggt ccacctcgac
     9781 ctcgcgcgcc ccccggtgct aatgctgttg cgtctggccg gccgctggcg ttcagcgcgg
     9841 ctccgaaaac gcccaaggcg ccctggtgtg gaccgacgca cgcctacaac cgaacgatct
     9901 tttgcgaggc cgtcgcgctc gtggccgccg agtacgcccg gcaggcggct gccagcgtct
     9961 gggactcgga ccccccaaag agcaacgagc gattggatcg catgttgaag tcggcggcaa
    10021 ttcgcatcct cgtgtgcgag ggctccgggc ttctcgccgc cgcgaacgac atcttggccg
    10081 cgcgggccca gcgccccgcc gcgcgcggga gcacaagcgg cggggaaagc cgccttcgcg
    10141 gcgagcgggc ccggccgtag cgcgagcggg agggcttttt cgacgcgcgc ggcttaagca
    10201 gcgcgctgct gtgctagtat gaaaataaac gcttgttaat taaacacacc aagccgagtt
    10261 gcgttgtctt tgggatgagc gggcgcataa aaaccgcggg ccgcgcgctc gccagtcagt
    10321 gcggcggtgc tgcggcggca accatggacc cgtacgacgc cattgaagcg ttcgatgact
    10381 ccctgctcgg gtcgccgctc gcggcggggc cgctttatga cggcccgtcc cccgcgcggt
    10441 tcgcgctgcc gcccccgcgc ccggctcccc tggccgcgtt gctggagcga atgcaggccg
    10501 agctgggctt ccccgacggc cccgcgctgc tgcgggccat ggagcggtgg aacgaggact
    10561 tattctcgtg tctgccgacc aacgcagacc tgtacgcaga cgccgcgctg ctctcggcag
    10621 acgcagacgc ggtagtgggc gccatgtacc tagcggtgcc tggggacgcg gagcgcttgg
    10681 acttgaacgc gcacgcgaac cagccgcttc ccgcaccgcc ggcctcggag gagggcctcc
    10741 cggagtatgt ggccggcgta caggcgcatt ttctggcaga gctgcgcgcg cgggaagagc
    10801 ggtacgcggg cctgtttttg ggctactgcc gcgcgctgct gcagcacctg cgcgcgacgg
    10861 cggcgcgtgg ccgaggcgcg gcgggcgcgg gcgcccaggc agaccgcctg cggcagctgg
    10921 tggcggcgcg gtactaccgc gaggcgagcc ggctggcgcg gctggccttt gcgcatatgt
    10981 acgtggcgac ggcgcgcgaa gtctcttggc gcctgcactc ccagcagagc caggcgcagg
    11041 gcgtgttcgt ttcgctgtac tatgcttggc cgcagcggcg gcagttcacc tgcctgttcc
    11101 accccgtgct gttcaaccac ggcgtcgtgg cgctggagga cggcttcttg gacgcggcgg
    11161 agctgcggcg gctaaactac cggcgtcggg agctggggct gccgctggtc cgcgcggggc
    11221 tggtcgaggt tgaagtgggg cctctggtgg aggagccgcc gttttcggga agcttgccgc
    11281 gggcgctggg cttcctgaat taccaagtac gcgcgaagat gggcgcgccc gccgaggccg
    11341 gcgggcggct ggcgccggag cgggagcact cgtacgcgcg gccgcgcggc gcgatcaact
    11401 acgggacgac tccagaggcc atgttgcggc ccccgtcgcc gagcgaagtg ctgccgtgcg
    11461 accccgcgcc agcggctacc gtgcgcgtgg cgagccccgc cacacatctg gctcaggcgc
    11521 cttcagccaa gggcgccgcc ccggccgagt ttgccgcctt ggctgggctt gcaaagcccg
    11581 gtccggcccc gctcgcggcg gccccggccc aagccccgtt cgcagcggcc ttggccttag
    11641 ccgagcccgc ggcagccctg gccccggccc cgcttgcggc ggccccagcc gagcccgcgg
    11701 cggccgtcgc cgggccaagc ccggcaaacc cattcggcgg cacgtatgac gcgctgctgg
    11761 gggaccgcct caaccagctg ctggacttct aagggcgggc gggcagtggc gctttcgacc
    11821 cggcgcgtgg cgtttgcgag gcctccctct ggcgtaaggc ctctggcgcc gccctgcggg
    11881 cggcgcgagc gtataaaagc cacttgggtc tacacgggat ttagttttcg cgcccgcggc
    11941 tttctaggcg cccttagacg ccatggacgc cgctagggat gggcggcctg agcgccgccg
    12001 cgccgtctcc ggaacgtacc gcacgcaccc gttccagcgc ccctctgccc ggcggagcgc
    12061 tggacgccct gcgcgctgcg gacgccgagg ccgcggagcg ccgcgggtcc ggcgcccgcg
    12121 gccgtacttc cagcggcccc cggacgagga caccagtgag gacgagaacg tgtatgatta
    12181 catcgacggc gatagcagcg acagcgccga cgactacgat agcgattatt ttactgctaa
    12241 ccgcggcccc aatcacggcg ccggcgatgc tatggacaca gacgcaccac ccgagcgcgc
    12301 cccggaaggg ggtgccccgc aagactactt gacggcccac ctgcgcgcca tcgaggtcct
    12361 gcccgagtca gcgccccacc ggagcctgct ggagcgcacg gcccggaccg tgtatgcgca
    12421 gcagtttccc ccgcgcgatt tgagtgcggg ctccaaggcg ccggcacagc gcgcgcggcg
    12481 gagcctccgc ggcttcccgc gtggcggcgg gggcggccaa gaacccgggc cagacgacga
    12541 aggcgacgac gccgcagacc tgcgcgagga ccttgtgcca gacgaggcct acgcgcacct
    12601 agagcgcgac gagcggctgt cggaagggcc cccgctcctc aacatggagg cggccgctgc
    12661 ggctgcgggg gagaggagcg tggtggagga gctgtttacg tacgcccctg cccagcctca
    12721 ggtagaggtg ccgctgccca ggattttgga gggccgggtg cggcccagcg ccttcttcgc
    12781 gcagatgtcg ctggacgcgc tgtgccgcac gccgcccaac gatcagcgcg tggcgcgcga
    12841 gcggcgcgct tgggagatgg ccggtacgcc gcatgggctc ctaataacca cgtggagcac
    12901 ggtggacccg gaattctcga tcggcggcat gtacgtgggc gcccctgagg gcacccggcc
    12961 ccggctagtg tggcggcgcg cgatgaagca ggccatggcg ctgcagtacc ggctgggggt
    13021 ggggggcctg tgccgagcag tagacggcgc agcatgccgc ccactgaggc gctgctcttt
    13081 ttggcgtgac gcgctgctgc gcgagtgcgc aactgccatt ttttgtcgcg gccggggcgc
    13141 gcgggcggcg ccgcgccgcc tgccgcggcc ggcggttggg ctgctggcag ccacgcagtt
    13201 cacgccaccg gacgcgtccc cccacgcgac gctctttcgc ggctcaatgg gttccctgat
    13261 ttactggcac gagctgcgcg tgatgctgac tgcggtgccg gccctgtgcg cgcgctacgc
    13321 gggcgccggg ctgcagtcgg ccgagctgta cctgctggcg ctacggcact cagaggcgcc
    13381 cggctacacg gcaaatgagc gctacgcgct ctcggcgtac ctgacgctgt ttgtagcgct
    13441 cgcggagcgg ggcctgcgct ggctgtatct agcgggcgcg cacctgctcg ggccgcaccc
    13501 cacagcggcg gccttccgcg aagtgcgcgc caagatcccg tacgagcggc tgccgctagg
    13561 cagcgcgacg ctgcacgacg ccgaagtgga gacggtggac tcggccacct tccaagaggc
    13621 cctggctttt agcgcgctgg cacatgttta cggggaggcc tacgtagcgg tgcgaaccgc
    13681 gacgacgctg ctgatggccg agtacgcggt ccacgctgag cgccgggacg tgcggcagat
    13741 gacagcggcc ttcctgggcg tggggctgat cgcgcagcgg ctgatgggca gcctgaacct
    13801 gctgctgaac tgcgtagccg gcgcagcggt gtacgggggc cggcgtgtga cggtgcgcga
    13861 gggcacgctc gcgcggtaca gcctgctagc ggacgcggca ctgccgctgg tgcgcccggt
    13921 gttcctggtg gagttccggg aggcccgcga cggcgtcatg cgcgagctgc ggctgcggcc
    13981 cgtggcgagc ccgcccctgg ccggcaagcg gcgggtcatg gagctgtacc tctcgctgga
    14041 cagcatagag gcgctggtcg gccgcgagcc gctaggttcg cggccggtgc ttgggccgct
    14101 cgtggacatc gcggaggcgc tggcggacca cccgcacctc gtcacgggcg atgggcgggg
    14161 cccgcgcctg ggcggccgct agggcgacgg ccgcgcttac gcggcgctgg gtccgcccac
    14221 atcagccacc acgcccgcgc gcccgccccg ccctcgtatg cctatatagc catcacgctt
    14281 gaatgccaag cgccactttc ccgccgcggc gaaatggcgt ggccggccgc ctctcggggc
    14341 ctcatcgagc ggcgggcaga gaaggggtgc ctgctgccga cgctcgcaga tgccacggcc
    14401 gcggccgtgg tggccttgca ggaggcgacc gagcctctgt gcggggctcc gctgtttggc
    14461 gccgagcgcg cggccgcgct gctcggcgtg cgctccaacg ccgtcccgga ggcgctggtt
    14521 ctgtcggact cggcgaaaga cgccgacgac gagtaccggc tggagtatga ccgcgccgca
    14581 gcgcgggtgc tggcgggcgc gcggctctct aaggacgccg tctggcgcgc ggtcatcggc
    14641 tcgtactgga agtacctgaa ggcctcgagc ggcgctgacg tgaacatcga cggcgcggcc
    14701 ggcggcgcgg cgatggagca ggcgcagctg acgaacgtga tgctctttgc gcccacatac
    14761 gcgcgccggg cctcgcgctc gccgttcaag cacaagcagg acaacgcggc gtacaaaacc
    14821 gcagcggcgg agctgcgcgg cgccctgcgc gcggtggaaa agtatatgta ttacatgcgg
    14881 ccgggcgacc ccatggtcga aagccccgac acggaagccc gcctgcagga aattttggcg
    14941 tacgccgcga cggcctaccg ctggctgctg tggttcatgg acgcgctcga tggcacggtg
    15001 ctgcgcaagc ttggcaagcg cccctcggcc gcggtggggc cgcgcgagcc gcggccgccg
    15061 ggcgagctgt gcgagcgcca tctgaccggc ggcccgggga tcgcctgcgg cagcggggcc
    15121 gcgctcatgc tgacggccct gacggcggcg gtgctggcct tgctactgcg cgtcggggcc
    15181 gcttggacgg aatcgtcatg gaagagcaat acgcagggcg tgacgggagc catcgtcgcc
    15241 gcggtcgagc tggcgtcggc cgtacaccac cacctgcagt acctgctcaa catggccttt
    15301 gtggggtacg cctgctggct gcgcgcgggc gtgcgcgacc cgtacatgat cgcggccatc
    15361 cgcgcgcagt gccgcttcgc tcactttacg gggcagctga tgccgaccat gacttccgcc
    15421 agctgggcgg ccctggagcg cggcacggcg agctggttta agctggcgct gctgaaaagc
    15481 gtggcggcgc acggcgcgca gacgcgctac tactccaaca tcgtggagtc gatgcggctc
    15541 ggcgggagcc gcgggctgct ggcgccggtg cgcgcgcggc cgtcgggccg cggccgccgc
    15601 tgcccgcaga gtctggccgc gcgccccttg cccagcctgc cggccgcggc cgccgcccct
    15661 ccgggctcgg gctcgggctc gggctcgggc tctgactctg actccgacct ggatctcggc
    15721 tttgcccccg ccgtcggcgt ctatgcctcg atgcgcaacc tggagggcgc ctatgccgac
    15781 gcgggcggcc cgctttcgcc ggcggcaagc gccgcgcggc gggaggcggc ggtgtacgaa
    15841 aacgaaggcg agggcgaatt cgcgcctttg ccctcggcgt tcgccgaaga cggcagctcc
    15901 gacagcgccg acgagctcgc tatcgacggc cccatgcctg ccccgccgcc ccgcggtggc
    15961 cgcggcgccg acgagctcgc catcgacggt cccatgcctg ccccgccgcc ccgcggcggc
    16021 cgcggcgccg acgagctcgc catcgacggc cccatgcctg ccccgccgcc ccgcggcggc
    16081 cgcggcgcct ctgctgggcg cctccagtac gctgattcgc gcgccgtctc gagtgacgac
    16141 gacgaggacg agggcaagga cgaggacgag aacaaggccg gggcgaccgc cccgttggcc
    16201 gcggaccccg aatcggaact ggcccgcgcc atgcggcgtt gcagcctccg cgtcccggcc
    16261 tcggccccgg ccccggcccc ggccccgtgc accgagcgcc cgggtaatcc aacccggtct
    16321 tactcgcgct cgcgccctcg gctccgcgcc ctagacgacc ggcacggcct ggaggcgctg
    16381 gcggctgccg gtgccgctca caccgcgcgc cacaaccgcg acgtgtggca gcgcttttcc
    16441 cgcgtctgcg aggccggcga cgactacgaa aactacgacg aggcccgcgg cgcagagcgc
    16501 ggacacctct cttgcgcctc ccgcgcgcgg cctgaggtgg agagggtaac gtcgctgtaa
    16561 aggcgcccac cgcaaacgct gtaacacaca cacaataaaa agtttgtttt agtttattat
    16621 gaaattgtac atgcgtggtc tttggggggg ggcgcggcgg ctttgccgtc ggggccccgc
    16681 gcctacaggc gcgcccgggc cttgcgccgc aggcacgagg ccgccaccag caggagcccc
    16741 acggcgccga gaccgcaggc gacggccacg acgctgacga ggacggggct tccgattagg
    16801 ccgggcgagg cgtcgtacgt ggcggtcgcg gagaactcgg gcagcggtgc cgggtagcca
    16861 gtggcggtgc aggtgtagtc gacgggcccg tcggttgtag aaagcaggcg cacgccgcgc
    16921 aggtttacca gcccgggccg ctcggcgcag acgccggtct gctcagtgcg cgacggggcg
    16981 atgccgtcgc gcaccgtcca gcgcagggag acgcgcccct cggggacgca gcgcgcctcg
    17041 cagacggcct cgccgccctc gaagtacacg cgcagctcgg gcgggcggta aacggccggc
    17101 gtgccagccg cgtaaaagcg gcgctccatg ttagcgctct ggaaccagga gacgtcgcag
    17161 cgcaggttgg gcgggtgggc ggttggcgtc gcgtcctcga gcgtaaggac ggacgtgcgc
    17221 gaaaagagcc cggagtcgtc gaccgtaaag acgtcgcgcg cgtgccgagc ctccacgggg
    17281 tagccgttgc ggaaccagtg caggcgcgtg gagcgcggcg ggtagtactc ggcggcgcgg
    17341 cacacggccg cgtagccggc gccttctagc gctggctggg gttcgacgga aacagcgggc
    17401 gcgcggtgcg tcgtgacggt cacgaccttg cgctgtgact tggtgcccat gtcgcggcgc
    17461 caagtgtaca cgccctcggt ggcggccgtc agggagcgca cggtcagggg caagttgcgg
    17521 gggtcggcgg gcgaagggaa aatatagttg tcgcccagct ccgcgctacg gtacgcgatc
    17581 gagccgttct gggctacgaa cagcagcacg ggcggggccc gcggaaaggg gttgcgcacg
    17641 gcctcgtcgt cgccgcgcgt ggagcggaac ctgcccacgc gctgaaacca gagctccagg
    17701 cgcgcaccgc cagtggcgtt gtcggccacg ccgcagtgca cgtacagcgg ctcggcgtac
    17761 gaggcggcca cggcctcgcg ctcgcagagc atccacttgc gctccttcgg cggggctttg
    17821 ctcggccgcg gggggcgagg ccgccccccg ccgctaggtc gcccatcgcg gctcgcgttg
    17881 ccagcgccgc cgggtcgccc gtcctcgggc ggggcgggcg gcggcgtgct gttggtaacg
    17941 ggcgggtcgt gctcggacac ggacggcggc tccggcgtcc ccacgggcgt agtagcaccg
    18001 ggcgtgctgt cctctggcgt agcgtcgggg ctgttgggcg tggggggcgt tgcgccggtg
    18061 gtcccagcgg agctttccgt ctcggttggg gacggggagg gcggaggcga gggcgaggct
    18121 tccgcctcct cggcgagccc ccgccgggca gacaggagcg cccaggcgaa aatagctgcg
    18181 atcagccacg ctcgccccag cgggcccatg gcggacgcgc ggcgaggtct cgggctggcg
    18241 gtctctcggc ggtcgtgcgc gcgggtggat ccaagatggc cgcgaccgcg gcgcggctac
    18301 atttttaagg gcgtccgttt tgtgctttcg tggtccggga ttgagcacac gcgcggctgc
    18361 aggcgcgtta ccgtcggcgg cagccgttca ttcgtcggcg cagacccagc aggccccgac
    18421 gcagaagcac agcgcggcgt gcagggcctt ggccacgtgc gccgcggcca gccgtgcggt
    18481 gccgcgcccg cagcgccgga cccacacgca ggccaccagc gtgcccgcgg ctgccgaggc
    18541 cagcgctgcg ggcgcgccgc cgtccgcgcc gcagagcggc agcgctgcgc ccagagcgca
    18601 gatgcccacg tgcgccatta gcgcgccgtc cgcggcgtcg gcgcgcgcgt agcgcaggca
    18661 gaggtgctcg gcgagcgcga cgccgtgccc gcccgcgacg ctgagcagaa ccgcgccgcg
    18721 cgtgcgccag cgcccaccgc cctcgagccc aagcgcgcgg cccggggccc agagcgccgc
    18781 cgccgcggct aaggcggcgg ccgacagcgc gagctccgcg gcggcggcgc gcgccagcgc
    18841 gcgcatgggc acggcgtcct cgcgcgcgcc gcacgggtca gcggggcacg ctgcctcgcc
    18901 gagcggcgcc agagtccgca gcgccgcgta ccgccagatc ttgtagtggc aggtgtcttc
    18961 cagcgccgcc gcggcgtccg tggcggcgac gaccagcgcg gccgcggcgc ccgcggccgc
    19021 cagcgcctcg ggccgcgcgc cccagcgccc ggccgaaagg ccgagaagca gcccgcaggt
    19081 catggtcagt agcgccgtgc gaaagtgcgc cccggtgccc gaggctgccg tcacaaagtg
    19141 cgcgcagtgc accggcacac cgcagacgac gtaggcagcg gccgcgcccg ttgttacccc
    19201 gcgcagcacg gcgggggcgg ggtctgtggc ccagacggcg agtgccgctg cgacagccag
    19261 cgcctgcgcg agccggccaa gcggcgcgag ccggcggcgc agcgtctgtg cggcgggccg
    19321 ccaacaaacg agcgcggccg cggccgtggc tgttaacgca agcgccgcgg ccgggtcttg
    19381 cgcgcgcccg acggtggcca gggccgccgc catcaagccg gtgtgtgtgc ccatggccac
    19441 cagcgcgccc gtggcggcaa gcgcacacgg gccgcagccg gctctcgccc ccgcgcagcc
    19501 gctcacccgc acggacgcga acatggatgg tcccggttcc ccaaataacg caacgtggcc
    19561 caggatcgtc ttttatcggc ctttattgtt tttcgcttaa ggagtttcgc ccccctcccc
    19621 gccccgatcc gggcccgagc tcgggcccgg ggcgccggcg tcggcgcgcg gccgcttgcg
    19681 ggcccggccg ccggaaactg cgaccgggtg cgcgccgtcg gtttgaatgc cggctccggc
    19741 cccgcgacga ggttggccgg acgcggcggg ccgcttagcg ggaaggcggg gtgcgggctc
    19801 ggcgcagtca tcagcatcgt cggcggaggc ggtggcggtg gcggggcggc agaaaaagaa
    19861 cacagtcagc ccctccggcg ccgctgtgga cacgctcatc atggcggcgc tggcgggcgc
    19921 gaggtagaag cgcacgaggg cgtcgccgcc gacctgccgc accttttgca gcagccgccg
    19981 gaatcccgag ggggactcca actccagccg aaagtcaggc gccccgccag agcagcgcac
    20041 ttccaatagg gcggccctgc ggccgccgcc ctgggcgcgg gcaaaaatgc gctcgctgcc
    20101 tgcgctcggg gcgagcgcca gctggagctc tgccccggac tcgccgccct catggcgcgc
    20161 ggcgaacgaa gctcggcccg atgcggactc ggcgctcagg caacgggcgc gccggtatgc
    20221 gaataccacc gcctcgttgg gatctttggc aactgcctgc agctttgaga gctgcggccg
    20281 cgagagcgag acggcgaggt cggcgccgcg cgtcggaagc atgattgagt actcgcctag
    20341 ctcgtgcttg accaggctgg cctgcaatag ggcatcggcc tcccgaaagt aggtaacttg
    20401 cgttagcacg ctcgcgggtg gctcaccggt gattagaaag gccacgttct gcactgtccg
    20461 tgtcttgtcg gcgcggaagg cgtccagcag gccgcggcgg ctgtcgacgt tggcgaggaa
    20521 gacggctcgc gcgtcgtcgc gggcgggggc ccactggaag gacgtgaact tctcggcggg
    20581 gacggccacg tacacttgct cgtcgtagag gccgctgtgt accagcatgc cctcgcggct
    20641 aaagaccaaa aaggcgtttc gcagcgaggc gccaaagggg ctcagcaggg cggagacgtc
    20701 cgccagctgg cggccgataa gcgaggcgct cgcgattggg ttgccgttgc cgccgtcgga
    20761 cagaccggcg gtgaggcggg cctcgccttc gtcggcgcgc agatgcgagg ggggctgcag
    20821 catcgcggcg ggtgcttcgg cggcgctttc gctcgcctct tacgcgcgcg gtcgcaaagc
    20881 gagtctgcgc tgcggcggcg ctctttatac tgggcggacg cccccgcagc ggcaaaacac
    20941 acactcggcg gcctcagcgt atcaaacggc gacacgttta agtttcgacg cctataagcg
    21001 ggcgcgcgca ctaggcctcc caatcggcac cgcgcgcggc tgtgcgggcg accctgcgca
    21061 gagagagatg gggctcttca agctactgcg ttacgcgtac ggcaatcggc tggtaaagca
    21121 cgacgccatc accacgccgc cgggcgtgat gaccccgatc gcggtcgacc tgtggaacgt
    21181 gatgtatacg ctcctggagc gcttctgcgg cgacgcgccc ggcggcgtag gagacgccgc
    21241 cgcgaccgcg cgctgcttcc tctcgctgct gcggatgctg ctcaagcgct cctactaccc
    21301 gatctttgta gcggaccgcg gcatccacgg ggaccggcgc gccacgcggg gtgccaaggc
    21361 cattgtggcg cagacgatgc gcgccgtcgg cggctcgggc cgcctcgggc ggctcgtcag
    21421 cgacgattat acctcggagg acgaggtgct gggcgcgtac gagtaccccg tcccgcacgc
    21481 ggacgcggca gccgacgacg acgaggaggc aacggcgaag gaatttgccg ggcgcgcctc
    21541 ggcgggggcc gcgcgggcca acgcgcccaa gctggcacat cgcgtgtgcg tgagcctcat
    21601 ccgctttttg ggctacgcgt acgtcgacgc cgctgagatg gaggcagacg acgtctgcgc
    21661 aaacctcttc cacacaaaca ccgtggcgca catctacacg acggacacgg acatgatcct
    21721 tatgggctgt gacctgattt tggacgcggc gccgttgttc cccccgacgc tacgctgccg
    21781 cgacgtgctg gcgtcgctgg ggctcacgta cggccagttc ctcgcgacgt tcgtgcgctg
    21841 ccacaccgac ttgcaccagc cgccaatgct gcgctcggtg cagcaggtgg tgcgggggct
    21901 gcggcgcgct gccgaggccg agcccgcgac taccgagacg gagtctggct ccgagcgcga
    21961 gccggagtcc gagctcggtc gtccgggcgc tgggccgcgg cgccggttgc cgcccgcggt
    22021 cgacgacccg ctgaaaacta cgacgccggc gaccgtggaa gcgcacagcg tgcgcatgaa
    22081 gtatacatct cggtaccctc cgattgcgca gacgtgcgcc gacgcgctgc ggctgctgcc
    22141 ggcgtcccag acgcgcggcg gcgtgctgga gcgcaaattt gtaaagcacg tggtggacac
    22201 gatcgcgccg cgaatgcgcg ggcgctgggc cgtgctgaag cgcgtgccca tcgcacagga
    22261 cgcccccgac cctcggctcg tgtacgacac catcgtgagc gccgtaggca gcgccgccga
    22321 ggccgacacg ctgatggggc tcttctggaa gcacatcccc actccacccc catttgccaa
    22381 ggtgctggca gactactggg acgaggcccc cgcggggccg gggtcgcgac ggacaacccg
    22441 ccaataaaaa cgcgcgcata cgcgagactg gctttcgttg acatggaaca ttttttattc
    22501 gcggcgtggg ggtgagaagg aggaggaaag gcggggcgct ctggcagggc agcgggggtg
    22561 ccctacaggt cgttgattac ggtgcctgtg tagttggtgc tgcggcgctc aaagaagttc
    22621 gtgtgcttct cggcagtcat cagggccaaa ggaaaatcgg tcccaggagg cggggtgcca
    22681 aacagaggag gcagctggat agcagcgagc aggcggtccg cgctgtactc gacgtacgca
    22741 gaaatagcct ccacgtcaag tatatgactg ccgcgcggcg cgcaaccaaa taaactcgcg
    22801 ctcaatttcc acgcttcgcg gaacagctcg tagatgcggg ccggcggcgg ccgctccccg
    22861 ccgaggtagt tgtcgaagat gcagcacgac gcggccgtgt gcacggcttc gtcgcggctg
    22921 atgaggtcgt tggtttggca cgtcacgacg aaaaggttgt gggtgcgcag gtaggcaatc
    22981 gccgcaaacg aggaggagaa aaaaatgccc tcgattagaa tcatgagcac gtacttttcg
    23041 gccaccgact ctgccgcggc cacgcgccgc tcgagccagt ccaccttgcg ccggaccgcc
    23101 gggtcgccga gggcgccctc tacgtagccc gcgcgcgcca ccgcgtcgtt tctaaagagc
    23161 agcagctgta tggcgctgta cacccgcgag tgcaccactt cgatggactc ctgctcgata
    23221 tagtaatgca ggatgtcttt ttgggtgaac agctcggaca ggtccccgag gttgacgttc
    23281 acgaggtcat cggcggccga gaggaacgcg aacagaaagc ggtaaaactc cagctcggcg
    23341 ccgctgagcc gcgccacgtc cttggcgtcg tccgctaggg gaaactcggt ctccagccag
    23401 cggtttgcga cgctgagcga ccgcaagtga tctaggtcgg ggcactcggt ctcgtaaaag
    23461 tatttgtatt tacgcgtgag ggtcgccgcg tccgccgcct cggccatcgc gctcggcgcg
    23521 cgtcgctaca ggtggcaccc agagcacacg aggtcgccgc ccgtgaagac gccgttgttg
    23581 gtggccttgc ggatcttgca gtagtagagc cccgtcttaa ggcccttctt ataggcgtac
    23641 actaggaggt tcatgatctg ggaggcgggc acctttccgt ccattggctc ggtcacgaag
    23701 agcgacattg actggctctg gtccacgaac ggggcgcggt cggcgcagag gtcgatcagg
    23761 cgctcttggt cgtactcgaa ggccgtcttg aacttggcca gcggatgccc gggcgcgagg
    23821 tcgcccagcg cggcggccac cgaccactgc tcgcggtcca gcgcgcgcac ggccccgagc
    23881 cggctggcct cgcgcgtaaa gtgctttcgc agcgcgcgca tcagcggcag gttcgggcgc
    23941 agcagctcgc cgctcatcgt gaccttgctg aacatgttgg tgaagacggg cgagaagccc
    24001 tcgctgccct ccgtcacctg cgacgaggac acggtcggca taagggcgac aaactgcgcg
    24061 ttgtacagcc cgtgccgcgc gaccttctcg cgcagccggg cccaggcccg cggcagcgag
    24121 aggaccacgc cctcgtagcc gtcgaacggc atgagcccgc gcgcgaactt gctgcgcgca
    24181 aagtcctcga acggcgcgca gccgtactcg cacagcgtgg cgctggtggc catgacggcc
    24241 aggagcaggc gctcggcgat ctccacgttc agccgccgcg cggcgggcga gagcatgtcc
    24301 atgccgagct ccaagaggag cgtgtgcagg ccctggaagc cgatgcccag cgagcggtgg
    24361 cgcgccacgc cgcgcgcggc cttttcggta gggtactgtc cgcctagcat catagcgttg
    24421 acaaaaatgg cggccgtggc ggccgccgtg gacagagcgg caaagtcaaa ggcgagcgcg
    24481 ccgccctcac cctcgcgcac gcagcgcggc aggttgacgc tggccaagtt gcacacgccg
    24541 tgggcgtcgg ggctcgcgcg ctgcacgatt tccgtgcaga ggttggagcc cgttagcgcg
    24601 tccccggccg tgtccatgtg gtaatggcgg ttacacgcgt ccttgaacat gacgaagggg
    24661 ctccccgtca tgacgatgct tcggacgatg aggaaagcta ggtcctgcac gggcacggtc
    24721 tcgacgccta gcccctcgcg ctccagtcgc tcgtactcgg ccgtaaaggc cgggccgtgc
    24781 agccggctga ggtgcgacgc gcggtcgtcg aagagcgtcc acacaacgcc ctcgcggcct
    24841 tcgaggtggg cgaggtagcg gtcaaagagc aggtccggca cccagaggca gctgaacagg
    24901 ttgtcgcagc gcgtcgactc gtcccgggcg agcaggccgc gcatgtttag cacggcccgc
    24961 acgtcgcagt gccagggctc gaggtacacg cagatgcccg tcgggcgctc gctgtcgctg
    25021 ttgatggcca tggccatcga gtccagcagc ttcagcgccc ccatgatgcc acgcttgcag
    25081 tcgcgcgaga ccgcccggtc gaagctctgg aaggagattc cgatcccacc gcggttgagc
    25141 aagattcgcg cgacctccgt ggtgatcgcc tccacggcct ccgtactgct ggacacctgc
    25201 ggattgagca ggtagcagct ggccagcgag ccccgcgcgc ggccggcaaa gagcatgatc
    25261 ggcgtcgcgg ggacaacgag ctgccggtac agcgcggtca ggtaggcgtt gaacaccgcg
    25321 caccacgtgg cgccctcgcc gacgagggcg cgcccaaagg ccggctcccg catcgtccac
    25381 gtggcggcgg tcgcggcgat ccgcacgaag aactggccca tagactcgat cgccccgccc
    25441 tcgagcttgg ccaggtacat ctcttcgtac ttcagcgccg actgcaggcc gagcgcgcgc
    25501 agggtggcgt actcggtaag ctcgaagtat cggagcgaga cctccacgaa ggcgcggttg
    25561 gcgcgcaccg gctccgcgac ctcggacacg agcgcgagct cggccgatgt aagccagtcg
    25621 tccagaggca cgctccgagc acgcacgcgc aagtgcacga gttgcccgca ctttacgtac
    25681 acgcgttcgt cggcccgcga ctgcgctctc atgcgatcca cgacctcgcc gacgtaagcc
    25741 gccactgcgg cccgagaagg acgagaagcg gcggcgggcg gcggcggcac ggcaccgcag
    25801 cccagctgcg cccattccgc gtgctcggcc tcgagctgct ccgccgcgtc ggccgggcag
    25861 gctgtctgca tgaacgcgtc gctcgccatc ttgctcgccc ccctcgcttg cagcccgccc
    25921 ctgccgaccc gctggctttt tgtctttcgc ccgccgaccc gccggcgctt ggtctgcccg
    25981 atcgcacccg ccccgacgcc ttgggaacaa gcgcgcggcc ggctctggct ccccggagat
    26041 aaaaaccgag cgtatggcgg cagcaaaagg tgcgggccag gtgctcgctc ggcaggcaac
    26101 ctgggcccgg cagcagagat atttaacggc ggtttgaggg gcgtggcggc ccttccctgt
    26161 tgatttatgg catcgcacac aacggtgttt gcggaacaca ttttatttaa aacgacagcg
    26221 cccccttgtg tcagtaaaag cactccaccc agtccccggt tccccacacc aagccctcga
    26281 tcttgacgac gggcacgtcg caagactggt agcgctcgct gcggcaagtg actcgcggcg
    26341 agtcgtgggg cagcgtcccc aggcgcgcga aggcggcgta catgcagctc tcccgggtgg
    26401 gccgcccggc agcgtccggc gcccagcgcg gcaggaacgc cgtcgcgtcg cagtcgccca
    26461 gccgcgagac ggggcagcgg taggccgcgc ggctgttcgc cagcgcgggg agcggaaact
    26521 cgtccgcggc cccggccact tctgcagcgt cgcccgccgt cccccggagc acgttttcgg
    26581 cgcgcgtgcg gtgcagcaag tagctcagcc cgctggcgaa tgtggtttcg ttaagcttgc
    26641 tgacggccac gtgggcgcga aagccctcgt gctccaagcg ctgcgtgtac acgaagacca
    26701 ggtacacaaa tttgacgccg gcgggctcca gccgcagctc ggcgtccacg tccaggaacg
    26761 cgcaggcggg cacgtgggcc gtagagcgcg ggtgcgcggc ctggtcagtg cgcgcgccct
    26821 cctgcgcgcc gcagacgacg gccgtgacgc tggccagctt gtcttgcgtg gtccacgaga
    26881 gcagtccgcc caggcacccg agtgcctgat gcgggaacgc gcggcagcgg atcatggcct
    26941 gcaggcaggc gtagaagcgg tctagccgca atgccatgcg gcggtcgccg gagttggaaa
    27001 tgaggtgcgc gcgcagcgcg tctgcggcgg cgcggttgcc gtactcggcg gcgcaggcgg
    27061 ctgccagaaa ggaaaaggat acaagagagg cccgcagccc cccgggcggc accgcgccca
    27121 cgctggaggc gtcgccgagg tcgcgccaag cctcttcgac gtcgcgaaac tgccgtccgg
    27181 ggggcgcagc cgcggcggcc agcccaataa tgtcggcggg gtgcttcagc gttaggacgg
    27241 gcgcgccggg gcgctcgagc tgcgggtcgc aaaagtccgt cagggtaacc tgccgcgaga
    27301 gccggatgtg aggctgcccg ccgggcgaga ggacggcggt gccggcgggc gtgtccacgg
    27361 caatctgccg gggcgtgacg atttgaatcc ccgacatgtt ctggatggtt accgttgcgt
    27421 cagacacgtg cagcatcccg ccggcccaag ggttgtagcc ccggggtgcc cgcccgcgag
    27481 cgccgccaac cgcaggcgcc gtcactgact gcacgccggc ttcggcggca gaggcctcgg
    27541 ccgccgccgc ggcggcggcg gggacgcccg agaacggcgg cgcggcggct gggagccgca
    27601 tccgcaagtg gttgccgatt tgaatgtaac tcgagctccc gttaggcgcg gccatcgttc
    27661 ctcgtccgct cggcactcgc gctcgggtcg ggtgttatag ggtggcggat tcgagctgcc
    27721 tttatagcgc cggcgcacgc ggcgggggca agggcgtcag cggcggaagc cgcggcggcg
    27781 gttgcggcgg ggggctgtgc ggggcgtaca ataaactgcg cggcgggtgc gggctctggc
    27841 cattcgcgcc ccggcgcacg cgcggctgac atgagcggag accccgtgcg ggccctgtgg
    27901 gccgcgctcg agcggttgga tggcgaggtc gccggcccgg ccgcgcttgc ggaggccagg
    27961 gcggccgtct cggagttcct cctcgcgtcc gggcccagct cgctagactt cgtggcgccg
    28021 cgctgggccg cgctgcagcg cgcggcgtgc cgcgcttacg agcgcctgca cacgccagac
    28081 gcggcgctgc tggcggaaaa cctgcccggt ctggtgctgt ggcgcctgcc cggggccgcg
    28141 cgcgacaccg ccgatttcat ggccggcgtt cgggacctgg ccaacagcat gatcgccgag
    28201 gcgccgttgg gttacctggc ggccgcgcgc ctgcgcgcca cggcggcgtt cggcccggtg
    28261 aacatgcagc gcgtggtggt ggagtgggcc tcgctctttt tggagatcta cgcacgcgag
    28321 gacgcggcgt gcgtgggtgt gttaggcccc gaccctgcgt gccgctcgcc ggcgggcagc
    28381 gcggccgtca tccgcccgct gctgcagagc cgcttccgcc tgctgtatga catgcccttt
    28441 tttcaggcgg ggcttagcgc cctggcgcac gccgccaact ggaaagtgcc tatggccgcc
    28501 gtggcacgac gcgccgcgga cgccgcggcg ccgccgctag cgcgcgcgct ttttgccgtg
    28561 gcgcttgtcg acgagtactt tcccgagcca gacgacgagg acacggcgcc ggggctggct
    28621 gaggcgtttg cggaaattgc tgacttggtg ccgcccgagg cgctagtgcc cgcgggtgag
    28681 gctaacgctt ttgcgcgctc gtcgcacgac gtgcgcgtat cggcggcgct ggcctaccgg
    28741 gacccctttg tgcgcggcgc ggccgcgggc agcgtcgccg cgcgcgtgcg tgccgacgcg
    28801 ggccttctcg ccgacgacac gttgctcggc cgggacgccg tcgccgttca cgcaggcgcg
    28861 gtggtgcggc tgctagaacg cgcggccgcg cgcgcgacgc cggcggcgct ggggcgagtt
    28921 gcagagcacg cggccgccgt ttgggacgcc gtgcaggcga gcgccacgcc agaccaagcc
    28981 gtggagacgc tggccgcggc ggggtttacg ccgggaacgt gcgccatgct agagcgcgcc
    29041 gtgctggcgc agctatcgcg cccagagccg cgcgcgccgg cagacgtgct gcaggcggtg
    29101 ggctgcgtgg cggtggcggg cggcgtgctg tttaaactct ttgacgcgta cgggcccagt
    29161 gcggactacc tcgcgcacta cacggccact atcgcaaacc tgcacccgta ctacgcggac
    29221 gtgctgccgt tgctggggct gcccgacggc gggctggagc agacgatccg ccactgcatg
    29281 gccccgcggc cgcgcacgga ctacgtggcg gcgattcgcg cggcgctggc ggcagaggcc
    29341 gcggccgcgg acaagcgagc cgcgagcgcg agtgcgcggg cggccgttga aaacagcggc
    29401 gaccgcgcgg cggccggagc tgccgcgcgc gaggccctcc taacctggtt tgacctgcgc
    29461 gccagcgagc gctggggcgt ggcgccgccc gcggccgaag cgccgcccgc ggccgaggcg
    29521 gcacgctctc cggccgcggg cggcgcttcg gccgcagagc tcgcccgcgc ggcgcgggcg
    29581 ctcgagttcc cccgcacgga cgccgtgccg gctgccgtct tgcgagaccc ggcctttgcg
    29641 ccccacttcg ccgccgccgt gctgtcggac gtgctggtgg ctgcggacgc gctgcccttc
    29701 agcgcaaacg gcgtggcgca gctgatggcg ctgatcgctt gggcgcgaga ctgcggcgcg
    29761 ggagcggtgg ccaacgtaga cggctaccgg acaaaactgt cggccctggc ggccgggctc
    29821 tggccgtttg tggacgcgag cgccccggcg cccacgacga cgcaggtccg caacgcggag
    29881 gctgtgctgg gcgagctgca cacggtagct acgaccgcgg cggagtgcct gccgcccgaa
    29941 gtgcgcccgc ctgtgcccgc gcgcccgcgg gtgggcggtt gtgtcttctt agcgagcatg
    30001 tacctgcacg ccgccttcgc gcggctgcag ggctatgtcg ccgagacgga agcgctggcc
    30061 gcgtctatgg ccgcggccgt gggcgacgtt gccggcgcgg tggcgcggct gggagtgctg
    30121 ttcgactgcc actttgcgtc ggtgccgggg cagcagatgc tggcgatata cgcgacgcgc
    30181 ggcgcgccgt gcgccctggg tgcgtggcgc tcggcggacc tggccgacgc ggtgcgcggc
    30241 gcgcgcgccg aagccgcgcg cgcccgggcc gaggtgcgcg tgtcgctggc ggcgttgcag
    30301 cgcgccgcgg cgcagacgac acaagcgctg caggagtgtg aagctgcgga cgcccgcccc
    30361 cccggcggcg ggctggacga cgagcaccgc gcgttgctgg cgggccactc ggcgctggtg
    30421 cgggcgcaga cggcgctggc gctggccgcc ggcaagctcg tggcgggcgc ggaggcgccg
    30481 gggctgcacg aggtgggccg ctttctgcag cgctgggacg cgatcggcgc ggccctcggg
    30541 cgcgcgctag acgacagtgc cggcgagcgc gacgtcgccg agctcgtcgc gcggctccgc
    30601 ggcgtctggg acgaggtcca ggaggaccgc cgcgtagcgg ccccggggcc gccgcgcagc
    30661 gccgcaaacg cggcggccgc cgaagaggcg gtgctggcgc tgttggaggg ctacccggag
    30721 gttcggggag acgagggcag cccggcgctc ctggacgccc gcgcggacgt ggccgactgg
    30781 gcgggcgtag accgcggccc gctgcagcgc cgcgcgtctg cgggcgcgga cgccgccgcg
    30841 tctgccgccg cggcaaacac ggcggcgggg ccgtggctta cgacggaaga cctgctcgcc
    30901 gaagtcgatg gcgtttgcgc cagtcgcccg gccgcagccc ggtgaggcgc gcgccggcgg
    30961 tgcggcggga ggccttcgca taaacggcgc tgcgcgcgcg gtgcccccta gtacccctgt
    31021 ggagcagcga agcggcacca tgtccggcgt tgccggcgcg cgcgcgccgg caacgccggc
    31081 cgacgtcgcg gtcgccgctg tgggttttcg caaccagtac gacgcggcgc tggggccggg
    31141 cagcgcggtg gcatgccttc ggtcctcgct gtcgtttctg cggctggcct tcgcgggcgg
    31201 cgtcgacgcc gcgctgggcg ccgacgccat cgacggtgct ctcgctgagg gcgcggcgtg
    31261 ggcgcgcgaa agcggggcgc gcccggaaat gtgctcgatc gtgcacctgc caaaccgcat
    31321 caccgaccag gcgggcgcgg ggagcgggct ctgctgcgtg ttttcgcgcg tgtatgggga
    31381 gtgcggcttc tacacgccgc cggcggagcg cgccctgagc acccaagtcc cagcgcgcga
    31441 attcgtggac gccgtctggc agccgcggcg gacgtcgctg gcgctggtga tcgtgggcgc
    31501 catgggcgtc ggtgtctttc gcgccggcga cgcggtctac ctcttcgacc cgcatgggag
    31561 cggggacgtg ccccaggcgt ttgtcgcgcg catgcccccg agggccctct acgcgtacct
    31621 agctctgcgc gcgtgtggcc agcccgagtc ccggtgggcg ggcgcgctag tgcactttgt
    31681 ttcggcgggc ccggagcccg cgcgccccga ggagctaagg gcggccgtgt ctgcgctgta
    31741 cggcgcgagc gagacatacc tggacgacga gccctatgtc gagcggcgcg tggtcagcgt
    31801 gcacccgcgc gcgccggcca acacggcctg ccttacggcc gtggcggtgg gcggcgcggg
    31861 ggcagagtgc gaggacccta cgttcgcgcg cccgggctcg ccggcgttgc tgccggcgga
    31921 gcccgtcgcg cggatgccgc cgcagatcac ggccgcggcc gcggctcgcg cggcgggtaa
    31981 gcggacgagc ctgccgcggc ggcggcgggc cccgtggacg ccgccctcga gccgcgagga
    32041 ccttcgcgcg ccggcggccc gcgctcgcgc ggggaagccc ccgcgaaagg tccggggcgc
    32101 ggagacggcg ggggccgggg aagattgggg ggagggggga aacgcggctg cggcccgccc
    32161 gccgccggcg ctgggcgccg ccgcgcccgc gcacgccgcg acggcgtgcg cggcggagct
    32221 tggcgcgcgc gcggcggagg ttaccgcggc cttggacgcc gtccaggcgc acgcggcgtc
    32281 gatagccgct gacgcagacg cgtgcgtggc tcgcgccgtc cgcgtggcgc ggccccgcga
    32341 cgccgccgcg gaacgggacc cgctggaaca cgcgatcgcg ggcctgtttg agcgggtgct
    32401 ggcctttttg gtgcagaacg gcgcgcgcac gcggcacgac gccccgtcgg ccgtccagcc
    32461 gcttttcggg gcggtggccc aggcgctgcc gcagcacacg cccgccagcg cgttcatcac
    32521 atcttccggg atggtgctcg aggggctggc cgcgtacacg cggctgtcgg aggcgatgcg
    32581 cgcgcagccc tcggcgctgg gcgacctggc ggacgccaag ctgcgcctag tcgcggccgc
    32641 cgtcgcggcc gacacggagc ggctgcacga cgccgtggac gagctggagg gcgaggtgga
    32701 cggcgccggc ggcgcgggcc cgctcgagct gtgcggcgcc gtctcggcgc gcttcatgga
    32761 gcgcctctcg gcctccggcc ggcggctatt ttcgcgggcg gcgcttcgcg acggccggcc
    32821 gctggacgcg cgagtccgag cgctctttga gcgcgcgcga gcgcgcgagg cccgcgtggc
    32881 cgccgagacc gcggcgctcg cgcgcgagat cctggcgctg gagggcacgg tgcgcgccgc
    32941 gcgcgagcgc ctggacgccg tcccgcccga cgacccgcgc gcggtgcccg cggacagcgc
    33001 ggtggccgac ttggcggctg agcttgcggc gggccgcgcc gccgtggtcg cgcggagtgc
    33061 cgccgccctc tccgccgagc tggacgcgct cgcggccgag gcgctgcggc agtactttct
    33121 gcgcggcgcg cagtacagcg ctcgcgccat cctggccgac cgcggcggcg gcgagcgctt
    33181 ccgcgtggcg agcgcggcgg ttgcgccgct gcagcggctg gccggctctg cgcccgactt
    33241 ggcggcgcgg gtggctcggc ttggcgccgc gccgggcgcc gcggcgcctc cgctgccgcg
    33301 gtccgcgcgc aaaggcgagc tcctccgcga cctgctcgcg gcaggcgcaa cggcgcacac
    33361 cgaagacggc ctcgcggcct gggtggcgct gctgcacgag gcgcaggcgg aaggcgctgc
    33421 cgccaagaag gagctggacg ccgtgctgag tgacgtggcc gccataaacg ggcgctcggc
    33481 gtcgcgggcg tcgctggagg cgagcatggc tcgcttcgag gcgatgtccg cggcggcggc
    33541 gcgggcggcg gcgggcgccg ccgcggaggc gccgggcgcg ggcgccgaag aggcggcaga
    33601 cgccgcggag gcggccgtgc gcggtgccga cgacgtcctg cgccagctgg acgccctggc
    33661 gacgggcgcg gcggctgacc gcgaggcgcg cgcgcgcgtg gccgcggccc gcgcggggct
    33721 agaggcgcag gcgctcgcgg cgcggcggcg cgtggccgag ctgggggagc gacgcgcaga
    33781 gctgtaccag cgcctggacg cgctgttgct gccgctgcag ggcttcgcgg ggctgcgcgc
    33841 ggcgcccggc gcgctggagc ggctgtgcgc agacgcgggc gcgcagagcg cagaggactg
    33901 cgcgcgcttc ttgcaggagg cgccgccgcg cgtggccgcg ggcgtgcagg accgcctgtg
    33961 gcagctcttc ggccggtacc gcgaggcgct ggagaacccg agcgcgctgg cgccgggcgc
    34021 gctggccggg ctgggcccag ccttcgcggc ggtgctgggc accgcgctgg gccaggcgat
    34081 gggccccgcg gcgcgcgcgt ttttcgaggg gcacgcggag cgcgtggcgg ccgccgtggc
    34141 tcgcgcggcg gcggagcctg cggcgcctgc cgcggtggcc gccgcggcga gcgcgctgcg
    34201 cgaggcggct gaggcgctgc gggccggggg cgcgcacgtc ccgcccgagt ttgcgttttt
    34261 ggacgcgctg caggcccagt acgcggcgcg gcgcgaggcg cagaccggcg cgcggcggct
    34321 gggcgccgcg ctcgcggccg tcagcgaggc ttcgggcgcg cttgcgtctg cggcgagcgc
    34381 actaaaaaac gccatgacgg cgggcgctga tgcggccgaa acaacggcgg ccgccgccgc
    34441 ggcagacgcg gcgctggggg cggcggaaga agtacttcgg gccgcggacg aggccgcggt
    34501 ggccgccggc ggcgaggatg cggacggcgg cgaggatgcg agcgaggccg acgcggacgg
    34561 cgccggcgat gcgccgcccg ccgggcgctt ggggccacag gccgccaagc tgcacgccga
    34621 cctgcgcaag gcccgggcgc tggcgcggcg gcgcgccgag gaagtccggc gcctgcgcgc
    34681 cgaggccgag cggcgcgccg agggggcggc cgcgcagcgg caggaggagc gctggcgcga
    34741 ggacttgcgc gccgcgctgg agcgcgtcga ggcgaactcc gccttcgacg cggccgagct
    34801 ggcgcggctg cgcgccgcgg ccgcggcgcg cggctacgac ccgcggccgc tggcgcggca
    34861 ggccgaccgg gcgctggagg cgagcgcgca gcgggcgacg gcagccatcg aggccgtgct
    34921 cgcgttcaac ccgcacgcgc ccgagaacgc gaagatcgat gtcccgccgc cgctggcgca
    34981 gctgcgcggc atcgcgtggt gggacgcgtt ttccctggcg gcccccgcgc tgtcggccct
    35041 cttcccggcc gcggacgtgg gccagctgac gcggttgatg cacatcgcga cggggctgct
    35101 gacgttcgcc gcctcgggag gcggcgagcc tcgctactac gacgccgtaa cgtacctgga
    35161 gggcgacctg gcggccgtgc ctcggctcgc caagtacgtg gccttctacc gccgggggca
    35221 cgcggccttc gaggaggagc gcgcgcggct gggcgccctg cgcgcggacg tgctgcaggc
    35281 ggccggcggg cgcgcggcgg agatcagccg cgctagaaga ggtaacgtac tgcgcagccc
    35341 cgccgagcgg cgcgcgctgg aagcgggcgt gcgcctggag ctgccgagcg aggctctgat
    35401 cgcgagcgcg ctggcgcagc tggagcgctt tgaccacgct cgctttgccg gctcggccta
    35461 cgaggcgcag atgctgagca cggtgcggcg cgacgcggcc gcggcgcgag aggcgctaga
    35521 ggcggcaaag gcggcgcgcg cggaggccac ggcgcgcgcc gagcgcatcc tcggcgaggt
    35581 cgtggctgcc gaggcggcgc gcgaccgcga cgagggcgcc gggctggcca acctcaagaa
    35641 cctgctgcgc atcacgccgc cgccggcggc gctggggcca gcgctggacc gcgccgcctc
    35701 ggcggccgac gtcgtgacgc aagcggcgct gctgctggcg gccgtggagg aggcgccgga
    35761 gctggacgtg gccgcggtgg agtggctgca gcaagcgcgc tctatcatcg actcgcaccc
    35821 gctaacggcg cgcatcgacg accgcgggcc catggagccc tttgcggagc gcatcgacgc
    35881 gctgcgcgag ctgaggcgcc acctcgacgc gctgcggcgg cagctggagt cggcggcggc
    35941 ggcgtgggac ggcgcgtggg agctctttgt ggcggcgcgc cgccgcgcgg ccgcctcgcg
    36001 cgaggaccac gagggcgcca aggcgcgcgc agccgcgctg caggcggccg cgggcgtggt
    36061 gctggggctg cgcgcggacg agcactacgc gcggctgccg gccgcgttca caggcgcgct
    36121 ggacgcgcgg ctggcggagc gcggcgacgc gctgggcgcc ttccacgaag ccgcgcgcgc
    36181 cgcggacgcg ggcctgcagc ggctgcaggc aacgcttgcg gcggtgcgcg gcgaggccgc
    36241 gtacgagggg ctgcgcgccc tcctggcggc cttcgacgcg caggttgccg agctcccggc
    36301 ctgggccgcc caggcgcacg cgcccttccg ggatctgctg gtgctgcgga tgcgcctcta
    36361 cgaagcctac tttaagctcg tgccgcgcgc cgcggcgcgc gcacgcggcg ccgccgcggc
    36421 ccgggcagcg cgcgccgcgg cgacggtgca ctcgcgcgca gaccctgcga cgcgcgccgt
    36481 agcggcgcgc gcggcgcggc tgtgtgagcg ggacctgcac ctgcgcgggc gcgtggcggc
    36541 ccttctgggc gacgaagcgg cggtgtgcac gctgcgcgag gcggattcgg agattgacgc
    36601 gctggcgccg cgcgcctacc tggacgccga cggcacgccg ctctgctacc gggtgtgcta
    36661 ccgcgcggtg ggcgacaagc tggctgtggc gctgtgctcg caggtggggg cttcgatgcg
    36721 ccccccgctg gacgagagcg gcgtggtgga ggcggcttcg gtcgccgccg tgaacgtgtt
    36781 aaacgagatt gtgaacctgc gcctggagat cgagcgcgcc cgcgacgcgg actttggggc
    36841 gttttgccgc ttcgtgcgcc accggcgcgc cgactggggg ctggcggacg tgcgctcggc
    36901 ggcggccgag ctctacgcgg ggctgctggc gactacgctg ccccgccgcc acggcgtcgc
    36961 ctccctgggc gcgctgtgct tctcgctggc cgagcggggg ctgcggccag cgcgggcgcc
    37021 ggcgagcggg cccgcgccga gcggcggcgg cgcgctcgag ctgacgcccg cggacctggt
    37081 cgtggccgcg ctcatgggcg ccttcatgca cctggtaaac ttcacgcgcc tggacctcgt
    37141 gcagaagcag gagtacatgt gcaagacgtt ggacggcgtt ctgaccgagg cgcttacgag
    37201 ccgagtggcg gtcaacagcc tcgcgccggg agagcccggt gcgaggcgcc cggtgccgct
    37261 tggcggcggc gcggacgacc cggcggacgg cgcgctgttc gccatccgcg ccgccgactg
    37321 ggacgcgggc cgcctttccc cgtccgacgt gctagccgtg tggcggcacg cgcccgacgc
    37381 ggccacgcgc gcgaccgtgg cggagctggc gcgtctcatc cccggcggtg cgctgacaac
    37441 gatcagcgtg ctggcgcgca tgtgcattcc gggcgacttg ctggcggcgc tgtggacgac
    37501 actcgcggtg gactcgctgg gcgcacagac ccagagctac gacgcctttt tggcgcgccg
    37561 cctggacgca ccctcgacgg tgcacgcgac gggcggccct tcggaagacg cggcggcgct
    37621 ggccgctgcg gctgcggcgg ccgggggccg gcccgcgctc ttttgcccga cggggagcag
    37681 cgtgacgttt acgctcgtgc ggcagccgcc cagcgaggtg cagaccgtca acgcgctgga
    37741 cctcgtcacg tgcgcgctgc tgctgggcgc gccggttgtc gtggccatgg agaacccgga
    37801 cgtgttctcg gagggctcgc gcctgatcat gtgcctgcgg ctgtttgaca cgcggccggg
    37861 cgggcgcgac gccgacgcgc ctgccgccgt gtcatcggac ctaaactcgt ggggggagcg
    37921 gctgctggcg ctcgacgaga acattatcga aaacgcgtgc ctgacggcgc agctggagca
    37981 gctgtcggcg ctgatcgcga gcaagccgct acgcagcgcg ccgccctgcc tcattatgct
    38041 ggatacgcat ctgcagctcg cgcgggtgct gtgggcgcgc gccgccgcgc cgccgctcgc
    38101 aatgttgaag attgccgaag acgacgtgct ccgggacttg cccagcctga cgctagacta
    38161 cgaggacgcg ctgccccccg cggccagcgc cgccgacccg ctcttcacgc acatcatcag
    38221 cgagaacaac gtcccggact ttgccgccgc tagcggcgac ccgctatacg cgcacccccc
    38281 cgtgttccag cacgccaccg acaatttatt tccgcacgcg cgggcggcgg caggtggcgg
    38341 cagcggcaac cgtgtagcca acgcccgcgc ggtcgccgcc gctgcgcgcc ccccgacccc
    38401 agcttcagcc ccagcgccgg caccggcact ggcaccggct tcggcggagc ctgctctcgc
    38461 ttggggggcc gacgagtggc tagacgacga gattggcgac gcgtacccgc cggcccccgc
    38521 gcacgacgcg tacccgccgg cccccgcgca cgacgcgtac ccgccggccc ccgcgcacgc
    38581 gcaaggaaaa cccgcgttac tggcagcgcc tgctgccgga gccgcggagg ctcctggcgt
    38641 tgagcgcgcg cgtcgcctga cgcgccgtac tggaccacgg aagtccatgc ccgccgcgtt
    38701 gccgtggcga cgcccgccgc ccgcaagcct ggtctccgca gcgcctccag tgcctccggg
    38761 gccgcgcctg ccgccggccc cgccattgcc gccgccggcc ccgccattgc cgccgccggc
    38821 cccgccattg ccaccgccgg ccccgccatt gccgccgccg gccccgccat tgccgccgcc
    38881 ggccccgcca ttgccgccgc cggccccgag tacggccccg gttccggccc cgccattgcc
    38941 gccgccggcc ctgactccgg ccctgactcc ggccccgact ccggccccga ctccggcccc
    39001 gccattgccg ctgccggccc cgattacggt tttggttccg gccccggttc cggctccggc
    39061 cccgattccg gctccggccc cgactccggc tccggccccg actccggctc cgccattgcc
    39121 gccgccggct ccagatgggg ccatgggagc gcttagcgca acgcggcggc cgacgcgccg
    39181 cgctggggct cgaaaatcgc tgccggccgc gcagccgcgg cagcggctgc tgcgctcacg
    39241 ctcgcccgcc agcgttccgg cgccgggctc agagctcgtt ccaccaccgt caggcggtgc
    39301 gcttggctcg cccccttctt tcgtgccgtc cagaccgcct agcttggagc ccgtgcctgg
    39361 cttgcccctg ccgccgagcc gggtccaagc accagtagat gcgcccgcgc cgccccccgc
    39421 gccagagcgg cccgcgccgc cccccgcgcc agagcggccc gcgccgcccc ccgcgccaga
    39481 gcggcccgcg ccgccccccg cgccagagcg gcccgcgccg ccccccgcgc cagagcggcc
    39541 cgcgccgccc cccgcgccag agcggcccgc cacagcggtc cagagtggtt caaaaattcc
    39601 agcaccgtcg aatgctttgg tgggccaggt ggccccagcg ctgctgcggc gcggccccag
    39661 ccccaggggc aagcctggcg cgcccgccag gcccacgggc ggcgcaaata ttgcgcggaa
    39721 aaacacccgg gccgttgacc ctaccgttat cggatctggc tctgcgctgt cgggccttgg
    39781 ctccgccgag gaggatgctg actttggagc gtcgggcatg tatgttgcgc cgcctggccc
    39841 cgctcccctg gctgcgcccc ctgcgccttc ggccctgccg gcgccgcgcc tggaggcgcc
    39901 agcggccgca agcttgccgg cgcccccgat cgcgcccccg atcgcgcccc cgatcgcgcc
    39961 cccgatcgcg cccccgatcg cgcccccgat cgcgcccccg atcgcgcccc cgatcgcgcc
    40021 cccgatcgcg ccccccgcca tgccggcacc cccaagcgca gcgccggcga ctgcaggctc
    40081 gtccgcgccc ccaatcgcgc cccccgccac gccagcgcct ctaattgcac cccttgccgc
    40141 gccggtgcct cggttggtag gtgcggctgc gcgtgggcga gtgattggac acatgcgcgc
    40201 agctgcgcca aagccgcggg ggctgcgcgc ggcggaacgg ccgccgatgc ggtcgtgggc
    40261 gtctcggggt aacctccaca cgcaagattt actggcaagc gccgaagcgc ggatttgcga
    40321 gctgcccgcg ccccccaagg tccccctcgg cgcagactcc gacgccaccg atagctccct
    40381 ggacggaagc gggccggaaa cggaagagga gacagaagcg gaagcggggg gcgacggccc
    40441 cggccaagac gcgcccaaag cccgagtggt gcctgccaac tcgctgctga agcgccagta
    40501 cttgcgcggc acgggcataa gcgtcctggc cctcttgctg gaggcctgcg aaaaaattgc
    40561 ccggcggctg cgcgcgacgc gcgacgtgct gcggcagcgc gccgctgaag tcacggctga
    40621 catatttgcg ctgcgcttgc ttttggggta gcgctcgccc tttcccctcg gtccctccct
    40681 ttcccccacg tccgccgcgc ctcgcggcct tctgtacttt gccgcacaat aaacaccgca
    40741 acgcaaaatt tcatgagcac aaaactgttt tattattgcg atcgcacaat tgcgccgatc
    40801 cgaaaaaagc gtcacgtgcg cgcggcagac gccgccgcgc cagcgtcctc ctcgtattcg
    40861 ggggggagct gcaccacccg ggggaggaag gtccgcttca gtccgattgt cgggcgcgcc
    40921 caatgcgcgt ggtcgtaggt cgcaaacatg ggcacgcgcg gcacaacggc cttttcgtgc
    40981 cgccgccgca ggtcgaccat ggccagcgac gtgccgacga gcaggttgcg ccgggccgcg
    41041 ctcacctgct ccggcgtcgt gccgtcctgc aacgggcgcg ccgcggcgtt tagcacatgc
    41101 aaaatctgca cgggcagcaa gtcccgcagg gtgtcggggg tgatggtagc cggcgcacta
    41161 gggtcgatcc cggcaggcgc ggacatggcg tcgtcgaacc gcgagtgagc gcgcggcgcg
    41221 ggcgcgcgtg ttaagagggc gcccagaaaa ggcgcagtat cgcgagaatg ccgcaaactc
    41281 cgcccacaag tgttgcaagg gctgccattt tttgccggcg cgcggtcagc agcgcgccgg
    41341 cgtagtgcgc gacgtttccg gcgccgccgg ccggttcgag ctctcgctcg ctgtgaccgc
    41401 acgcgcttgc gcgccgagag cgcacgtcac gctcgctcag ccgctcccgg accgcgcggt
    41461 ctagcagccg gccggtgcga tgcgagtcgc cggggcccat gaaccggaac gagagctgca
    41521 cgcgcggcat gcgcacgaag cagctcacgg acatcatggc gcgaaagggc cgtgggtcta
    41581 tgccgccgcg ggccttgatc ttctccagcg ccgacaggct caggcccgtg ctttgcgtcg
    41641 aggccagcgt ggcgttgttc tgctccgccg tgatggccgc gagcggcgcg ccggggggcc
    41701 gcgagaagta cccctggaag agcacggaca cgcccgtgtt ctggacccgg acgtaggggt
    41761 cgcagtccgt ctgcgcccag ctggccatta gccgcaagat gtactccagg gggaaggact
    41821 cgttgcttcc gtcctggccg ttgaactgga agacgcaccg cgcgggcggg cggcgcgggt
    41881 cccagggctg gggcacgtcc ccctcgccac attgcaggtt gccggcgacc agcaggcgaa
    41941 tgcgggccat aagactccgg gaagaaccct cgccctcgcc ctcgccgtcg cagtcgcgct
    42001 cgcggccgtg catagtgggc ggcagtctgt ctcgccgagc gctgcgtcgg cgcggaacga
    42061 agctgcgccg tgccggcgcg gcgcctttat agcccgcccc gctttgcggg cgcgcgcggg
    42121 ggcctacgcg tcgtgcagaa tctggtgtag gtccagaaat ttgttgatca ccgtcgcaaa
    42181 gcgctccttc ctcgcctcca gcgctcgcgt gtggctgcac gccgcccgcc cgcccgagcc
    42241 gtgtgcgatc gtcgaggcca ggcgcgccga aaaggccaaa tagttcacct tggcgtcggt
    42301 ggtgggcagc agcacctcga gctcgcgcgg cgccacgtcc tcgaaccaaa tttctacggc
    42361 ggcgccttcg ctttggaggt agcggcgctc cagctcggcc acgtcctcgg tggccagcgc
    42421 ctcggggggg atgagctcgc ggagccgcat gttcgcgcgc gctgacgacg gcgccggtgg
    42481 cggcgatggc gcgcgctcgt gggcagaggg tgcgttccgc gccccgtacg tcgcgtttga
    42541 cccggcgctg ttgaaggaaa acggccagct ccttgaggag ctcgtctttg cggcccattt
    42601 aatggaggtg ccaagccctc gagacgacgg ggacgaggac gggggtggtg acagggacgg
    42661 cgccgccgcg gaggggggcg gcagcgccga cgtcgtgccc tttgtcgaag aggccgccgc
    42721 cgcgctggcc atcgaccggc cctgcgccgt gtgtcgcacg attgatgctt accggcgcga
    42781 gttcgggctg gcgcccccct gggtggccga ctacgccatg ctctgcgcta aaagcctcgc
    42841 ggcgccgccc tgtgccgtgg ccatcgtggt tgccgccttt gagttcgtct acctgatgga
    42901 ccggcacttc ctagccgcgc accgcgccac gctagtgggc gcctttgcga ctcgggtgct
    42961 gacgctggtg gatgtacaca agcatttctt cctccacgtg tgcttccgca cggacggcgg
    43021 cgttcccggc aacaacgccg ggaacgccgc cgggggggcg cgccgggccg ccgaaaaggt
    43081 gcgctactcc aactactcct tcctcatcca atcggcaacg cgggcgctgc tggctcggcg
    43141 gcggaggcgc ccggaggcgc cggcggtgcc cgcagacggc gcgggcccgc gggcgctgcg
    43201 cccgcagtcg ctggcgactg cgctgctgag ttggaaagag tgcgcgcgcc tcgtggattg
    43261 ctcggcgccg ttgcccggtg gcggtggggg cgcgcgggcg gcgcggcgcc cggggggcac
    43321 ctgctgcgac gccgcgcgtg cgcgggctgc ggagtacgaa gcgcgcgctg ccgtgctgcc
    43381 atcgccgcgc ggcggcgacg ccgacgaagc gtccgcggcc agcgccgccg acggagcgcc
    43441 cgcggaccga tgggcgtacg cggacctcgc gctgctgctg ctggccggcg tcgcgacccg
    43501 gggcgacggc gcggtcgccg agcgcgcgat cgcgtcccgc cgcgccgccg tcgatcgcta
    43561 ctgggcggcg cgcgcgggct tcctcgcggc caacacggcg ccgcggtttg cgcgcttcgc
    43621 cgcgggcgac gcgcgcccca gcgtggcgct ggggccggtg ctggccacgg ccctcaagca
    43681 cattacaggg cgcgggcgca cgacgggcga gtgtgtgctc tgcaatcttc tgctcacgcc
    43741 ggcgcactgg cgtgctttgc gcgcgctgcg cgcggacgtg gtggcgcact ctgccaacaa
    43801 cgcgggcctc ttcgactgca tcctgccggt gctggacgcg cgcgccggcg cgccggtcga
    43861 gggcgacggc ggccgcttct ttgccgcgct ggcgctgctg gagcccgagg ctgtgtataa
    43921 gcacctattt tgcgacccca tgtgcgccgc gtgcgagctg caggcggacc ccgaagtgtt
    43981 gttcgcattt tccgacggcg acgcgcgcga cgcggacgag ctggatctat ataaggcgcg
    44041 cgtggccagc gagaatagtt ttgagggccg cgtgtgtgcg ggcttgtggg cgctcgcgta
    44101 cgcttttaaa acgtaccagc ggttcccccc aaagccgacc gcgtgtgcgg cctttgtccg
    44161 agacgccggg cagctgctcc gccggcacgg cgtggctctc gtctcgctgg agcacaccct
    44221 ctgccactat gtctgaccgc ggggagcgcc gccgagctag agagccaagc ccagactttg
    44281 ggtgcgggcg tggggctgag cgcgccggcg actgggcaac ggccccggcc tcgacaccag
    44341 ccccggcccc ggggcgccgc tcgctgatct cgccccgcct ttgctctcgc tctcgctctc
    44401 gctctcgctc ccgctcgccg tttgcgcctc aagggcgctc ccgctcccgg ggcccggcca
    44461 cgcgccgcga gcggctgcgt tcgcgcacgg gggcgcggcg cgcggcacgc gcgcgagaca
    44521 gctacctgat gtacttcagg tttttggcct cctcccctgc tgacgagctg gccgccgtcc
    44581 gcgagctcgc ggtgccgctt atccgaacga cgcccgtggt gctcccgttc gacctctcgc
    44641 ggacggtcgc cgataattgc ctatcgcttt cgggcatggg ctactatctg ggcatcggag
    44701 gctgctgccc cgcctgcacc gtgaccggcg agccgcggat gggccgcgcg gaccgcgcgc
    44761 ttattttggc ctacgtgcaa cagctgagca acatctacga gtaccgggcc ttcctggcct
    44821 ccatccgcgc gcttggcggg acggacgacg gcggctttgg cggctgcgcc cccggccccg
    44881 gcggccccac cgaacgcgcg ctcgccgagg ttttggccca acccgagctc tttttcgcct
    44941 accacgtgct gcgggacggg ggcgtgcgcg acgcgcgcgt gctgttttac cgagacctgg
    45001 actgctcggg ctttatgatg tacgtggtgt tcccgggcaa agccatccac ctgcaccacc
    45061 gcctgctgga ccacctgtta acggcttgtg ccgggtacaa gatcgtcgcc cacgtgtggc
    45121 agacgatgtt tgtgctcgtg gtgcgccggg acgggggtgg gggcagacaa cagagcgcga
    45181 cagacgccga ggtgccggcg gtgagcgcgg gggaccttta ttgcaaaatg tcggacctca
    45241 actttgatgg ggagctgctg ctagaatacc gaaggctgta cgcagcgttt gacgactttg
    45301 cgccgccggc gtgagcgcgg cgaagcccgc cgcggcgagc cggccttgca gccggcggtc
    45361 gcaggcgcgc gtttccggaa taaagcgctt gagcaggttc tccgtggtcc gcgtgtcgtt
    45421 tccaaacagg gccttgaagg tggcgccgac ggtgcctagg aggtgggaaa agtagtagtc
    45481 tgtgttgagg ggcacggcat gggcccgcgc ataccccggg tcctcggcca tgtccgagat
    45541 tagcaaacgc ccggggcggg cgccgccgcc gggcggcgcg gacggggccg tgccgcgcag
    45601 cgcgttcacc gcggcggcgt cgcgctccac gccctcgccg ggcgcgacga tcacgtaggg
    45661 gatgcggtcc ttgacgttgg ggcgggcctc gctgcgcagc aggagtttgt agtacacggt
    45721 cagatgcgcg atgcgcttgt tggcgtaggc ctccggtggg cggctcagct ccgccgtcat
    45781 gacgaagtcg ccaatgtcca gcgccgggtc ggcgatcttg gcgtgagctt cggccaacac
    45841 agctccgaag cgcgcaaagc ccggcgggag ctgccgcccg ggccactcgc tgggcggcac
    45901 ggccgaggcc tcggccgcgg cgcgcgaaac agcgtcgtcg tgcataagca cgtcgaccaa
    45961 gcgccgcgtg taggcgttga taaagcggca gttgtttttg cgcacgaggt ccacgccttt
    46021 catgagcatc ttgccgccgc cgacaaggcc gaggtacttt ttttttgtga tgagcagcag
    46081 cttggcaaag gttttctcgc actcgagctt gatgggcggg cgaaagagcg ccgccgaaac
    46141 ccggcgcgcc atgccgtcgc ccagcgcgca cacggcgtcg tagggcatcc ccgcgaactt
    46201 gacaaagacc gagtccgtgt cgccgtaaac cacgcgcacg cggtagcggc cggcggcggc
    46261 cgccgccggg ccggccgcgg ggaaatctcg caccagtgcc tcgggtgtgg cccagcgctc
    46321 gtgtatgtac cgccgcgtct cgagcagcat gtcgcgcccg atggtcgtta cggtggccgc
    46381 gaccgccagg caaggcagta gtccgttgga cacgccggtg aagccgtaca ccgagttgca
    46441 cacgaccttg atggcggcct gctgcttatc gagcagcaca gcctcctcgg gcgcggcggt
    46501 ggggatgcgc gcgcggatgg ccttgcgcat ggccagccag tcgcgcaaca gcacgctgag
    46561 caggctctcg cgcacgtgcg cgcgcacaaa gtggagcgcg cgcccgccca cgtcgaacgt
    46621 cgcgtagtcc gcgccgggcg tcagccccgc cggcgcggcc tcgcggcgca cgagcgtggt
    46681 gaagcacagg ttgtgcgcct gaatgatgct ggggtagagg ctggcaaagt ccagcaccat
    46741 gacggggtcg acgtgaaagc ccgactcggg gtccaaaacc ttggccccct ggtacccgac
    46801 ggcgcgcccg cccgccgcgc ggggccggtc cgccgcgccc gcgcgcccct cgttcccccc
    46861 gtcttcttct cccccctcgt cctcctcttc ctcctcgccg cgagccgcgt cggcccagca
    46921 ggcgaagcgc tccccccgtc cccgcccggc gccccgcgcc gcgccggcct cggctccggc
    46981 gaggcgcttt tgggtgtccg gcagcagaaa gccccgcgcc cgggccaagc gcagcaggca
    47041 ggtgaatacg cgaatctgct gcccgtcaaa aatggcgcgc gacaccgtga ttccggccag
    47101 ccgcgccacc gccgacagct ccaggtgggg caagtacttg aagaacagct ttccgaccag
    47161 cgccgaatct tggatgcagt actcgccgat gacgccgcgc ccctcgggcc cggccgcaaa
    47221 gtgccgaggg atgtccttgt agtccaggtc caccttccgc tcccgcaggg cctcctcggc
    47281 cacggcgttg agcttgtagc tgggcagctt gagcttctcc acggccgtgc ggtacatgtc
    47341 cagggaaacc acgccgttaa tcttcacctt gctctgcttc tgaaagcggt tttggcccgc
    47401 gtcgaagacg cggaagaggc cgccccggtt tagcttcccg tagccgtcga gccgcacgtc
    47461 gtagacggcc gtgagcttct ccgagatgta cgcccagtcg aagttgacga tgttgtaccc
    47521 ggtgacgaac tcgggcgagt actgcttgag gaacgtcatg aaggccagca gcagctcgaa
    47581 ctcgctgtca aactccagca cggcgggcgc ggggagcccg gcggccgcgc acgcgccgag
    47641 gaaggccggc ggcaggtcgc aggatcccag cgaaaacaaa agcgtgtgct cgtggcgctg
    47701 agtgcgcagc gagtacgtca gacacgagat ctggacgacg aggtcctcgg cgttggcggc
    47761 cgccgggaac gccagcccgt cgcccgcgca cgacaggcac tcaatgtcaa agcacagcag
    47821 cttgtagtcg ggccacgcgt cggcctcggc gcccgcgatc ggctccaggt tgtccgcggt
    47881 gcagttgact tccacgtcgc aggaggtcgc gtgctgcgcg ggcgcgcgca gcgcgcgcgc
    47941 gcccgcgcgc ccggggcgca gccggtacca gccgaagctg gtgaagcctt cgttgtccag
    48001 caaaaagcgc gtcgtcacgt ccacgtggcc ctcatacttg gtcacgccgg ggaggaagtt
    48061 gtcgcagagg tagcccccga gccgcgcgct ggccgaagac accttgtaga aaagctgcgg
    48121 gcgcgtgtcg tagaagtaca cgtccgctgc ctcgaccacc gcgaccgaaa ggctgtcccg
    48181 cgaggcgcgg cccaggtaac cgccgggccg gcgcgcgccg gcccggccgg cggcgtcctg
    48241 ctgtgccgcg ccggcggcca gggccgagga gcgcagcgcc gccaccatgg cgtcgatcag
    48301 ctggccctcg tcgcgcaccc cgcaggctag gtcgacggcg gccttctcca tgtaaaaata
    48361 gtgccgcacg ccgtacacgt gcaccgccac gcgcttgccg tcctccgaca tgcccagcag
    48421 cgtcacgacc gtggcgccgc cgggccgggc ctcggcggca aagcgggacg cgtcgccggc
    48481 gctcgggtac tcggtcgtct ccacgatgtc gtacacgtga aagcgctcaa agcgcgggtc
    48541 gagcgcggcg cgctccgggg cggcgcggcc cgcccacacg cttacgcggc gcggccagca
    48601 gcaatggccc gcaaagtcca ggatgtcgtg ctcctcgccg tcgaggtata ccttgggcgc
    48661 gcgctcggcc gtgccgatgt gaacgccgcg gcggcggggc gccgccgccc ccgcagcctc
    48721 gtcgtccgtg ccgccgtcgg cgccgtcggc gtccaggcag cgcggcgcga tgaagcggaa
    48781 ggacgaggcg gcggtgcagt atgactcagc cgcgcgcccg ccgccgcggc ccgccgcctc
    48841 gtctgcgggc gcctcgccgg cgccatcggg gatgtccggg ccttgccgcg cgggggcgcc
    48901 tcggccgcgc ggcgcgaggt acgggttgaa aaacccagcg cgcgggggcg cagtgccctg
    48961 ttcgcagtct ctgtccatag cctggcgggc gcaggcgcgc gactggaccg cccccggtgc
    49021 cgtcagacgc tttaacggcc tcaccggggg aggggccggc gcgaggttaa ataccagatc
    49081 tgccagcggc gagccgtggt ggcgcgcagc tcacggccgc gggcggcggc agccgacaag
    49141 ccaacagaca gtgcgtccgg ccggcttgtc ctcctcgcgc tcccgccgcg ccccgccttt
    49201 tttgagttgt tgccgcgccg cgtctgccga ccatggacgc ggcggccaag acggtagccc
    49261 tcgcgccggg gcccgcgggc ttcgtgtacg tctgcgacgc ggctcgcctg gacctcgaca
    49321 agctcgcgct gctcgccgcg cggagccgcg actcgctgct ggcggtgctg cccctggtgc
    49381 gcgggctcac tgtggagacg gcattcgcgc caaacgtcgc ggtggtcgcc ggcactaaga
    49441 ctaccggcct gggtggcgcg gggctgacgg ccaagctaac gcccagccac taccacccga
    49501 acgtgtttgt ctttcacggc ggcgagcgcc tgcgcgccag cacggccgcg ccaaacctga
    49561 cgcgcgcctg cgagcaagcg cgccggcgct ttggctttag cgcctttgcc ggcgcgcccg
    49621 tcgacggcgc cgttgagacg acggccgagg acatttgccg cgcagtaggc gcgagtcccg
    49681 aaacggccct ggtcttcctc gcgacgacgg aggctttcaa ggagacggtg tacatgtgca
    49741 acaccttcct gcactacggg ggcgcggcgc ccgtgcaagt gggcgccggc gaggcggtgc
    49801 gcgtgccgct gtaccccgtg cagctgtaca tgcccgacgt gaaccgcgtg aacctagagc
    49861 cctttaacgc gcgccagcgg gccatcggcg agcagcttgc gtatccgcgg cccttctaca
    49921 acgccgcact ctgcgagctg ctgcacggct acgtgctggg cccggccgcg gtggcgctgc
    49981 gcgtgcgcac gttggacgcc gtggcgcgcg gtgccgcgca cctagccttc gacgagagcc
    50041 acgagggcgc cgtgttgccg ccggatgtgt gcttcacggt ctttgaccag cccgcggggc
    50101 gcggtggcgg ccgcgggtcc gcgcgcggcg cggacccggg cgcggccaag gctgccgcgc
    50161 cgggcggcgt agagcgccgg ctggcctcgg tgatggcggc ggacacggcc gtgtcgatcg
    50221 aggcggccat gagcacgagc gtgttcgacg aggacgtcgc gtgcgtggac gactggccga
    50281 tgctgcaggg cgcggcagac gacgcggcga agctggacgc gctgggcgcg tacgtgggcc
    50341 gcctagccgg gctagtgggc gccatggtgt ttagctcaaa ctcggtgctg cacatgacgg
    50401 aggtggacga cggcggcgcg gccgacgcta aggacggcgc cgccgccggc ttccaccgct
    50461 tctaccagat cgccgccccc tacgctgccg ggaacccgcg ctgcgacaag gacggcaagc
    50521 cgctgccgca gaccggcgcc ggtccggccg tatctatcaa cggcgcgggc caggagttcg
    50581 cgctggacca cctggcgctg gcgtgcgggt tttgcccgca gctgctggcg cgcatgctgt
    50641 tctacctgga gcgctgcgac gcgggcgcct tcgccgggcg caacgacatg gacgcgctga
    50701 agtatgtggc cagcacgctg gagggcgacg tgccctgcgg gctgtgctcg cgcgacgacc
    50761 ggcacgcgtg cgcacacacg acgctgcacc ggctgcggca ccggctgccc cggtttggcg
    50821 cgccaacgcg gagcccgctc ggcgtcttcg ggaccatgaa cagcgcgtac agcgactgcg
    50881 acgtgctggg gaactacgcg tcgtacagcg cgcttcggcg cccgggcgcc gacgagaacg
    50941 ccaggagcat catgcaggcc acgtaccgcg cggccgtgga aaacgtgctc gcggagctgg
    51001 accagcagcg gctgctggcg cacgacgccc agtcggcggc gcagctcgag cgcgcgatta
    51061 cggaccacgc cagctttcgc ggcgctctgg ctgcgatcca aaacacggtc gagcaggcca
    51121 ccgaggcgtt cgtgcgcggg ctggtcgagg accgcgactt caagatgcgc gaggcgctgt
    51181 acgaggccaa ccacacgctc tcgctggcgc tggacccgta ctcgacggcc gtttgcccgg
    51241 cgacggcctt cctgtttcgg cgctcggtgc tggccgtggt gcaagatcta gcgctcagcc
    51301 agtgccacgg catcttctgc gggcagccgg tggacgggcg caactttcgc gcgcaattcc
    51361 agcccgtgct gcggcggcgc ttcatggacc tgctcaacgg cggcttcctc acgacgcgga
    51421 ccgtgacggt gacgctcgcg gaggccgcgg tcgcggcgcc gaaccttgcg gcggcgcaga
    51481 cggagccgcc cgcgcgcgac atggacggcg acatctcgaa ggtaagcctg gaggtcttca
    51541 aggagatgcg cgtgaagaac cgcgtgatgt tctcggcggg caacgccaac atgtcggagg
    51601 ctgcgcgcgc gcgcgtgctc gggctcgcgg gcgcctacca gaagcccgag agcggcggcg
    51661 tgaacattct cagcgggccg ctgggcttcc tggtgaagca gttccaccgc aagctttttc
    51721 ccaacgggaa gccgcccggg agcccgacgc ccaaccccca gtggttctgg acgctgctgc
    51781 agcgcaacca aatgccggcg cggctgctct ccaaggagga catcgagacg atcggcgccg
    51841 tgaagcgctt ttcggacgcg tacgcggcca tcaactacgt caacctcacg ccgggcaacg
    51901 tggccgagct ggcgcagttt tacatggcca acctggtgct gcgccactgc gaccacaagc
    51961 agttctacat caacgggctc acggcgatcg tggccggggc gcgacggccg cgcgaccccg
    52021 cggcagtgat gcactgggtg cgccggcgca tcgcggacgc gcccgacgcc gcggcggccg
    52081 ccgaggaggt gctacgcgag gcggaggccc gcccggaggt gtgggcgggc accttcgccg
    52141 ccagcaacct cgtgcgctcg gtcatggcca cgcggcccgc ggtagtgctg ggcctcagca
    52201 tcagcaagta caacggcagc gcgggcaaca atcgcgtctt ccaggcgggc aactggagcg
    52261 gcctcaacgg gggcaagaac gtgtgccccc tgctgtgctt tgacaagacg cgccgcttcg
    52321 tgctcgcgtg cccgcgcgcc ggctttgtgt gcgcgaccgc gggcgcgggc ggcgccaacc
    52381 gggacaacac gctggtggaa gcgctccgcg agattatcaa cggcagcaac ggcgcgctgg
    52441 cgcagacggc cgtctacggc gccgtgctcc aggcgctggg cccgcgcgtg gagcacatgg
    52501 acctggacga ctgggcggcc ctggtggagg acgagttctt cgcccagagc atggtggagc
    52561 tgacggagcg cgcggccgcg cggcccgggg gatggtcgcc ggagggcgcg gccgacatgc
    52621 tgcgagagct ggagctcgag gcggcggccg aggccgagcc cgcgggcggc gcctttgact
    52681 tcggcgcgtg cgcgagcgcc gcgccagacg cgacctacgc cttcggcggc cccgtggccg
    52741 gggccgggcc cgccgcgcct ggagccaagc gccccgacct ggacgagctg tttgagatgg
    52801 gcgtcccgga caagcggccc gccctgacca ttgacatggt gtagcgcggc ggcgacatgg
    52861 gcggggctat aggtcgctcg tcgccggcga ccccgcccgc attctcccgc cccggtaaca
    52921 gatatataca tgcgccgttt gccgcgaaat aaaaggataa tatcgttgca cattattcgt
    52981 gtttttgtct ggcgcggttc gaccgaggcc gcggcgtctt tggccgtgaa gggggggggg
    53041 aagggggacg cgcaggcatg gcggagccga cagcggcggc cgctgcgcgc tcgggcctcg
    53101 gctccgagcc tggccccgcg cttggcccag acgccgagcc cggctcagcg ttcggcgggg
    53161 cggcggcccg ccagcggctg cttgccatcc tcgggcaggt acagacgtac aacttccagc
    53221 tggcgctgct cgggcgctgc gacccggctg tggcgcgccg ccacctcgac gccgtcaagc
    53281 tgaacgccct catggtgcgc tggctgcggc gccgcctcgg cggggcgctg cgcgcccagg
    53341 cgcgcgtccg cctcacgccg ctgacgtacg cgctggacct cgcgctggac cacgccgcag
    53401 cggaaagcga cgcgctgctg gcggccgcgg gcaccgcgag cgcgcctgcc gagttttttg
    53461 cgcgcaccat ggggctggag ggcgcgtgcc gcttccaccg gcgcgcgcgc ctggcgctct
    53521 acggcggcga gacgatcgac atcgagatcc agttcttgca cgacgtggaa aactttttga
    53581 agcagcttaa ctttgcccac ttgctcgcct caaccgacgc cgcgctcgcc gcgctgggcg
    53641 acgtggatgc ctttttgcgg gccacggtgg cgggcggcgg ggtggcaccg cccgagctgc
    53701 acgattttgc gcagccgtgt ctggtgtgct tcgaggagct ttgcgtcacc gcgaaccagg
    53761 gcgagtctgt gggccggcgg ctggcgctgt gcgcctgcga ccatgtcacg cggcagctgc
    53821 gagtgcgcac cgagctatgc agcgtgggcc agtacctgcc gcacgtgcaa ggcgtgtcgc
    53881 gggcgcggct ggcggcggca gcggcggcgc tggcggcgct ggcggcgccg accgccgcgg
    53941 gggcgggcgg gccccccgtc ctcgcgacgg ccccgcccgg aggcgacggc gacggcggct
    54001 ctgtgcgcga ggcggccgcc tctgtgctcg acgcgcacca cgtcttccgc ccggcgccgc
    54061 gttggctcta cgcggtcagc gagctgcagt tctggatgtc ctcgtcggcg cgcggcgagg
    54121 ccgccgccag cgccgtcgcc gccttcgccg gcaacctaga ggcgctcgcc gcgcgggagg
    54181 cgcagcaccg gctgcaagtg gccgcggcgg agatggcgct ctttggccgc tccccggagc
    54241 actttgaccg cgcgctcgcg gacaagctgg cgcagctgga cggcgtggac tgtctgctcg
    54301 tgggcagcgc tgcggtggcg cccgacgagc ggctcgaggc gctcatccgc gcgtgctacg
    54361 accaccacat gtcggcctcg ctgatccggc gcctcacgcg cccggaccag cgcaacgagg
    54421 acgcgctgcg cgagctgctg cggcgggcgg ccgcgggcga ggcgggcgcc gccgcggttg
    54481 gcctcggcgg cccgggcaga gacgaggggg gcggggacga gcccgaggag gagggcggga
    54541 cggacaacga cggcggcgcc ggggccgggg tggggggcgg tggggcgggg ccgtccgggg
    54601 gcgcagacgg cgggggcggc gcggaggacg acggccccgc gggctgggcg gcgctggcgg
    54661 cgcgcgcccg cgccgatgcc gacgtgcgcc gacagcgcta tgccgagcgg ctctcgaagc
    54721 gctcgatgga cagcctcggg cggtgcatcc gcgaccagcg gcgggagctg gaaaagaccc
    54781 tgcgcgtgag cgtctacggg gacgtgctgc tcaacgtgta cgtggcggtg cataatgggt
    54841 tttgcgcacg ccgcgccttc cgcgccgcgc tggcgagcgc gggcacggtg gtggacaacc
    54901 gcgcctcgga cgccaccttt gacgcgcacc gcttcatgaa ggaggccctg ctgcggcacg
    54961 ccgtcgaccc ggcaacgtgg cccgcgttga cgcaccagtt cttcgaccta gttaacgggc
    55021 cgctctttga cggcagcgcg cacaacttcg cgcagccgcc aaacaccgcg ctgtacttta
    55081 gcgtggaaaa cgtgggcctg ctcccgcacc tcaaggagga gctggccgcg tttatgctgg
    55141 cggccgcggg gggcgggtgg gcggtaagcg acttccagca gtttttttgc ttcgcatccg
    55201 cgcgggcgcg gggcgtcacc gccgcgcagc ggctcgcctg gcaatatatc cgcgagctcg
    55261 ttctggcccg cgccgtcttt gcgtccgtct tccactgcgg acgcgtcccg ctgctgcgtg
    55321 cggaccgaac ggcgccgggc ccggacgggc ggcagtcgtg tcccagcggc gtctacctga
    55381 cctacgagga gtcatggccg ctcgcggcgg tgctgaacgc gccgcgggcg ccggagacgg
    55441 tcggcgagga cagcgtcgtc atctacgacc gggacgtgtt ctcgctgctc tacgcggtcc
    55501 tgcagcgcct ggcgccggcg gggcgcgcgc cgcgctagcc gctgccctgc tatgggcgac
    55561 gtgggccctg ctgctggcgg cgcccgccgc ggggcgaccg gcgacaacgc ccccggcgcc
    55621 cccgcccgaa gaggccgcga gcccggcgcc ccccgcgagc cccagccccc ccggccccga
    55681 cggcgacgac gccgccagcc ccgacaacag cacagacgtg cgcgccgcgc tccggctcgc
    55741 gcaggcggcc ggggaaaact cgcgcttctt cgtgtgcccg ccgccctcgg gcgccacggt
    55801 ggtccggctc gcgcccgcgc ggccgtgccc tgagtacggg ctcgggcgga actacacgga
    55861 gggcatcggc gtcatttaca aggagaacat cgcgccgtac acgttcaagg cctacattta
    55921 caaaaacgtg atcgtgacca cgacctgggc gggcagcacg tacgcggcca ttacaaacca
    55981 gtacacggac cgcgtgcccg tgggcatggg cgagatcacg gacctggtgg acaagaagtg
    56041 gcgctgcctt tcgaaagccg agtacctgcg cagcgggcgc aaggtggtgg cctttgaccg
    56101 cgacgacgac ccctgggagg cgccgctgaa gcctgcgcgg ctgagcgcgc ccggggtgcg
    56161 gggctggcac acgacggacg atgtgtacac ggcgctgggc tcggcggggc tctaccgcac
    56221 gggcacctct gtgaactgca tcgtggaaga agtggaggcg cgctcggtgt acccgtacga
    56281 ctcgttcgcg ctctcgaccg gggacattat ctacatgtcg cccttttacg ggctgcgcga
    56341 gggcgcgcac cgcgagcaca ccagctactc gccggagcgc ttccagcaga tcgagggcta
    56401 ctacaagcgc gacatggcca cgggccggcg cctcaaggag ccggtctcgc ggaacttttt
    56461 gcgtacacag cacgtgacgg tagcctggga ctgggtgccc aagcgcaaaa acgtgtgctc
    56521 gctggccaag tggcgcgagg cggacgaaat gctgcgagac gagagccgcg ggaacttccg
    56581 cttcacggcc cgctcgctct cggcgacctt tgtgagcgac agccacacct tcgcgttgca
    56641 gaatgtgccg ctgagcgact gcgtgatcga agaggccgag gccgcggtcg agcgcgtcta
    56701 ccgcgagcgc tacaacggca cgcacgtgct gtcgggcagc ttggagacgt acctggcgcg
    56761 cggcggcttt gtcgtggcct tccggccgat gctcagcaac gagctggcca agctgtacct
    56821 gcaggagctg gcgcgctcga acggcacgct cgaggggctg ttcgccgccg cggcgcccaa
    56881 gccgggcccg cggcgcgcgc gccgcgccgc gccgtctgcg cccggcggcc cgggcgcggc
    56941 caacgggccc gccggcgacg gcgacgccgg cgggcgggtg actaccgtga gctcggccga
    57001 gtttgcggcg ctgcagttca cctacgacca catccaggac cacgtgaaca ccatgttcag
    57061 ccgcctggcc acgtcctggt gcctgctgca gaacaaggag cgcgccctgt gggccgaggc
    57121 ggctaagctc aaccccagcg cggcggccag cgctgcgctg gaccgccgcg ccgccgcgcg
    57181 catgttgggg gacgccatgg ccgtgacgta ctgccacgag ctgggcgagg ggcgcgtgtt
    57241 catcgagaac tcgatgcgcg cgcccggcgg cgtttgctac agccgcccgc cggtctcctt
    57301 tgccttcggc aacgagagcg agccggtgga gggccagctc ggcgaggaca acgagctgct
    57361 gccgggccgc gagctcgtgg agccctgcac cgccaaccac aagcgctact tccgctttgg
    57421 cgcggactac gtgtactacg agaactacgc gtacgtgcgg cgggtcccgc tcgcggagct
    57481 ggaggtgatc agcacctttg tggacctaaa cctcacggtt ctggaggacc gcgagttctt
    57541 gccgctagaa gtgtacacgc gcgccgagct cgccgacacg ggtctgctcg actacagcga
    57601 gatacagcgc cgcaaccagc tgcacgagct ccggttctac gacattgacc gcgtggtcaa
    57661 gacggacggc aatatggcca tcatgcgagg gctcgccaac ttctttcagg gcctgggcgc
    57721 cgtcgggcag gcggtgggca cggtggtgct gggcgccgcg ggtgccgcgc tctcgaccgt
    57781 gtcgggcatc gcctcgttta ttgcgaaccc gttcggcgcg ctggccacgg ggctgctggt
    57841 gctcgccggg ctggtggccg ctttcctggc gtaccggtac atttcccgcc tccgcagcaa
    57901 ccccatgaag gcgctgtacc cgatcaccac gcgcgcgctc aaggacgacg cccggggcgc
    57961 aaccgccccg ggcgaggaag aggaggagtt tgacgcggcc aaactggagc aggcccgcga
    58021 gatgatcaag tatatgtcgc tcgtgtcagc ggtcgagcgg caagagcaca aggcgaaaaa
    58081 gagcaacaag ggcggcccgc tgctggcgac ccggctgacg cagctcgcgc ttcggcggcg
    58141 agcgccgccg gagtaccagc agcttccgat ggccgacgtc gggggggcat gaggcctatg
    58201 tatgggcagt tcgggtgcca ataataaatt ttgcgcgaat cttatttaag tgcacaccgt
    58261 gttatttgcg gctgtttgtt tttcttggag gcgggacgtg cgcgcgagct cggccggatt
    58321 agggttcggc gccacccggg cacggcaggg cgccctttac ttatgtttgg cgcgcggtgg
    58381 ctccggcacc ggtctctgtg gccctccccc cgcctttgcg tttattgtcc cagctgtgtt
    58441 cccgcctttg cgtgcccccc gcccgagcgc ccgaccgtcc ttccccgccc gaccgtcctt
    58501 cccggcgcgc ctcctcccgc gccacaaagc acatttgacc ccaaaagtaa tgcaaaatat
    58561 acatttattg tggcgcgggg cgcccgaggt accgcattgt ttgttgtgtc cgtgtgtaaa
    58621 catcctcgac ttgccggcca gctaagcggg ccgctttgcg cgcgggctcg cctttcgcta
    58681 gcgctgccgc atcatctggg ccacgaagat ttccgccggg tcgcacgctt gcggcggttg
    58741 ggcgggcggc aggctggcca tggcgctggc atccaccgtc gcggccaccc cgggctcctc
    58801 cggcggcccg acagcggcgg cggccgcgac ggtcgctggt gctgcagcta cggcaggaac
    58861 ggacagcgcc tgcgccggcg cctgggccgg tgcgagggtc ggcacttggg ccgggcccgc
    58921 acctacccgg ggcggggcag tgtactgctg cggcaagcac ggcaaatgcg ccgcgggcgg
    58981 gtgttgcgca gcagcgaagg caggaccgta ggggtagccg gccctcagct ggctcacctc
    59041 ctgctgcagc gaggacacgg cggaggcgag cttggaaaga gcgtgcgacg gtggcgggtg
    59101 cggcggcgga ggagagtggt ggtgaggcgg cagctcggct ggcgcgccct cgcccgggta
    59161 gtaggcctcg tcgtcgtcgc cgccgccgct ccggccgcgc gggtggtccc agttgtaccg
    59221 gcgccgcttg gccagggggc ggcggtcgag ggggccgtcg tagcccgagc cgtccgcgcc
    59281 gtgcgcttgc acgcgtcggc cgtcggcgat ggcgccggcc agggccatga tttggctctc
    59341 gagccccggc ggcgggaaac cgtacccagg gtgccagggc gcggcgccgg cggcgccgta
    59401 ccagcccggc atcgggggcg gagcggcggc ggcagcggcg gcggccggca aaaaatacgg
    59461 agccggcgga ggcgcggcgg tcatcgctgc gccccgggcc tggctgacga ccaactggtt
    59521 gtactgagca gtcggcacgt acacgtagtc cccagccggc agggggtgcg ccgaggccgc
    59581 accggcttgg tgcgctgcgc tcatggcagg cggtgggggc ggcgggggcg gtgccggcgg
    59641 aagctctggc tggcgtgcgc gtccgcccgc gacgggaagc gcaatgcaga cgccgcccgc
    59701 gaccgcgctc ttttgagccc gctcgcgccc gcccgtgcgc tctggcccct cccccccggt
    59761 cggcagcggg aacaccgcgc tcgcctgcag gtacgtgtgg cccgcgatgc ccgcctcgcg
    59821 gcggcgacgc gagacggtgt cccacttgtc ccggacgagc atgttgttca cggcggtcga
    59881 gagcagcgtt tgcgccagcg cctcgcgggg caccggccag gcgcggtcgc cgagggccgc
    59941 gcgcgcggcc tccgcgttgg cgaggagggc ggcgcgcgcg cgcggcgaga gccggcggaa
    60001 gggcgccacg caagcgtccg gcgtggcgtc gtacgtgacg atggtcccga cgcggcggcc
    60061 tagcacgcac agcgcgacgt gggcaaagag cgtgccgtcg gcctcttcgt cgggcgcgag
    60121 gcggcgcgaa gagagcgaca cggagggcaa gtagttgctg acgaggtaca ggaagcgctc
    60181 gcgcggcgtg agcgaggggg cgtcggcgcc gaagaacgcg gggtgcgcca cgcccgcgag
    60241 cgtgtcggcc agttgcgggc agttgatgac gccgacgaaa aacagcccgg cgtcgtcgtc
    60301 ggcgagggct agcacggcgc cgacttcgca ggcgcttgcg tggtcaatgt tgatcggcag
    60361 cggggcggcg ggcggcagcg cgcgcgccac ctgctcgcgc gtgaggacga gctctccttc
    60421 gtcgcccatg ccgtagaggg caaggtaccc gcccacatag acgggcatgc tcgcgcgcgc
    60481 aagcgccgaa ggctcggcgt ccacgcgcgc gtcggcgctg cccccgtcgg gcgcgtccgc
    60541 catggcgccg ccgctttgtg cgcgcgcggg ccggcgggcc tttttatggc cgcggcaccg
    60601 ctcacaccgc ggaggtgaac agcggcacga agcccagaca caaaaagtac agcaagtcgt
    60661 agtcgctggc gacgttaaac tgactcaagc gccgcgtctc gtccagcgcg cggcgcaggc
    60721 gcggctgctg catcaacacg cccagccccc gctcgtactg cagcgccacg gcgtcgtgcg
    60781 ccgccacgac ctccacgacg ggcgcgggcg cggcgcggtg gcggttttcc agctccagcg
    60841 ccacgaggcg cagcagccca ccttggtggc gcccgccaga cacactgatg gcgcgagggg
    60901 cgcccgcggc gctgcgcggc gccagggcgt ccagcgcgag ggcggccgcg cccgggaaga
    60961 gttgcgtgac ctccacctcg gggcaggctt cgtacacgcg agccacatag cgcgcgcaga
    61021 ggaacgtcag gttggcgtcc ccgctgcgcg cgcccacggc gccgtcgagg ccgccatcgg
    61081 cgccgcgcgt cacatccccg ggcgcggccg ccccgggcac cagcgtgcca atctggaagt
    61141 tgttccggag cttgtcggcg tacacgttgc cgttccacag caggcggcgc accaggagca
    61201 aggcggtgat agtgtcgacc gtagcgcgca gcaagctctg gtcctcggcg aggaaaaggt
    61261 tttgcgcgcg cgccaggtac gcgccggctg cgcggtgaac gtcgtccacg tacgcaacgc
    61321 cgtccgcgtc cgcggcgcgc gcgggcgccg cgccgccgcc tagcgcgcca ggaatcgccg
    61381 gcaggacgcg cagccgctgc agcgcggcga ccacggcgtg cgcttccagc gccccgcgct
    61441 cgtagcggcc cgcgccgccg cccggcgctt ggaactgccc tcgcgggagg cgctcgaggt
    61501 caaacgcgta ctgcacgcgc cgggccgcgc cttcatcgat ggcgcgggcc agggcgtcca
    61561 ggtacgccgg gatctgctcc acgaggccga caaaggtcac ggggctctgc gagccgccgg
    61621 caacggcacg gtgcgcgagg tgcagacaca gcaccgcgca ctcaaaggcc gagtacgcgc
    61681 ggttgcccac gtacatgcgc ccgctggact gcagcgccgc caccgcggcc gccatgaagg
    61741 ttcgagacat gcgcccatcg cggtagtcca tgccgcgcgt cgccagaggg cgctcggcaa
    61801 tcagccgatc ctgcaacgtg cgataccagg tcccgaagac aatgcccgcc gaccccccgc
    61861 cggcacgcgc ggtgtacacc attgccaaca ggtcggcggc cagggtggtg tcgtactcca
    61921 ggggcgggtc gttttttgct atttgcactc ggcgtgcgcg cacggcctcg agcgcgcccg
    61981 cgccgccgcc cccctcctcc gcgtcagcgg cggcgcggcc cgcgcgggcc gactccgccg
    62041 ccgcgtccgc ctcctccgcc cggcgcgccg cctcctccag gtccgcgagc acggcggcta
    62101 cctccgccac ccgggcctca atgggccgga tgcgcgcgtc gacttccgcg cccgcggcgc
    62161 gttgcttcgc cagcaggttg tccgcggccg ctgccgcggc ctggttccgc gcccgcgctg
    62221 cggccagctc ccgcgcgggc gcgtccgcgt ccccaatccg cgcgaagacg ggctcgtccc
    62281 agaagcgcag cggaaaggcc ggcgctataa aatttcgctc gtccggtaca aagacgcggt
    62341 ccgcgactgc gtggatgtcc acgcccaggc aagcaaactc taaacgcccg agcgccatgg
    62401 ccccgatgcc gccacaaaga gcgccgaaat ttcgcccagg cacgccgcgc cgcccgacgc
    62461 gtctttagcg cacccgccgg cgctgttgcc cgcgtgcctg ctgccgccca ccgggcggcc
    62521 gctctccccg gcctcagcag ggccggggtc gccggcgggc ggccgcgggg tggcggccac
    62581 agccgccctt ttgcccgtag ccaggggaag cggctgcccc ttctgccgcc gcggccgcgg
    62641 ttgctcggct ttgcgtttgc cccgcggcga tcgccccgct cgccgcgaac gcgcgcgcgc
    62701 gaatggggcg tactcggcga gcccggctat tatagcctca aggcgcgccg cgttgctagc
    62761 gatcgtctgg gccggcaggc gcgtcactct gagcacgcgc atgccccgct gggagacgaa
    62821 caccagcacc ggcgctagga ccaccgggtc tgggcccggg ggggcgagat cgcgcacaag
    62881 ccgggccgag tcgcgcagct gccgcagccc cccgaggcgc tggtccatct tgctgggcgt
    62941 gttcatgttc gttgaaaaac ggcacgtctt cagctccacg ataagacaga cggcccgggc
    63001 gtgccctgcc tccgcgaccc ggagtaggca cacgcaatcg ggccgccggc tttgcaggtt
    63061 tacctcaaag ctcagagaca cgcccacgac ctgcttaaaa acctccgggg cgccaaactt
    63121 gcccaaaagc tgggcgaggc gcgggcgcag cttctgcgcg ccaaccgccg cgcgtgcgtc
    63181 gcaagccagc gcctcgtaaa agcggctgtg gcaccggatc ccggcgcgca ggcgcgcacg
    63241 tcggtcgcgg tcgcgcgcca tggccgagcc cgcgcgcgct ctccgcgtcg tgcgtatcta
    63301 cctggacggc gcgcacgggc tgggaaagac aacaacgggc cgcgcgctcg cggccgcttc
    63361 caccgctggg gagggcgtgc tctttttccc ggagccgatg gcgtactggc gcacgatgtt
    63421 tggtacggac gccttaagtg ggatcctcgc ggcgtctgcg cgatgcgccg cagcctcgca
    63481 cgggagcgca cgcggcgccg gcgggccggc gcaccgcgca gacgcggacg cggcgggcct
    63541 ggttgcgtac taccaggcca ggttcgcggc cccgtactta attttgcacg cgcgcgtgtc
    63601 cgcgctgctg gcgccgcctg ggccggcgcc gggcggcact gtgaccctcg tgttcgaccg
    63661 ccaccccgtg gccgcgtgcc tctgctaccc cttcgcccgc tactgcctcc gcgagatcaa
    63721 cgcggaagat ctgctcatgc tcgcggccgc catgcccccg gaagcgcccg gggccaacct
    63781 cgtcgtgtgc accctccccc cggccgagca acagcgccgc ctggcggcgc gggccaggcc
    63841 cggagaccgc gcggacgcgg gctttctggt cgctgtgcgc aatgcttacg cgctcctggt
    63901 gaacacgtgc gctttcctgc gcgcgggggg cgcatggcgc gacggctggg acgcgctgga
    63961 gtgggcggac gcaaatgcat tggccgcgct cgcagacccc agttgtgatg aatgcaaaat
    64021 ggcgccggcg ccggcgctgc gcgacaccct gttcgcggcg ctcaagtgcc gcgagctcta
    64081 cccgggcggc gggacgggct tgcccgcggt tcacgcctgg gcgctggacg ccctggccgg
    64141 ccgcctcgcc gccctcgagg tgttcgtgct ggacgtgtcc gcggcgccag acgcgtgcgc
    64201 ggccgccgta ctggacatgc ggcccgccat gcaggccgct tgcgcggacg gggcggcggg
    64261 cgcgacgctg gcgaccctgg cgcgtcagtt cgcgctagag atggcggggg aggccacggc
    64321 gggccctagg ggactataaa gctgcccctg cgctcgctcg ctcgctgcat ttgcgccccg
    64381 atcgccttac ggggactcgg cgctcggcgg atcccctccc ggccccgccg cgaagcgagc
    64441 cgccagacaa aaaaatgcgg cgcccgctct gcgcggcgct attggcagcg gctgtcctcg
    64501 cgctcgccgc gggcgccccc gccgccgccc gcggcggcgc ggggggccga agcagggagc
    64561 acagagacgc ccgatacgaa atcgaagagt gggaaatggt ggtcggagcc gggccggccg
    64621 tgcacacgtt caccatccgc tgcctcgggc cgcggggcat tgagcgcgtg gcccacattg
    64681 caaacctcag ccggctgctg gacgggtaca tagcggtcca cgttgacgtt gcgcgcacct
    64741 ctggcctgcg ggacaccatg tttttcctgc cgcgcgcggc cgtcgacaac gcttcggccg
    64801 ctgacattcc ggacaccccg gccgtacagt cgcacccggg gctcttcggg gcggcctttt
    64861 cctggagcta cttgcaaacg cgccacctcg tagactacga cctggtgccg agccgccccc
    64921 tgcaggactg gtacttttcg caggcgcgcg ccgagagcaa cgccgcgcgc ccgccgcccg
    64981 ccccgcgcgt cacaccaacg ccggcggggc gggtggccgc ttttgacatc aacgacgtgc
    65041 tggccagcgg cccggagcac ttctttgtgc ctgtgcgagc ggaccgcaag cggcgcgagc
    65101 gccacgtggc ggattttgcc gcggtgtggc ccgtgtccta catccccgca ggacgggcag
    65161 tgctaagctg cgagcgagcc gcggctcggc tggcggtggg gctcggcttc ctgagcgtct
    65221 cggtgacgtc gcgggacctc ctgcctctgg agtttatggt cgcgcccgcg gacgccaacg
    65281 tgcgcatgat taccgccttt aacgggggcg gcgcttttcc gccacccggg cccgcggccg
    65341 gtccgcagcg gcgggcctac gtaatcggct acgggaactc gcggctggac agccatatgt
    65401 atctgaccat gcgcgaggtg gcgtcgtacg cgaacgagcc cgctgacttt cgcgcgcact
    65461 tgaccgccgc gcaccgggag gcttttttga tgctccggga ggcggcagcc gcgcgccgcg
    65521 gaccgagcgc cggccccgcg cccaacgctg cctaccacgc gtaccgggtc gcggcgcggc
    65581 tgggactcgc gctctccgcg ctcaccgagg gggcgctcgc ggacggctac gtgctcgcgg
    65641 aggagctagt cgaccttgac taccacctca agctgctgtc gcgcgtgctg ctcggcgcag
    65701 ggcttggctg cgccgccaac ggccgcgtgc gcgcccgcac catcgcgcag ctggccgtgc
    65761 cccgcgagct acgcccggac gcgttcatcc cagagcccgc cggggcggcg ctcgagagcg
    65821 tggtggcccg cgggcgcaag ctgcgcgccg tgtacgcttt ttcgggtccg gacgctccgc
    65881 tagctgcgcg gctgctggcc cacggcgtgg tgtcggacct ctacgacgcc ttcctgcgcg
    65941 gcgagctgac gtgggggccg cccatgcgcc acgcgctttt tttcgccgtc gcggcgtcgg
    66001 cgttccccgc ggacgcccag gcgctggagc tcgcgcggga cgtgacgcgc aagtgcacgg
    66061 ctatgtgcac cgccgggcac gccacggcgg ccgcgctgga cctggaggag gtatacgcgc
    66121 acgtcggcgg cggcgccggg ggcgacgcgg gctttgagct gctggatgcc ttctcgccgt
    66181 gcatggcctc tttccgcctg gacttgctcg aggaggcgca cgtgctggac gtgctctcgg
    66241 ccgtgcccgc gcgggccgcg ctggacgcct ggctggaggc gcagcccgcg gccgccgcgc
    66301 cgaacctcag cgcggcggcg ctcggcatgc tgggccgggg aggcctcttc ggcccggcgc
    66361 acgccgccgc gctcgcgccc gagctcttcg cggcgccctg cggcgggtgg ggcgcgggcg
    66421 ccgccgtggc gatcgtcccc gtggcgccga acgctagcta tgtcatcacg cgcgcacatc
    66481 cgcggcgcgg gctgacgtac accctccagg gaattgacgt cgctaacccc ctgctggtga
    66541 cttttgtgcg cggcacgtcg tgcgtgtcgg ccagcggcgc ggtggaggcg cgccgccttg
    66601 cggtccccgg cccgctggac gcgtgcgcct actgcggcag cgtgttcgtg cgatacttgc
    66661 cctcgggcgc ggttatggac atcgtgctca ttgcggacaa gcgcaccgag gttgagttct
    66721 cgcgcggcgc caactctagc atgcccgtct tcaaccctcg cctccacagc gggcgctccc
    66781 gcgccatgct gctgttcccc aacgggacgg tcgtaagcgt cctggccttc gccgggcacg
    66841 aagcgccgac gttttcgccg gcgtacgtct gggcgtcggt aggcggggcg ctggtcgcgg
    66901 gtaccacgat atacgccatc gcgaagatgc tgtgcagctc ggtcccgctc gcgcgcgggt
    66961 actcgtcggt cccggtgttt tagcgcgcgc gttgccctcc cccccttccc ccttttcacg
    67021 tctccccgcc aataaagacg cctccaacaa atctcacacg cgcgcctggt tttggttttt
    67081 tgtaagggta tattattgat tgccgcgtcg ccgcccttgt ggcacgctga gcctagggtt
    67141 cagtgccggc tccagcttcc ccttctccct ccccttcgcc gtcgctgttg ccgtcctcat
    67201 actcactgtc cgacggcggc gtaataccgg ccgccccaag ccgccggtcg acaagggcgc
    67261 gcaggtagca cacgccgtgc cgagcggcgg gcgcgcggtc gaacgccgtg agctgttccg
    67321 cctccatgag ggttacgtgg ggtgccgccg ttcccagcgc gtcgcgagcg cgcgcgccag
    67381 cgccggcagc cccgccggcg tataggtgca gcagcatcgc gcggacgtgg ccctcggctc
    67441 tccgtagctc gtccgcgctg cccgtctcca caatgcgccg gcgcgtgtgc cgagaggcca
    67501 ggctcaagac ggcggtcatc tcgaggtcca gcgcgcgcgc ggcggccgcg gcgtcgtcgc
    67561 agtcacagtc gtaatcgtag ccgccgccgt ctccgccggc gccgcctttt tccgcaggcg
    67621 cgggcggttc tcccagatcg gcgcgggcca aagcctcggc gaaccgcccc agtacgcaca
    67681 gctctcggag gatgtcgttg gccgcgtccg cgaccgtgcc ctcgtcgagg ggcgcggcgg
    67741 cgcggtgcgg ataattggcg gcatagctct cggcgaggtg ctcgagcgcg ccgtagcagc
    67801 tggccatgcc ccagcgcgac agcaagaact ggcacagtgc gaagcgctgg cagaagctga
    67861 acccgtagtc cgccacggat tcgccgacaa agccgcggcg tccgcgcggc ccaaaaaggg
    67921 ccgtcgccgc ggccaccaag tccccgcgcg cctcgtttag cgtttcgtcg atgccggccc
    67981 agtggtcgct cttcaggacg acggcgtccg cgcagcacga cggcacacag ccgcggcagg
    68041 gggtcgccgc cgagagcggg gggcctgtca tggcccaggc attgtaggtc cgcgggatga
    68101 gccgcacctg cacaaagctc gacacggcgg cctcgcggcg cgcctgcggc ggggcgaacg
    68161 ccgcggcgcg agcggtggtg acgatgactt cggtggtcgc gggcgagcgc gcgtctgccc
    68221 cttctccggc gccgcgccgc agcccgcctc tgcagcgacg gctcaaaaag cccgcacagt
    68281 agggggcgca cgggccgcgg cggggccgca agcacgcttg catcagcgcg aagcactccc
    68341 ggttgggcgc gtacacgaag cccgagagcg cgttggtgat cgtgggcacg tcaaacaggt
    68401 gcagaacgcg ccgctcggcg tcgtggtagc cggtcgtgag cacgagcccc gaagcgacgc
    68461 cgagcgacac gaagcactcg gccaggtaag ggtcgccaac cggcacgtcg aagcggccgc
    68521 agaggtccgc gcccgcggcc ggggccccgc cgcgcgggcg caagcgcgcc aggcagtcca
    68581 caaacgcgcc cccgccgtcg ggatcgtcct cgccgtcggt tgcgccagaa ggggcgaggg
    68641 gaaccgcgcg cgcgagttcc gcgcgcacgt agttggctac ggcgcggtcg ctgcgccccc
    68701 agccgcgcag ctccagccca aacttcaccg cctccccgcc cctgcgggcg actgagacta
    68761 ccgtgcccgc atagacaaag tacgcgacgt cccccgcggc cgagacgtag aaggaaaccc
    68821 cgttgtgcgc gacgacgctg tggtaggcga gctccatcgc cgcggcggcc gcgcgagcgg
    68881 gccgacgggg ggaacaatga cgcaaaaggg ccccgggcgc tgagttaaat ccggcgccta
    68941 ctcgcgccgc ccgggagtcg ccgcgagcat gctcggcccg gagagtgcag cccttttgcg
    69001 cgcgcccgag ccgccgctgg gcggcgccga tgcggaagag ggggcggccg gcgccagccc
    69061 gggagacagc ggctcggacg acgaggagga tgagctgctg cggtgcgtcg cgctgtcggc
    69121 gtacgggggc gacgtggact ttctaacgcg ctcgccgcgt ctggcgccgc gcgcggacgg
    69181 gcgggccgcg ttctcggcgt acgtggtctt tggcgcggcg tccgccttcg ggctgaatcc
    69241 cgcctgctgc ctgctgttct tatactacta ccggacgttt ggcgacgcga cgtttgccgt
    69301 cgccggcgcc gcggcaacgc tggcctacta cgcgcggctg gcggcggccg cgggcttcct
    69361 ctacgcgggc gtgcgggcgg accggctgcc ttttgggcgc gggcctcggg cgctgctggc
    69421 ggcgctggtg ctggcgcgcg cggcggtctt tgcggcggtg gcgctgccgg cggcctttgc
    69481 gggcccggcg ctgttcctgc ggctcagcgc ggcggtggcg gacggcggcg cgcgcgcggc
    69541 ggcggcgggg ctcctgctgg ccgggctggc ggcgtacacg gcggatctcg tttgtgacgt
    69601 catcgggttt ttcgcgcccc gggcgtggat gcgcgtgtgc ctggggggcc acgtggccgt
    69661 gtgacgccac cgcgtgagta taaaacgagc ggcgcggccg ggcggccgca ctgcgcgcgc
    69721 cgccccacac cgcgccatgg accgccagag cgagcctccg cgcgcgcccg cctacacggg
    69781 cgggctggtc tccggtcaag tgctgtcgaa catcgaagtg gcctgccacc gcgcgctgtt
    69841 cagctttttc cagcaggtgc gatcggacga caacggcctg tacgcggccg cctttgacgc
    69901 cctcttgggc acgtactgca acacgctgac actagtgcgc tttctggagc tcgggctctc
    69961 ggtggcgtgc gtgtgcacca agttcccgga gctgaactac gtgcacgagg gcacgatcca
    70021 atttgaggtg cagcagccca tgatcgcgcg cgatgggcca catccggtgg accagcccgt
    70081 gcataactac atggtgaagc ggattaaccg gcgctcgctg agcgcggcct tctcgatcgc
    70141 cgccgaagcg ctgggactgc tcgcggagga ggcgtccgac gggacgcagg tttcgtcggc
    70201 catgcgcatg cgcgccatcc agcagctcgc gcgcaacgtg cagacggtgc tggattcgtt
    70261 cgagcgcggc acggcggacc agctgctgcg cgtgctgctg gagaaggcgc cgccgatgtc
    70321 gctgctggtg ccgctctcgc tgtaccgcga ggacgcgcgc ctggcggggt cgcggcgcgc
    70381 cgcgctggtc tcggagctga agcgcccggt gcgcgacgac gccttcttct tgaacaagag
    70441 cgagggggcg ccggggcgcg agctcgcgct ggccaagatt acggacctcg tgggctgcac
    70501 ggccgcgtcg gtggcggtgc cgcgcctgac gcactgcgac acgcgcgggc gcccggtgga
    70561 tggcgtgctg gtgacgacgg cgggcatcaa gcagcggctg ctgggcggcg tgctggcgct
    70621 ggccgactcg gaggcggacg tgcccgtaac gtacggcgag ttcgtgatct cggggctgaa
    70681 cttggtgacg gcgctaacga tgggcaaggc gctgcgcggg ctggatgacg tggccgcgca
    70741 tctgctgggg ctggagggga ccgcgggccc ggggctggcc gtggccgccg actacgacgc
    70801 gccggcagtg gcgcgcgtaa aggcggacct ggtggccgtt ggggaccggc tagtgttttt
    70861 ggaggcccta gagaagcgcg tgtaccaggc cacgcgggtg ccctacccgc tggtaggcaa
    70921 catggacctg acgtttgtca tgccgctggg gctgtacaaa ccgcctgcgg accgctactc
    70981 gcggcactcg ggcagcttcg cgccgccgcc cgggcacccc gacccgcgca tgttcccgcc
    71041 gcggtcggtg ttttttttca acaaggacgg cgcgctgacg gaggtttcgt tcggcgcggc
    71101 catgggcacg ctctgtcacc cgtcctttct ggacgtggac ccggtgctgg cggcgctcgg
    71161 ccggcgcggc cagaggcgag aggcggagtg gtgcctcttc ggcgcgtacg tcgccgaccc
    71221 cggcgagcag gagctcgcgg accaggtgcg gcacttcctg gacgcctggc acgcgctgct
    71281 gcccccgcgg ccgcgctggg tgatggagtg tgccatgacg ccggaacaga tggtggcgcc
    71341 cggcaaccca aacatgccgc tcgagctgca cccggcgttt gacttctttt tggggcccgc
    71401 ggacgtggag ctgccagggc cacccaaccc accacaggtg atgccggcca tgcaggcgat
    71461 gccccgtatc atcaacggca acatcccggt gccgctgtgt ccggtggact ttcgcgacgg
    71521 gcgcggcttt gagctgagcg tggaccggca ccggctgagc ccggcaacgg tggcggcggt
    71581 gcgcggtgcc tttcgggacc cgaactaccc catggccttc tacatcatcg aggcggtcat
    71641 ccacggcagc gagcgcacct tttgcgcgct ggcgcggctg gtgatgcaat gcgtgaccag
    71701 ctactggcgc aactcgcgct gcgccgcctt tgtgaacagc ttccccatgg tgatgtacat
    71761 caacgcgtac ctgggcaacg gcgagctgcc cgaggactgc acggcggtct acaaggacct
    71821 gctggagcac ttgcacgcgc tgcggcggct cgtggacgag tacacagtgc cgcacgcgcc
    71881 cctgggcggc gagcaggagc acgccgcgct gaaccacgcg ctgctggacc cggtgcttcc
    71941 gccgccgctc atctgggact gcgacgcggt gatggcgctg cagcggcgga cccggcgcgc
    72001 ggcgcgcgca cgcgtaaacg gcgccgcgcc gcacgtcgtg gcgcggcgcg agctggccga
    72061 agccaacttc cgcaacgtcg ggcccgacct ggtgcacaac cgacccgtgc gcggcggcgg
    72121 ccccggggcg tacccggtcc cgcaccatgg cgacgagtgg ctggtgctgg ctaagatctt
    72181 ctactacgcc gtggtcccgg ccttcgcgcg cggcgcgtgc tgcagcatgg gcgtgcacta
    72241 cgaccgcgtg tacccgctgg tgcagtcggt cgtggtgccg gatctgcccc ccgacgagga
    72301 gccgcccgcg ggccccgagc acccgcgcca cccgctgcac ccgacgaacc tggtggccaa
    72361 ctccttcaac gtgctgctgc acaacgcgcg cgtggcggtg gacgcggacg cgctgctggt
    72421 gctgcaggaa gccgtgacca acatggccga gcgcacctcg gtggtggtgg tggacgcggg
    72481 ccccgacgcg gggacggcca cggccgcaac gcggaacatg cgcacgctgg acgcggcgct
    72541 gcaccacggc gtgctgatga tggcgtacca gcggaacgac gaaacgctgc tggacggggc
    72601 cttcttctac ccggcgcccg tgcacgcgct ctttgcctgc ccggaccacc tgcacgcgat
    72661 gcgcgggctg ggccaaaacg cgctgctggc cgcacggcac gtgccgcccg tgccgcactt
    72721 tgtgggcgcc aactactacg ccaccgtgcg gcagcctgtg gcacaccacg cggcgcagag
    72781 ccgcgccgac gaaaacacgc tcacctacgc gctgatgggc ggatacttca agctgagtcc
    72841 gctggcgctg acgcaccagc tgcgcacggg gctgcacccc ggcttcgggc tcacggtcgt
    72901 gcgacaagac cgcttcgcca cggagaacat gctctttgcg gagaaagctt cagagtcgta
    72961 ctttgtcggg cagctgcagg tggcgcgcca cgaggcggtc ggcggcgtcg ggtttacgct
    73021 cacgcagccg cacgcgcgcg tggacctcgg cgtgggctac acggcggcct acgccgccgc
    73081 ggccatgcgc acgccgctca cagacctggg caacacgccg cagaacctgt acatgacgcg
    73141 cggcgacccg cccatggtga acggggacgc ggacggcttc gtgcgcacag tcaacgccgg
    73201 gagccgcata cggccgcagg gccccgcgcc gctcttcggg cccattatgc ccgccgcgcc
    73261 ggcgggcacg gcgcgcgggc aggctgcggt ctgcgagttc atcgcgacgc ctgtctcggc
    73321 ggacctcgcg tacttccgct cgccgtgcaa cccccgcggg cgctcggcag gcgcggccta
    73381 cgccggcgac ggcgagtcgg acgccgacga cctcatgttc gaccatggcc agggcgaccc
    73441 ggcccacccg caccgcgcca ccgttaaccc gtgggcctcg cagcgacact cgtacggcga
    73501 ccggctctac aacgggcagt acaacatgag cggcgcctcg ccggtgtaca gcccctgctt
    73561 caagttcttc acgccggcgg aggtgtcggc caaggaccgc tgcatgagcc ggctgattgc
    73621 ggaggtgggc gcgggcgtgt cgcggagcac gtcggacacg gagctgcagt tcaagcagcc
    73681 ccccggcacc ggggagctcg tagaagaccc gtgcgcgctg tttcaggagg cgtacccgcc
    73741 gctgtgcgcc agcgacgcgg cgctgctgcg cgaccgcctc gccgcgcccg gcggcgcggc
    73801 cgcgggcgtc gagggccggc tggaggaggg ccactttgcg cagtacctga tccgcgacgc
    73861 ctcgccggtg cggggctgcc tgccggtggg ctaggcgcgc ccgccccgcc ccgcgcaccc
    73921 gcgcataaaa acgccgccgc ggtgcgcggg gcgcgtcagt tccgccggcg ccccgcgcag
    73981 cgatggccca gcccgaagcg ttcgaggtgg agattgtgct ccccggagac ctctctcacg
    74041 gcgacctagc cgccctccag aagtgcgagg gcaaggtggt attctttacc acgctgcgcc
    74101 ggcgcgtgcc gctggcggac gtggcgctgg cctccttctc ggtcaacggc gtcgcgccag
    74161 acaccctggg gctgatggcc gcgtaccgct gccggttccc ggccgtggtg ctgcgcgtgg
    74221 cgccggggcg aatgatggcg gcgcctctcg gcgtggggcc catgccgcgc ggcgccttcc
    74281 tgcaaaacac gggccccttt gacctctgca acggggacgc ggtatgcctg ctgccgccgc
    74341 tgctggggcc cgcgcgcgcg ctcgcgctgg cctcggcggg cgcggagctg ctgtttccca
    74401 tgacggtgcc gctgccgcag gcgcgcgcgc tggtggcgcg cgtggtggcg cgcgcggtag
    74461 aggcgctggg ggaccgcgcg gccgccgcgc gcgcgcgggc cgccgacgta atgtaccaca
    74521 acgggcgccg ctaccaggtg acgccggacg tgctgtgccg cgagggcgcg gacgcggccg
    74581 cgcgcaccct cgtgctgaac atggtcttca acgtcaacga ggggagcttg ctgctgctgt
    74641 cgctgatccc caacctgctg acgcagggcc tgcaggacgg cgtggccaac gccatcgtgc
    74701 agctgggcag cgcctcgcgc gaggcggggc agctgctgcg cctggagccg gccgagccgc
    74761 ggcaggacgg cggccggcgc ttttgcctgt acggggcgct ggcggcctgg attagctcgg
    74821 cgacccggct gggagacgcg gtcggcgcgc gccccctggc gaaggtgtgc acgttcgacg
    74881 ggccctcggt agtgcgtgtg ggcgaaaagg cgcccatcgt ggtgccgctt taggggcggc
    74941 tgtggtggcg gctcccctcc cccctcaccg gtgttaatac gcacgacaat aaatgagctg
    75001 acacacgctc gcacatacac agtttgtttg ccgtttattt gtttattggg gacagcgacg
    75061 gggcggggcg ccaggctcag tccgccggcg ggcggggggc cagcgggcag aaggcgccgt
    75121 cggtgggcgg gaggctgccc acgaacacgg ccatcactag cgccaccatt agatcgtcgg
    75181 cggcgccccg gcgcttgccc gagaaggccc gggccccgcc ggggccggcg gtgctctcgg
    75241 ttaggttttg cagttgctca aagaggtact ccacggggtc tgtctgcagg cgcacggtca
    75301 gcgaggccag gtcctgggag gcaaccacgc gcccggagtt gaataagcgg atgaagtggt
    75361 caaaggcggc cgtcttctgc ttctgcagca aaaaaaaggg gtaggccacc gcgctcccgg
    75421 gcgggcggca gtggtaaaag cgcgtctcgg cgggcatggg cacggcaccg gacgcggcca
    75481 gcgagtcgag ctcgcgccgg acgccgagcg cgatcgcgac cgcggagtcc tggctgctgt
    75541 tgccctcgac ggcgacaaag aggccgtcga ggcggcgccg gtgcacggcc atgacctgcg
    75601 cgaagcagcg cacggcgcac cgcgcgatct cggcggccga gctgcccgtg agcgccggca
    75661 aaaaaaagtg ctccaggccc agcaccagcc agctgccgcg atgccgcccc acgacggcga
    75721 tgccggagcc ggaggcgcgg gcgttgctcg tgaaggccgg gtcgatgtac atgtagagcc
    75781 gctcgggcca cgggccgcgg gccgccgccg tggatggccg atagagcaga aactgctcgc
    75841 ccgccgcgcg ggtgaacacg gccgcgggct cggcgcggcg cgcgacctcg ccgccgccaa
    75901 tgatctcctg catgaacgag ttgggcagga aggtctcggc ggtgttgcgc gcggcggcgt
    75961 ccatggtgat gaagacgggc ttgttgagga cgtaacacga gcacgcggtg gcgccgccgt
    76021 gcgccgccac acgcggcgtg tgctcgttgc atatatacgt caccacgttg agcagcccgt
    76081 cagaggcgcc cttgaggttg tagaggaagc tcgtgctggc cttgccggtg ttggtcgagg
    76141 agacgaagat tatcttgcag ctggcctggt tcaggaaccc gactatcgtc tggacggcct
    76201 cggggcggat aaagttggcc tcgtccacga agaggaggtt gaagtcttgc ccgcggatgc
    76261 cctgcgagac gcaaataata gaaaaagagg cgtgagcagc gcgcgtgccg acctcgtccc
    76321 gacccgacgc catggaggcg cacctcgcca acgagactaa gcactgcctg gcgcgcggac
    76381 gcagcgccgc gggcaccgtc gtccacctaa tcatatcgag cgactgccta cgggccgccg
    76441 gggcggaccc cggtcgcctc ttcacggcct cggggggggc gccgggggcc gcggcggggg
    76501 caccccgcgg cgggagcgcg cgcgcggact tttccgccgc ggcacagacg cgcttccacg
    76561 gcagcggcgc ctgcagcgcc tgggagcccg tgttcgcggc ctacgtcccc gcgggcgcgc
    76621 tggccagcgt gttactgccc acgcagccgg cggcccggcc cccgatcttc gccgccgctg
    76681 gcggcggcga agaccgcggc ggcctcttcg tgtccctgcc cgtcgccctg cccgagggcg
    76741 gggagggcgc ctttttcgac ccgttcacgc gcgcggcgct gcggctggaa atggccgacg
    76801 gcgagctcgt cgacttgctc ttcgcctacg aagagctgct gcccgccggc acccgctacg
    76861 aggccgacgt cccgcgcctg gccgccctct gctggcagtt tgtgcactat acgcggcgcc
    76921 atgccggcct gccggccgcc gccgtcgccg cggccgagca catggaggcc tgcctgacgg
    76981 agggcggtcg cgcgccgccg ctgccgcccg gcgggcagat ccgcccggag cgcctgctgg
    77041 ccgaaggcgg ctttgacgac cccgccgcgg tcgcccgcct cgaggacagc gaccaggagg
    77101 tcctggcgct catccgccgc gccgcagaag tagtagcggc gcggcacccg ctgcggcgcg
    77161 cgcgcgcgcc aatcggcggc ccgcgcgcgg tagcggcggg gctgcttcaa ggcgcgcgcg
    77221 cgaccgccgc cgcctgcgcc gccaccgcgc cggtcctgcc tcccgacgcc gcgaccgcgc
    77281 tgctgcccgc gacggagccg cgggccgccg ggcccggact tggcgcggtc gcgcgggcgc
    77341 tggcgggcga caccctcgtg gcgacggcgg cgacccgaca ggcccgcaca ctgaccgagt
    77401 ggttcgacgc ggggcactgc gcgctgctgg gcggcgacac gccgtgcgac gcgtggcgcc
    77461 ggcgcccgct ctcgctcgtg gcccggcggc actacgagac gggcgagggc ttcgtcgtcg
    77521 tggcgtacga gcagtcggcg ggctggggcg ggcgccgggc gcccggcccg gcccgccggc
    77581 ccgagtcggt ggccggggag ctcgcgcgtg cctgcgagcg cgagggcgtg gcgcaccctc
    77641 gtgcgctttc cgcggccgcg cgggccgagc tcgcacggcg gcacccgttt ctggcggcgc
    77701 cgctgggcga ggacggcgcg ccgcccgtgg aggccttcga cgcgggcgcc gaggtactgc
    77761 tggccgagcg cttcaaggcg gcgtgcgcgc gcgcgctggt gcgcgcttgg cgcgcgtgcg
    77821 aggcccgccc ggacctaccc cagcggttcc actacgacgt gcgggaggcc cagcgcggat
    77881 gtctggagga cgtggcgcgg cgcgtgccgg cctttttgcg cgcactggcc agcgcgctgg
    77941 gggcgctctc ggcccgggag tttttgaaca gcgcgctctg cgcggcggcg gtggcgcacc
    78001 tctcggcgac gagccccggc ggccggggcg tcctgccgta tcatcgcgcg tgcttttcgc
    78061 tgctggcggg cggcgagcgc gccctgctgt ttgattactt cagctttggc ggggaggtca
    78121 taaaggtctc gcgctcgccc ctcgcggcca cgacggcgca ggagtccggg cggcggccgg
    78181 gctcgatccg cctcttggac gcgggcgcca aaagcgggcg cgcgccggcc tgcggctcat
    78241 acccacccgg cgagtcgtac gcgtacgcgt gcgtaggctt ctcgcggcgg ctgcggtgca
    78301 ccgtcgtgtt cccgggcggg ttcgccctgg aggccgacgt cgccgcgcac ctggactggc
    78361 ctgctcgcct ctgcgaggcg gtgctcgggc ggctgggccg ccccctcccc gcgcccccag
    78421 gcgcgccggc cccgtgagcg cgacgaacgg cgggcgggca atcgcggcgc atggccgagg
    78481 accccgccgc tgcgggcgcg ctgctggcgc gcgcgctgac ggaggagctg ggctgcctgc
    78541 acctcgtgcg cacggactcg cgcgtaaaga tttacgtggc ggtggccacc ctcggccggc
    78601 tgctcgcgcg gctggtgtcg ccggaagacg cgagtcccgg cgctgccgtt cgcgtcaccc
    78661 tctacatcac gcggccgcgc tccctggagc tgccgccgcg gcacttccac gtcctggtgc
    78721 tttttggcgg cgcggtcgcg cgcgcctgcg tcgccggcgt gcgcacgcgg gcgctggtgc
    78781 cgggcagcac gcgagtgcgg gcggtcttcc gcgacgcggt ggctgtcccc gcgccggccg
    78841 acctccccga cccgagcgcc gaggtcgtgc cgcccgcgcc cgcggagcat gtggacccct
    78901 tcgcctttac ggccttcgcg cgcccgccgc gcgacgccgc agactgcttc cagctggcgc
    78961 cgggcgtgtg gtggtcgtac gcagaccggc gcctctacct cgtgcagatg gacgaagccc
    79021 tgctggccct gtgccccgca ggctggcgct cgcgcagcct cgggggcgtg ctcgggcggc
    79081 tgctgagcca ccccggaggc tgcgcggcgt gcaccgccaa atggcacatc gacgcgctta
    79141 acgcggcgcc ggagccgggc gcgtgcgacg tgtgcccgtg cgccgcgccg tgcctgtgga
    79201 agaaggcccg ccgccaggac gtgcccgtcg cgggggactc gagcctgttt cgagtgcttt
    79261 ttacggacgc ggtcgcgcgg gtgcgcattc tgggctcgcg acgccggccg cggatcacgg
    79321 gcgcgctccc cgagctgcta gccggcgtcg ggccgcgcgg cgaagcggtg ccggtgaacg
    79381 gcgccggctg gcagctgcgc gtcatggacg acgacgtcac gcgactgctc gcgagcagct
    79441 gccgcgcgat gcgaagctgt gcggcagcgc gcggctcgcc gtggggctga gcgcgtacta
    79501 ggaccgccgt gcccgctctg tcgccccctc gcgccgtttg cacgcacccc ctttttttcc
    79561 aaaataccaa gataccaata aacaacacac ttgttagcct atttcgcgcg tgcgcgtttt
    79621 ctgtgtactt acgtttgtgt tgtggctgga tgcaaacacg atcgtgctgc gggcgccgtc
    79681 cgggaacgaa aaggagatca cttccccctt gacgtggtct acgcgctcgc cgccgaacca
    79741 ctgccggagc cgcgccacga tctcctcgaa tacgggctcg gtggctttgc ggatgtgcgc
    79801 cgtgtatccg attttgatgc ccttgaacgt ggcgagcgcc agcgcgatca gcggcaccag
    79861 aaaccaggtc ttgccgtgcc gccgtggtac caggaacacc gtggcccgct gccggaagtg
    79921 ggcgaccgcg gcgtctgaga agtccggcgt gttgaaggcc acgcgcaaaa aggcgccaat
    79981 gcgctcggcg tgctccccca acagcgtcgc cgccacgaag tacgtcgcgg gcatcagaat
    80041 catcttttgg aaaagctcca gcgcgccccg cgtctggccg ctggggggct ctacgcgcgc
    80101 gcgtttggcg cggggggggt cggcgtcatc gccgccgccg aggtgcgaga acgacgtgcc
    80161 caccagccgg ctgaaccgcg cgacgaacgc ggccacctgc gcaaacgcgc ccgacgcgcg
    80221 catggactcc agcgccgcca tgacgctgtg gtacgcgttg cagtgcgccg ccgcctctgc
    80281 gggcgggtgc gccgcgaagc gcagggcgct caagaccccc gcgagctccc gggaaacgtg
    80341 cgcctcgccg gtgccggtat ttaacccggc ttcggcgcgc gccatgctcg tcagtagcag
    80401 gcgagaggcc gtggcggcaa acagcggcgc cagctcgcag tacccgtgca gcgtgcccac
    80461 gcctgggacg accgtctggt ggcgcttggg ggccgcaacg gcaaagtcga ggaaggggac
    80521 ccgcgcgtcg tcctccccgc gggcgccgcc gccgccgtcg ggccgcgctc cccgttccgc
    80581 agcgcggcgc tgccgctcgc gcaacagccg ctgaaagtag cgggcggatt gctcgcccac
    80641 ggcgcccccg aacatcgctc gcgcgcgtca cgggcgcgac tgcgtcttcc ccgcccccgc
    80701 ccccgccgcg gttgccgatg gcgacggcgg cgctcgcggg agacccggcg ccggggagcc
    80761 gaacggctgc gcgccggcgg cggctgcggc tggaagaagc acaccggagg gaggcgatct
    80821 tcaagtcgcg cgtcgtggac ttggtccgcg ccggcgcgga ccgggacgac ccggccttta
    80881 tacacgcctt tacggcggcg aaggccgcgc gccgcgactt gggggggcag atccgggcgg
    80941 cggcgcgcgt cgaggccgtc cggcagcacg cccgcgacat agagacacgc gtggccgccc
    81001 aagcggccgt ggccgccgtg ctggccgaaa atcgccgctt tttgcgcggc gactttctgc
    81061 gcgcgtttga cgacgcggag gacgcgctgc tggaccagga ggagcgcatg ggcgacgccg
    81121 ccgcggactg cgggggcgac gtgggcgtgg gcggggcctg gctggacggg gacgacgaaa
    81181 gcctgctcgc ccagtggctg ctccagagcg cgccgcgcgt cggaccggac gtgttaagcg
    81241 acgactggcc cgccgcgccg ctcggagggc tcgcggcggc gccagccggc gcgcgcgtag
    81301 atgcaggctc ggcggcagcg gcggcgggcc aggctgggcc tgccgctgct ttccgggaga
    81361 gacggccgcc ccacagcacc ccctgacccc cgcgccggct cttcagcgcc cccgctccgg
    81421 cgcgccaggg ggcgcagacc tcctcgcggc ggctgcggtg ctgccgccct cgccgcctcg
    81481 ggccgccgga tccgcgctac gccgcgcgcc gatccgcccc gcgagccgcc ggcggcgcgc
    81541 tcgcgcgcgc acatcttgcg gctggcggca gttgagcggc ccgggtgccc ggtctttgtc
    81601 gcggacgcga gtctgcgcat ccgttcggcg gccgagctcg ccggccccgc gcagctgcgc
    81661 ggggccggcg gctacgggag cgtcgttgtg cacgaggccg ccggcgtggc cgtaaagacc
    81721 tttgcgagtg ccgccgactt cgagcacgag ctgctcgtga cgctgctcgc gggcgagtgc
    81781 tcgctgcgcg cgctgcggca cgcgcgcgcc gacgccatca tccggccgtg cgggttcagc
    81841 ctgcggcgcc ggcagctagc cctgcccgcg tatgacgcgg acctggtggc ctacgcggag
    81901 gcggcggggc gcgccgtcct gtcgcccgcc gcactggcgg cgatcgagcg cgcgttcgtc
    81961 ggactcggcc gcgcggtcgt gtttctaaac gcgagctgcg gcctcgcgca cctggacatc
    82021 aagggcggca acatattcgt taacaccgcg ggcgcgctca tcacgcgggc ggtgctcgga
    82081 gacttcagct tgatgacgct caccgcgcag tcggcgctgg ccgacgcgga gtttctcgtg
    82141 tcgacggacg acggcaacag cgacggcgcg tctgacgccg tcgccggagg gcgcctgcgt
    82201 ttgcgcctgc cgcccgacgc ccggatgcca gaccctgaaa ttgttatggg ccactgcgcg
    82261 acgcggccct cggagatgct cctcgacttc cttaaccggc acggccttcg cgggcgcccc
    82321 gagccgctgc ccgcggacct aggactggcc atcgacctgt acgcgctcgg ccacgccttg
    82381 ctggagctgg tgttaaccgg cgcccgcgaa acgcccgagg tccagtgtgc gcggcgccag
    82441 ggcgcactgc acatgagcgc gcgccgcgtg acctgcgggc tggtcatcgg cattctggcg
    82501 caccggtgcg cgctcctccc cttggtcttc ccggcaaccc cgcgcacggc cgcgtgcggc
    82561 gtgccgtggg acgagcccgc ggccgtgcgg gcggccatcg gcaacgtggc gatccgcgcg
    82621 gccttcgacc gcactaccga agcgcaccgc gcgcggtaca cggagcgcgt gcgcgaagcg
    82681 ctcgcggcgg cgcctgtgcg ccgcgcgctg gagcttgccg cgctcttttg ccacccgaac
    82741 ccgcgagcgc ggcgcgccgc gctcgtgctg tggtcatgag tcgggcgccg ctcgcgaagc
    82801 gggcccgctt cgagctcgac agcgcgcgcc gcccgcgctg gagcgcttgc cggaagggct
    82861 tatggagagc agcatggacg agtttctggc cgaggcggcg ggcgaaggcg acggcgacga
    82921 cccggtcgtt tgccgcgcgg cgtacgtccg gcacgtgctc gcccgtgcgg gcgcgccgca
    82981 gccaagccgc ggcgcgcggc gcccgggggc tttttctcgc tgtcgaggcc gcgacccgcg
    83041 gccaggccgc ctgcgatctg tggtggctgc tccggcggag cctggccacg gcctcgtcgg
    83101 tccgctgggg cgccgccggc ccgcggccgc tagtgcgctt gggccgcggc gcggccgaag
    83161 agcgcaacac ggcagccacg gccttcgggc gcgataatga gcccctggcg cgagcgctag
    83221 tgcgcgcctg ctgcgtcccg cccggcgacc tcccaacgcc cgacgggctg gcggacggcg
    83281 gggggcgcgc agacgagctt gggcccgtgt ttgtgtttga cgccgcggcc ggggcggcgg
    83341 ccgaaagcgc ggcgggggcg ggcgcagagg cgcacacctg cggcctcctg atcgacccgc
    83401 gcacgggggc gcttggcgcc tccatcgaca tgctggtctg cgaccgggac gcgcggggcg
    83461 agctggcgcc gcatcccacc cagaccgcgt tgggggtctt tgagattaag tgccgcgcca
    83521 agtacgcgtt cgaccccgac gacggcgcgc gacggcgcgc gcgtacgccg ccctgttgcg
    83581 ggcgcagcgc cgcggcgctg cgtgccttcc tgcggtccgt gcgccgcccc ggggtggagc
    83641 actgccctcc cgacggctgc cccggcgccg cggaagcgct ggcgagctgc gccgacgcct
    83701 gggcgccgcc cccgcctgcc ggcgccgcac cggcgcggcg ctgctccgag tttgactggc
    83761 gccacctggc gctgaaccgg agcgtgacgt cgcgcgtgtg gctatttaac gagcccgccg
    83821 ctcactcggg cgctattgga ctcgccacgt gggacaccgg cgaggcagcc ctcgaagcgc
    83881 ccctgttcgc caacccgcgg cacgcgaact tcaagcagat cctcgtgcag agctacgtcc
    83941 tcgcgggcca cttccccgag cgcgccgcgg cgctgcatct cgtcactttc atcggccggc
    84001 agcggcgcgc ccgcgagcag ggcccgctcg aagtgcgcgc ggggccgggg gcggagacgt
    84061 gtaccgtacc gcgcgaaggc gccgtccccg ttctgctgat cgccacgcct gtggtggtcg
    84121 acggcgagct cgcgcgcgag tcgctagagc agccggcccg ggaagcgttt cgggcggccg
    84181 tcaaggagtc atgggacagg cggcgtcgtg cagccgatgc cgccgcaacc gcatcttgac
    84241 gcgcgccggg gacctcgtag ccctagacgc ggccgccttt gaggacttca gcctcgacga
    84301 cctgcaggcc ctgacggccg gggccgccgc gggggaggag ggcggcgagg acaaaaaaaa
    84361 cgccgacgac gactggtccg acgtcatcac cagcgccccc cggcgcgggc agcgcccccc
    84421 cgtaaaaccg taccggccgc agcgccgcga ggtgtattga gcggccgcgg accgcggcag
    84481 acccgcgaca ataaacacac gcaaagaatt acacgatttg atagcatctt tatttgacgt
    84541 gcgcgggggg tggggagcgg gggggggggc gggggtgtga agcgcgggag tgggggacct
    84601 ccggtctcct tagcggtatg gttggcgggc ggggcggggc gtgcgcctcg tacacggcct
    84661 cctcgtcgtc agaggcgacg ccgcggtcca gcagcgccgc tgcgtcgcct tcgagcgggg
    84721 ccatgccgcg gctgctgcgc gctcgggcga tgtagcgcgc cgcttgctgt cgcgcggcgc
    84781 tcacgtggcc gtagaaggcg ctgcctttgc gccggtggtg caggcaggcg cgcaccaacc
    84841 gcagcacgag catggccacg gccagcaggg cgacgccggc cagcgccagc tttaccctag
    84901 cggcagcccg gggggcctgc gtgcgcacaa ccccccgcag ctggtggaag tagtcgtgcg
    84961 aggcgaccgc gatgcagcta gctgccacca gcgttccaaa ggccggcccg ggcagcactt
    85021 gcgtgtagcg cgacaggact agctcggtca gtaccaaaaa gagcacggcg gcgaggcaga
    85081 agaccgtcac gccggcgacg accgtttgtg ccagcgacag ccccagcccg gcccccagca
    85141 gctggccgag catcaggggc gcggtgccaa tgatcagcgc cagcaggccg ccggccaggt
    85201 tgatcatcac ggcgcgcccg gggcccagca ggcggtgggc gcgcgggctc ctctcgcgga
    85261 gggcgtgcac ggcctgcgcg tactcggcgc cgggcagccc ggcggtgcaa aagagcccga
    85321 cgaaggcggc cggcggcgcc aggtgcgcga ggtaggtggc cgcggccaag accatgatct
    85381 tgtgggacag cagcagcacg gccgcctgca gcgtccaggc cgccagcgcg cccagcagca
    85441 gcgcacccgg gggcgtggca agcgtcgcca gcgcgttcat atgatacgcc gccgcaaaac
    85501 cccctgagtt ttcgcggcga atgattatag cggccgcgac gtcaaaggcg gcgacggcga
    85561 gcagaactac ggccgtgtac gcggagaagg ccgctgtggt cggcgtctcc aaaaacagcg
    85621 ccgggtggcg cgcgccgagc tcccgctgcg cccaggcgcc gccgtcggcc gagaggttcc
    85681 gcgcattgta attaactatg gccgcgtaga agcaggggag ccccgcgccc ggcgaagcgg
    85741 cgccgatcag ggtgatcagc agcagcagcg ccaggccggc gaagacgccg acctgagcga
    85801 gccacaagcg ccagtgcacg gcggcaggct gcgcggagcc cgccatgacg gcaacgccgg
    85861 gggcagcggc cgatgcggtg cgcgtcgagg gtgcgggcgc gtgcagcgac gggggcgaag
    85921 aagcgcgtta tgcgtcgagc gcgtcgctgg cgcggatgtt atacggcgcg gacctgagcg
    85981 agcgcgttcg ccggcgccac cccgccgttt gcgtggagca ccaatcagga cgccccgtcg
    86041 cgttgccgtc cccgcttgca gcggacgccc ggcgcgtgac cgtggtccgc gcgccgatgg
    86101 gctcgggcaa gacgacggca ctgctgcgct ggttgggcga ggcgctgggg gccacggatg
    86161 cgagcgtcct cgtggtctcc tgtcggcgca gctttacgcg cacgctgcac gagcggctcc
    86221 gcgacgcggc gctgccggct ttcgcgacgt actttgacgc gcggagctac gtgatgacgg
    86281 gcgcggccta ccggcggctg ctggtgcaag tggagagcct gcaccgcgtg gacgaggagc
    86341 tgctgggcga ctacgatata ctagtgttgg acgaagttat gtccaccctg gcccagttgt
    86401 attcgccgac gatggggcgc ttgcaccggg ttgacgcgct gctgcaccgg ctgttgcggc
    86461 ggtgcccgcg gattgtggcg atggacgcga cggtgaacgc gcagctcgtg gatttgttgg
    86521 cggcgctgcg cggcgcgggc agcgtgcacg tggtcatctg cgattatgcg tcggcgggct
    86581 tcttgcagcg gcgctgcacc gtcgcgcggc ggctgggcgc ccgcgtgctg gcggcgcggc
    86641 ttaaggggga cgccgaggac ggcgccgaag acggcggcgc ttcgttcttt acgcggctcc
    86701 gggcgcgcct cgaggcgggc cacaacgtct gcgtcttctc ctcgacggtg ctcttctcgg
    86761 agctcgccgc gcgcttttgc ctcaccttca cgccctcggt gctggtgctc aactccacgc
    86821 ggcccgcgga gggcgatgtg tcgcgctggc gtgacgttcg cgtgctcatc tacacgacgg
    86881 tcattaccgt cggcctcagc tttgaccaca gctacttcca cgcgatgttc gcctacgtca
    86941 agcccatgag ccacggcccc gacatggtct cggtgtacca gtcgctcggg cgcatccgct
    87001 cgctcgtcga caacgagctc tgcgtgtact tcgacagcag cgccgcgcgc cccgagcccg
    87061 tgttcacgcc catgctgcta aatcacgtgg tggctgagga cggcggctgg cccgcgactt
    87121 tctcggaggt caccaacctc ctctgctgca gcttccgcgc ggcgtgcgcc cccgcctttc
    87181 gcggcgcgcg cggactcgcg ctgtttccgc gcttcaagta caagcacctc tttgagcgct
    87241 gcacgctggc cagcgcgagc gacagcctca acatcctcca cgcgctgctg gagaacaacc
    87301 gcgtcgggtt ccaactggaa gcgctgcgca gcgctcaccg ccgcgggatt ctgccgcttt
    87361 ctcgcggacg tgcgcgccga cggcccgcgg ccgcggccga tttgcgcgca ttggccgccg
    87421 gcatcccgtc cccggtgtcg gccgagggcc tggccgagca cccggccgtg gccgccttcg
    87481 cggacaagta cttgcgcgcg ggcggggccc cgcccgccgc gctcgaagag ctgctgcgcg
    87541 cgctcaacgg ccccgcggcg cgcgcccgct tcgtaaactt ggccgtgctc ggcggctgct
    87601 tgcacgtgcc cgccgccgcc gaaagcctgg aagtattcgc gggcatctac cgccactacg
    87661 cctcgggcga ggtgcccgtg ctcaccgagg ccggcgccgt tgagacggcg gctttggcgc
    87721 ccgggctgcg ctggaagcca actgcgctgt ttgggctgcg ccgcatggcc cgggcgctgg
    87781 ggctgctgcg gcgccgcggc ggcggcgaag ccgacgacgt cgcagacgcc gcccacggcc
    87841 tcacggagcc ggcgatcgtc gagctcgtcg ggccgccggg ggggcacgac tacgcgcagt
    87901 gcttactgga aatcgcccgc tgcaacatca cgccggcggg cgtgatggcc cgcgggcctg
    87961 tggtcgctgt ggccgcgcgg ctttctgggc ggggctttgc acaggggcgg ggcgtggggc
    88021 tgggcgcggc cgcgcacgcg gtgagcgtgt tcaaagtgat atgggaagag gtgttcgggg
    88081 cccggctgca gaagagcacg caaaccttcc cgggccacgc gcgcgttaag aacctgcgca
    88141 aacatgaaat cgtcgccctg ctggacttgg ctggcatcga ccgcgccggc cgcgacacgc
    88201 accgcgagtt gtatcgcctg ctgatgagcc acaaggcgcg cttcgcgagc cccaagtaca
    88261 gcctgcgcct cccaaagtgg ggccggctcc ttggcttcgc cgcacgcggc ccggagcccg
    88321 ggcccgacgc gccccccgaa gcctcgctgg aagcggcgct cgcacgcgtc ccggctttgc
    88381 actggccttg cgccgcgggg gcggtcgact tttgcgcgct ttagccgcgc gggcctgtgc
    88441 tcgtctgccg tagccctccc cccccccccc ctctttaccg cgccatgccg gtttcgcaca
    88501 gcaacggctg tgtgtgcggg gtctcgcttt attcggcgtg ggccgcgggc cccgaccgcg
    88561 cgcgcgtgct gctcgcccta ctctgccgaa tggacgacgg cggctgcgac gccaagttcg
    88621 ccctcgtaaa cgtgtgtgcg cgtggcgtga ccgcgctcgc gcgcggcgcg agagatgtaa
    88681 cggccgcgcg gctggaggac ctcgcgcgcg ccgccgccgc cccccgagcg ctgccgctgg
    88741 caacgctcgg ccacgctgcg acgtggaagg ccctgtacgt aagtgccctg gcggcgctgc
    88801 gcgcgcagat tgggcccttt cgcttttatc gagagacgcg ctttggagta gacaacgaca
    88861 ccgggttgct ggtgtccgcc gaggagcccc ccgatgccgc cgacgcggcc ccgcgggcgg
    88921 ccgtgctgcg ctcggcgcta cggctggccg tagaggaaga cgcggtgcgc gcggcggcgg
    88981 cggcggctcc cgccgggggc ggctcccttg cgcgcgcgcg gctctgcgcc atgcgcgacg
    89041 gacacgccga cctctccgcg cccgggaacg tcgtcgaatt cgagctgact acaaagacgg
    89101 cccgcttcta ccgaatcttt gccgacatcg cccagccccc gcggaagcgg gccgggcgcc
    89161 tggcggacgt gtttgcccac cgggagtacc gcgtgcgcac agaaggcagc gccgccccgg
    89221 tggtcgtgcg cgcgctcgtg cccgtcaact ttgactgcgt cgtcgccgac gcgcgcgcct
    89281 tttcgccgat ggccgccatg cttgtgtttg cgcagtggca cgcggcgctc tttaccgacg
    89341 gaccggcgca ggtcctcggc tttctggggc cccagctgaa ccccggcggc gaagagcgcg
    89401 actactgctt cttgctgggg tttccgggcg tcccgctagt agtctcggcc gccgacgccg
    89461 gcgccgtgcg cgatgactta gacgcgcacg ttctcacgga cgggctctgg cccgccttcg
    89521 gcgtgcacgt gtaccacgcg ctcggcccgt ggaacttttt ggacggcgcc gccgtcgcaa
    89581 gcctgaaccg ccgcattgcg gcagcgcgcg ccgcgctgcc gccgggcggc agcgacgggt
    89641 cagattggcc cgcgggccgc gtgagcacca tcttgaacag ccccgcctgc gtgcgcgggc
    89701 tctggctggc caagttcgac ttttcggcct tttttcccac cctgtacgcc catcttgttc
    89761 ccgagcacgc gcgactggcg cgcgctattt gcgcgcgccg cgacgggcgc cctgggctca
    89821 agccttcgct cttgaccttt tttggcgggc tgcggcacgt gcacgcgccg gcgtacgagg
    89881 ccgtcatcgc gctggcgaac gccgtggcag ccgccgtgga gcgcgcggcc aacgcgcgaa
    89941 actttgccgt gtgcacgtac gtcaaggatg gcttttgggg cgccttcggg gacgcggcgc
    90001 ccgaggttgt gccgcgcgag gccgcgctcg cggcggcgct cgcgctgcga gacgactgcc
    90061 agcgcgcggc ggaagcggtg ctgcgcgccg cggggctgca ccccgcagaa ggcgccgagc
    90121 tgcacctgcg cttcgagggc ctgttcacgc atgccgtttc gtggtcggcc aacaaatact
    90181 ggctctggga cgccaccgcg gggggcgctg agggtgagct ctttgtggga ttcccctgcc
    90241 ggactgagtt cgggcgcatg gccaagcgca gccttgcggg gctgctgcgg cgcgccgtcg
    90301 cccagcccga gcgccccagc gacacggtcg cggccgccgc cgcggcctgt gacgcgctcg
    90361 ttcacgcggc ctttgagcgg cgcggcgacg tgcgtttttg gagcgcgacc gcgcccattg
    90421 ccgactgggg cgcggtgccg cgctcggcgc tttcgggcgg cgacctgctg gacgcggacc
    90481 acggcccccg gccgtacgtg cttgtggcgg gccacgaggc ggcgcccttc ccgctaccct
    90541 gggctctcta ccgctccccc gtgttgcttc cggacatcgc ctgtcgcgct cacatggcgc
    90601 ctgtgctgca ggagctggcg cgcatgctga acggcgccct ggcggccctc gccgcgcgcg
    90661 agggcgacga cgagccgcca atagaagagt tcgagtacaa cctggccgat ttcgattttt
    90721 tatttgcctg aggggatggg ggggggaaag gaaacatcat aataaaagat ggtagacgat
    90781 gtctcagtcg tacgacacaa acatcttgtc cggcgtcagt ttgtcgggga tgcgcgtcca
    90841 ccaatgatac accgcgtcgc ggaacgcctg cgcggcgagg ggcccgttca gcagccccgg
    90901 gcgcgcgtta atcacgcccg gcgggcaccg ctctggcgct ggcccgccgc gccgcgccgc
    90961 gccgccggtg tggtagatcg ccgtaatcac cgacgggggg ttgccggccg ctagcagcag
    91021 ccgggcgacg gcgtagtggg gcaacaccag ctggctctcg aaggggctgt agccggccat
    91081 gcacatagcc gtatttagca cgcgcatggc gcccacgtaa agcaaccggc tcatcttgcg
    91141 cgcaggcggc gggcgcagac gccgcagcag gcacgacagc tgcacgaaca gggcggcccc
    91201 gacgcgcgcc tcgctgcagc cctctaaaaa catttgcacg acgcagaggg caaagtcctc
    91261 ccgcgttttg gggcggcaca aggccagccg gtacggcagc acggcagcgg gcacggtagt
    91321 ggcaaagacc gcatcctcca tggcggtgag cacggcgaag gcaaagcccc ggaaggccgg
    91381 catggcttcg cattcggcac ggtacgcatc gcagtccact tcttcggcgc ggccgtcgag
    91441 cgtcagtagt agcgcgcccg tgctcggctc tacgcgcagg tgcgtaatgg acgatgacgt
    91501 gaacgtcggc ggccctgctg ggatctcgcg gacttcgcag acgaagcgcg ggagcgtcca
    91561 cacgaggtcg tcgagcacct gcggcgggcc acccgagccc tcgcgcgcgt cctgcagcag
    91621 gctctccagc gtcgagccct caaggggcac gcccagcgta agtccgtcgt acgcctcggc
    91681 catcctcgcg gcgctcgcgg cggcgcttct cctcgcggct gcggctgcgg ctgcggctgc
    91741 ggctcttgct tcgccctctc tcgcggctgc ggctgcggct gcggctgcgg ctcccgcttc
    91801 gctctcgggc accgcgcgac gcgaggccca gctgcagcgc cctgcgcgcg tcggccgtga
    91861 agatcgcagc gagctccgcg aggtacgtct ccaggcgcgt ttttttaaac accgccccgc
    91921 atagctcctc ctccgacctg cacgcctcct ggtgcgcgat caggaagccg aagcgccgga
    91981 cgcgcagcac agagaaaaaa tacggcgcca ggatcaagga gatggagctg ttcgagtaca
    92041 cgaccgacac ctcctggccc tggttgttag ccgtccgggc aagcttgaag cagcggagga
    92101 gttcctgctc ccacagccgc gagagccgct ccacgtcatc ggcgtacgtg gggatgtacc
    92161 gcgactgaaa gctgttggcg acgtaagagt ccgggcccat cagcccagat atgtcgatga
    92221 cttcgtgccc caattccgcc gtccgcgggg cccgccgaca gcgaacccgg gccggccggc
    92281 ggcccgcccc ccccgcgcgc ggcgtcggcc gcttgggcgg ccagcagcgc gcgctctcga
    92341 gccgcctgca gctcgcgctc ttggcgcgga gcttgtcggc caggtcgcgg ttggcgccct
    92401 ttagcgattc gatggttttg aagaggttgc tgacgtagcc ttccaacatc ccgttaatgc
    92461 tgtgcaccac agacgctcgg aaggccgtcc tggatctgct gtccgccccg ccgcccgcgc
    92521 ggccgcccgc cgcgccaaat ccgggctggg aggtgtccac gtctgagacg tcaaagagcc
    92581 cggcggccgt gtcgtctagg tacgaacgca cggtctccga gatgtcgccg atgtgccgca
    92641 tgcccttcat gttgacgatg agcttgatca accgcgccgc cgaggaggac gcggccgcgt
    92701 cctcgccctc accgagcagc ttttccacgg acggcgcgcc cggcggtttc gcccgcagcg
    92761 cttcggcgcg ccgccccacc agcaccttca gggggacggt gttaagcagc tggcagagcc
    92821 tcgcgtgctc gcgcagcgcg tggcaggcca ggacctcgcc gtgcagccgc tgcatgggcg
    92881 actcgaagag tacgtcgccg ccgcgccaca cgggcgccca cagcacgaaa cactcgccct
    92941 cttcgccggt gacggcttcg cgcacggcaa attgcttttt gcgaaaattg tagagaatct
    93001 cggtacggtc gtagtcgagg accgtcacgg cgccggcgca tcgcaggagg tccgctgcga
    93061 aggcctcgca ttccgccagc acccgccggc aacgtccagg cgccgggcca gctctcgcca
    93121 acgcgggaag cggcccccgg cgcctggacg gtgccggcac cgcgaggccg atgcgccgca
    93181 gcggcaccag ccccaggcac acgagccagt ctacgtaccg ggcgaagctg gccgggctgc
    93241 cggcgccccc cgcgggaaag gcggccgcga cgccccgaac gcactcaacg agcgacatct
    93301 gcagcgtgcg cctccaggta tcgaacacgt gctccgcgag ccgcaccacc tctgcctcgc
    93361 cgcgcgggcc gtatcgcgcc gcgatgtcgg cggcgcgcag gccgcgcgcg cgtgtgtagg
    93421 cgcgccaatc ccgcgccacg tcctcgtagc gcgcggcgtt tagcgttgtg cttaggatgg
    93481 tggcttgcac ttgccggatc acggtctccg tgcagcgcac ggcgctgtac acgccctggc
    93541 cctcggtgta gcccagctcc cccagcagga tctccttgaa gagccgcgtg ccgcgcgtcg
    93601 ggtggatccg cacccactcg cccggcggcc ccggagcgcc cgggttacgt gccgagccgg
    93661 ccaagtttaa ggcgcgctcg gacacgacgc gctcgcactc tgccatcgcc caggtgctcc
    93721 ggccggcgcg gccgcggacg tctgcacgct cggtcatgga gcgcgaggcc ttttcagccg
    93781 aggtcttcct gaatttcact tccatgcacg agatacagcc aatcgtcaag cggatccggc
    93841 agctggaggc cgcgcggctg ccggcggcgg cccggccgcc gcttggctgg ttccgcgcgg
    93901 ccgcggcggc cgagtccccg ctggactttg cgccgcgcga gctgcctttt gccgcgtacc
    93961 ttatcacggg gaacgcgggc tcgggcaaaa gcacctgcat ccaaaccctc agcgagacgc
    94021 tcgactgcgt gatcacgggc gcgacgcgcg tcgccgcgca aaacgtctac ctaaagctag
    94081 ccgccgccta ccacagccgt cacatcaaca ccatcttcca agagtttggc ttccgcgcca
    94141 accacgtgca ggcgcagctg ggccggcacc agtacgtttg cgcggccagc ccgcccagca
    94201 tccaggacgt gcagttccgc gacctcgtgt actactggga ggtgctgggc gacatctcgc
    94261 ggcggctgct gggcgcggcc gcctcgcgcg ggcagttcga ggcgctgcgc gcggcggagc
    94321 tcgcggcggg gcgcccgcgc ggcgccgtgg agcggctcgc gccctgcgtc cacggctcac
    94381 ttccggcgtt cgcgcgtagc aacgtgattg tcatcgacga ggccgggctg ctgggccggc
    94441 acatcctcac cgcggtcgtt tactgctggt ggctcatcaa tgcggcgcac gattcggcgc
    94501 agtaccgcga cggggccatg cccgtcgtgg tctgcgtggg ttcgcccacg cagaccgact
    94561 ctctcgagtc caccttcgag caccacaagc taaagtgccg cgtgcgctcc agcgagaatg
    94621 tcctcacctg ccttatcacc aaccccacgc tgcgcgagta cgccgcgatc ccgcacaatt
    94681 ggaccatttt cattaacaac aagcgctgcc aggagtacga gttcggcgag ctgctcaaaa
    94741 cactcgagta cggcctgccc gtgacggaag agcacctcgc gctcgtggac aagtttgtcg
    94801 tgccagacgc cttcattaac aaccccgcga acctgcaggg ctggacgcgg ctctactctt
    94861 cgcaccgcga ggtgagcgcc tacatgagcc gcctccacgc gcacctcaag gtcgccgagg
    94921 gccgcagccg ctttgtggtc tttacgctac ccgtgtacac ctttgtcaac atccgcacct
    94981 tcgaggacta ccgcaccgcc acgggccagc cggggctggg ggtggaaaaa tggctgcagg
    95041 ccaactcggg ccgcattacc aactactcgc agagccgcga ccaggacgcc cagtcaccgc
    95101 actgcgaagt gtgctcggcc aagggactcg tcgtggcgcg ctcggacgta acttacgtgc
    95161 tcaacagcca ggtgacggtc accacgaggc tcaagaagct ggttttcgga ttcagcggca
    95221 ccttcgccga ctttatcgcc gtgctgcgcg acgacgggtt cgtcagggcg cagagcgaga
    95281 cctcggtgga gtacgcgtat cagtttctgg ccgcgctgct ctttgggggc atgatcgcct
    95341 tttacaactt tttgcgcacg cccggcctgg acccgggccg cgtggacgaa gcctaccggc
    95401 ggctggcgcg cgccacgcag gaagcgctcg ggcccgccgc ggacgacgcg gtcgactggc
    95461 gggggctggc ggcggaccgc gccgccggct ctgaggccgg cgccggggac aacgacgacg
    95521 acctcgtctt cgcggccctg gacgagggga ccctcgactt gctctactgc aactacgagt
    95581 tccagcgccc tacgtccgcc cacgaaatct acgcacagtt tctgctactg aagaacttgt
    95641 tcgctgcgcg ctttgacgtc tgtcgaaccc tgttcggggc ggccttcgcg gacgcgccct
    95701 tcgaggctta cgtggacaac cttagcttca aaggctgcga ggtgttcacc gggagcctgc
    95761 gcggcgggct ggtctccatg gcactgcaga ccgacacata cacgctgatg ggctacgccc
    95821 acgcgccccc ctcgctgctt tcggaggagc ccggccggcg ccggctcccc gacggcgtcg
    95881 cggagctgct gtcgacgctg gacgtgccca acatcgtggt ccgcgaccag cgcggcttcg
    95941 tgtccgtgct gcacacgaac gtcagcgagt tcgtggaggc gctggacgac aaggagctcg
    96001 agatggctgt cagcgtcgac tacggcatca gctcgaagct ggccatgacc atcgcccgct
    96061 cccagggcct gagcctcgac aaggtcgccg tatgcttcgc gcgcggaaac ctgcggctca
    96121 acgccgtgta cgtagccctg tcgcgcagcg tgtcgtcccg atttctccga atgaacctca
    96181 acccgctgcg cgagccccac gagcgggaca cgatgatcag cgagcatata ttagccgcac
    96241 tccgcgacga gaacgtccac atcgtctact aagccccgcc gcggccgccg ccatggcgct
    96301 cgcggccccc gggcccggga cgacgacgct catcgcgtac tccctatacg aaataaagat
    96361 ggcccccttg tgggccttgc cccactgcga gcaggtggtg tgtgagtgcg ccgcggggga
    96421 tcgctcggtg tcggtgggcg gcgggctggc gtgcgacgcg ctgccggcag ggacgctcgt
    96481 gctccagcac gggcccgccg ccacgctggt cgcagtcgac tgcgggtccg aatactgctc
    96541 gtatgccttc acgcacgcca gcgcgtgcaa ctcgctgagc ttgcgcgagg gctccgtgtt
    96601 cgttgtcccg ttcgacgagt gggcggcaac ggaccgcgcg cgccggctgt gcagccgcgc
    96661 gcgcggtctg ctggccgtgt gcctgggcgc ccggcgagac atccacgtca ccattacggt
    96721 gtacggccag agcacagcgc cggcgaccgc gccgcccccc ggcgacgtcc tcgaggctat
    96781 cctgcaggag tcggagattc gcgactgcga tgcccgcccc tcgggctccc gcccctgcgg
    96841 cgaagaatga gaccgaggca gttaataaac tcacagttac gctttattgg aatgtgtagt
    96901 atatggttac gtcttattgg aacgtgcggt aattgggggg gaaagggcgc gtcgggggcg
    96961 gcggtgggcg gcggtccgcg ctggggaggg accgccgtgc tcgcgcggga ctggcggccg
    97021 cgtagaggcg cgcggcccgg gcctccgcgg gcggcaggcg ctcttcgttc gcgggtacgg
    97081 ccgcttccgg tccctcgggg cggcgcgccg cgcgaagact cggtgcccgg cgcacccgcc
    97141 gggcagcggc gtccgggctg ctttccccga ccgcggcggc cgccgcgcgc agcttagccg
    97201 cggcggcgcg gttggccgcg agaaactgcg tgtagtccgc caccgtggcc acccgggcct
    97261 ccccaaagac actgccggcg cgcacgcggg ccatggctac cggtgcggtt gctcgccggg
    97321 gcgcgagtcg ggaccaagcg tgttgtcgcg gtgtatatac accgggccgg cggcagaaaa
    97381 ctcgtacacg tacaccggga ccgcggggcg cgtgcctccg tccgaggagc gagtgtagta
    97441 ctttcgcggt ttccgcgact ggatcaccga gtggagctga tcgcgaacgc gctgcgcatg
    97501 ggcacgctgg cacagcagga acatctgcag gctcttgttg ctgcgcagcc gcgcgccgca
    97561 gccgcgccag ggccgcgcgc taagcccgcg ggcttgcgcg ccggaaaaag acgacgtctt
    97621 tgtgcacgct atggtgtact tggccagcgt gcgcttgagg tccttccgga tcgtgtccgt
    97681 gagctggcgc cgcccgagct cgtcgataga ggagaccata aacaaggtgt caaaggccac
    97741 gcagtcgggg tttgggccca gacccgccgc tgccaggccg ggcccggcca acgcaggccc
    97801 gctgctgcgc tcgccgtcgt cggcgggggc agaagcggaa gcggcggcgg cggcagatac
    97861 ttgccagccg ccggccgcca gcagagagag gaccggctcg acccgccgca tgaccgcacg
    97921 ccagcgctgt gctcggcgcg cgcgggctgc gcgcgcctta tacaatgctc cagtcgacgc
    97981 cgccccggcc gtgctgctcc aggaacgcgt tggcctcggc aaagtgcgtg cagtgaacga
    98041 agggcgctcg tgacagcggc gaggggtggc tgtacgtcag cacgaggtgc cgcttcccgg
    98101 ccgccccaaa ggcccgctgg gcgtgcgcgc cccagagcat gaacaccagc gggccgctct
    98161 ccgcgctcag gcgggccagt accgcgtgca ccagccgccc ccagcccagg ctagagtgcg
    98221 agcccggcgc cccgctccgc acggtgagcg aggtgttaag cagcagcacg ccgcggcgcg
    98281 cccagtcctc taggcagccg tgcgacggcc gcggagctcc gggaaagttc ttctgcacgg
    98341 cagcgtagat gttctggagg ctgggtggga ccggaacgcc gcggttcacg ctaaaagcca
    98401 agccgtgggc ttgcccgcgg ctgtgatagg ggtcctggcc cagaatgaca accttgatgt
    98461 cctcgggtgc cgcgtaacgc gtccacgcga agatgtccgc tttcggaggc agcacttgct
    98521 cgacgcggct ccggcgctcg tattcgcgca gcgcgtgtcg cgtgtagggc atggccagct
    98581 cgggttccag cacgcgccgc caggcttcgt ggacgccaaa ttcagcggcg aatgcccccc
    98641 aagtaatggc acgctggtct tctagcgctg ttacgcacgc gggaagtcca ttggggcgcc
    98701 ggcgcttggg cggcgcggca ccccgcaagc ggggacaaag actttcggcg cgtttgggcc
    98761 gaagccgggg ccgaagccgg ggccgaagcc ggggccgaag ccggggccga agccggggcc
    98821 gaagccgggg ccgaagccgg ggccggggcc ggggccgggg catcgctagc ggtagatgcc
    98881 gtcgccaggg ccgcagggac cagtcgtgtg gtatcggggc ggcaggacgc accctcgcgg
    98941 cggcggtggc agcggcgcgc gaacttcgtg cggcaagccg aaggcgctat tgaggacttg
    99001 gatggccaag tctcgataca ctggagtgtc ggcaagcacc cgccttatat cttcagcgag
    99061 cccacgcgcc acggcgtagg ggttggccca gtacgtctcg ccggtgtcct cgtaccacag
    99121 cgctgcctcg ggcggcgagc accgcccgcg gataaaaatg cccgccaggc ccggggccgc
    99181 ctcttcgtgc tggggcctgt ctgcgagcaa taagttgccg cggcaccgct cagccaagat
    99241 ggattctgcg ctatccgcgc gccttgtggc gccagccggc gggagccaca gcagcgccgc
    99301 cagcagcgcc caggcgcaag cgcgcgcgac cgccggtgcc atgccgctcg ttgtcgcagc
    99361 cggcgcggga gtatatttgc gccggcccac atgcgatgta tatatgcacg cccatcgccg
    99421 cccgccgggg gccgaagcta aagggtgggc ggccgggcgg atcttggccc ctgcgaccca
    99481 gcctagcaca cactgcgtgt gtgtagggga gaagccgcag ggtacgcggt agccgcatac
    99541 gctgcgccag cgtgggagtt gcgcagcgcg ccgctcgggg ccaagatcag cgcgatccgc
    99601 ggaaattagc ctggagtttg cgccgagccc cgcgccgcgc gctttcgttt gcgatgtacc
    99661 gcagccttgc gccggcgccg ctccaaagcg cgcacgccaa gcttggcgcg gggctgcagt
    99721 ccggcggaaa aatacaagcc ccggcgcgca cgccgagcat aacgcgcgcc ggaccccaaa
    99781 ggctggcttt gcggcgcgcg gcgcgggccg ccgtaaagtc agcgcgatgc gcaagccgct
    99841 gcgcgggtgc gttggccggc ccggcagtga gccgccgcgg ctttgggcgg ggggcagcgg
    99901 cctgtggtgc ggggtcggag cggccggggg ccgcttagtg ctttgcgttg cccgcccccg
    99961 cccacgcacc gttcttatgc cagcgtttgc accccggcgc gaacgctcta ccctcctccc
   100021 tcgaggcagg cgcaacggac cccgcccagt ccatcccact tcgcacaatc gccaaatttt
   100081 tgtccattag ctaaaagtat ctccggccat aatcgatgtg tctgagaggg taataaaaca
   100141 cacccagacg ctcggcactt agctctcgag tgattgcctg gctgcttgcc ccgtttgcgt
   100201 ggaatgaggc caaacaagca tttggcccct gtttgtctag acggggcttt gtgtttttcc
   100261 cacccctgcc cttgcccctg gccgcctggc cggccggcta aagtataggc cagaccaaac
   100321 cccccgcagc agctctgctc gctggcgaga ccccaaagcg ccaattgtgg catatttccg
   100381 ggtctgaccg cgcctgcact tgcctttggc attaatattt cagagtttaa tattacagac
   100441 agacaaaaag ccagataatt acaaagtatt tgtttttatt gattgcgcat gcgcgacctg
   100501 ggccataaaa gccccgcgca tgcgcgagca gttactttcg gtttggggat gacagcggcg
   100561 actgcggctc gaaagttaag tatgcaggct gggggtcgca aatacacggc ggtgcggtgt
   100621 ggtgggctgc gggtcgcgga gtgggtgggc ggggagccgg ccgcggcgat tattgccgcc
   100681 aggcgctgcc gccgctgcag cggccgagca gcccggccag gctcgggccc tggcgaccgc
   100741 ctggctgcgg cgccagggcc gcgctgctgc ggcggggggt ccccaggagg ctttctcgca
   100801 cccaggcggc cacttccatt tcggtgcgcc gcctcttctg cgccgagctc tcggggccgg
   100861 ggtccaggtc gccccgcgcc atggcgctcg ctggccttct ctcccggccg gggttgccat
   100921 tgcggccgac ctcggcccgg gcggctccgg ccagggccgg agcgccggcc cgccgggggt
   100981 cggcggcagg ggcgcggccg gcgggagacg gggtcggggc tcgggtggaa atagccgcgg
   101041 cggtgctggt agccgccgcg gtaacagcgg ggctcggcgc cgagctccga gcgacggaag
   101101 gtgccgccgc ggcggcagtt actgccgccg ccgcggccgg ggtcccaatt tgcgcacccg
   101161 ccgaggccgg ccccggggcc gccgcggggg ccgggtcggc ggggcgggcg ggcgcgttcg
   101221 ccgtcaggtc tatcactgtg gagatgggcg cgggggctgg ggccggggcc ggggccgggg
   101281 tcggggcgcg gtctaactct gtccttcttc tccggcgggc ctgcacacgg ggaggcccag
   101341 cctccccgag cagcctggcc cggcgctccc ctcgtccctc ctcactgccc gccccccagc
   101401 ccgcggtctc tcccgccgcg actcccaagc ccgctcccct cccctcttct ctgggctcgg
   101461 ggctgcatgc gcgcgcttgc gccgcggggg ctgcccgcgg cgccgccggc aatcgggggt
   101521 ctcgtctccc gccgcggctc cgagagctgg ggggcgcgga aactgccgcc gcgcggccgc
   101581 aagggcggcg cgctagcgac cgaggcgccg gctgcaccgc gggtgtttgt cgacctctag
   101641 tgctgacata ctgtctttcc gcaggccgcc gagcccgggc cgcgccagac gccccccgcg
   101701 tgcgcctcga ctcaacctcc gcgtccgtct ccggctccgt ttccgtgtcg tcaatggcgg
   101761 tcaggtcgga ggtgctgagc cccgacgacg actcttctga ctccgaccaa gagtcgtcct
   101821 ccgagccctc cgagtccgag tccgaggtgt cgagaaacac caccccacgg ccgccaggag
   101881 gcgcagactg ctgagggatg aggtgcgagg ggcccaccgt cacgcagcgc gccgccacga
   101941 acaacaggct gcgcacaaac gcgggggcgt cgtcctcgcc aatcaggggc tccatcgcgt
   102001 cggccagccc gtcgtcgtcg aagccgcact cggccagcat cgccatcacg tagtccgtca
   102061 tggccgcgag ctcgcgggcc gtcacggcaa agctgcccac cagagcgccc tcgacccact
   102121 ccaccacccg ccgcaggtac ggggcccccg gcccatgctc cggcgtgttc ggcagcaagg
   102181 gcaggcgcgg gccgcgcgcg acccggtcaa taaactcctg cgccgcgtcc gcgcctcgcc
   102241 ccgcgcgccc cccggccgct ccggccgccc tgcccgcccc ggcgcctctg gcctccccgg
   102301 cctcctccgc ccccccggcc ccgccgccgg cctcgctccc gtccgcggcc ccggcttccc
   102361 cgccggcccc cgaggcctcg ccgtcggccg ccgtgaggtc gatgggcccg gcgtcgtagt
   102421 cctcgcccca gatgacggcc gcgtccggct ccaacgcgcc gtccgccccc ggccctcccc
   102481 ccacagggat ctcctcgaag cactcatccg aggcgacgct gtggatgaga gactgcacgg
   102541 gcgccttgca cagcgggcag gtcgggcgcc cctccagcca ccggcggatg caggccaggc
   102601 agaaggcgtg caggcagggc agagcgcgcg ccgcgccggt gatcgcgtcc aggcagatgc
   102661 agcacgatcc cagctctggg gcagcggcgg gcggcgccat cctgctgggc gacacaaaca
   102721 acagaccggg cgccgctata tacgcgcgtc tcggggtgac gcgccgggag cggccgcgag
   102781 ggcggggggg cggggcgggg gcagggcgcc gggcgggcgg cgaaaggccc gcaccccccg
   102841 gctgccccaa ggcgaaaccc cccacgcaag gcgcgacgcc cgcgacgccg gcgccccccc
   102901 gcgcgggggc tgggccccct ccgcgccgcg ccgcgcgggc cccctgcgac cccggggggg
   102961 tgtttttggg ggggggcgga aatttcggcg cggcgggccc gggcccgctc tgggctccgc
   103021 ccctgggtcc ggcgccccgc gccccggccc cgcccgcggg cctcgggccc cggccggggg
   103081 gccggggttc tgcgtcttgg cccccggggc ccccgccccc gcccccgccc ccggcgcccg
   103141 ggggcccgag cccgggcctc gcgccccgac gcccggcgcc caggggcccg agcccggggg
   103201 ccgccgagcc cgcgcgggcg ccgtccccgc gccccgccgg agcttcgcgc tccacgcccg
   103261 cgtccctccc gggcttcgcg ccccggggcc cgccccgcgc gccgcgcgcc ggaccgcgct
   103321 ccgaccgaga ccgagggccc ggggcgggcg ggcggcggcg gcggcggcag cagcggcggc
   103381 ggcggcggcg gcggcggcag cagcggcggc ggcggggcgg ccgcgcgcca acccccctgt
   103441 ccgcggaggg caagtgcccg acgcggggaa cgtggcggcg gacgccagcg ccgcgtctcc
   103501 ggcgccgggt cctggccctc cgcggccgct ccgcagcggc gcgcggcccg cgcctccccc
   103561 cgcccccgag gcccgacaat gaagaaagag ccgcactcgg accgcgtgtg ttcgcacaga
   103621 ctcgtcttta ttgccgccgt cgcgccccct ccctcccttc ccgcgggccc ccctagggcg
   103681 aggccggccc gccgccggcg gcgccggcct cgtcgtcgtc cgacgaggcg ggggacgacg
   103741 ccgcggacga ggacgaggac gaggaggagg aggaggagga gagcacctcc acgcgcggcg
   103801 gcggcccgcg ccggggccgc cgcggccgcc ggccgccgcc cgccggcgcc gggaagcccg
   103861 agcccgcgcc cggggacgac tgcgccggca cccgggccgg cggggcttcc gccgccggcg
   103921 gcggcacgcg ctccaccagg ccgccgcccg cggcgcgccg cagcagcacg agcgtctccc
   103981 gcgggccctg gtccgcgtcc cagtccacgc cgggcgccgc ggccgcgggc ggcgccgccg
   104041 cggcctccag caccagcggc ggcgcctcgg cgcgcggctc cggcagcgcg gccgcgcaga
   104101 aggccaccgc cgcggccggc agctcgtcgg gcgccagctc cagcgcgcgc cgcccgcagg
   104161 ccaggtacac cggccgcagc ggcgcgccga gcccccagcg gttggcggcg cggtggctgg
   104221 ccgcctcgcc ctccacgaag tccggctccc cgagccccag cgccgcgccc tgcgcggcca
   104281 tgtccttgcg cccgtcgagc gccggcagca cgcgctgccg gtactcgcgc ggcggcacgg
   104341 gcaccgcggt gcgcgggccc aggcgcgtgg ccaccgtgta gcgcacgttg ccgccgcggc
   104401 agagccgcag cggcggcgcc tcggggtaga gccgcgcgta ggcggcctcg gcgcgcgcga
   104461 aggcgcccgg gccgaagacg cgccgcgagg ccagcacggc gcgcgccagc gcgccgctcg
   104521 ggccagcgcg cggcgcactg cgccgcggca gcaccgcggc gcgcaggtac acgtgcgcct
   104581 gcccgacggc cgggccgtcg cgcggccagt tctcggggtc cacggcgtcg agcacgatca
   104641 gccgccgccg cgccgcggcc agccgcgcgc agaggtactc caccgcgccg cggaaggcca
   104701 ggtcccgcgt cgagagcagc agcacgccct gcgcgccgag cgcgctcacg tccggcgcgc
   104761 ccgtccagcg cccggcccag gcgtgcgagt cggcgctcag cagcagccgg ttgcccagcg
   104821 ccgcgagcgc gtgcgagagc ccgccgcggc gcggcggcca ctcgggccgc cggcgctcgt
   104881 cctcgccggg cggcgccgcc agcgcctccc cgggcagcgg gtcgtagagc accaccacgc
   104941 gcacgtcctc ggggtccgcg atctgcgaca tccaggccac gcgccgccgc agcggtggcg
   105001 gcgagcgccc cgcggggccc gcgcggcggc gggccgcgat ctcggccagc gcctcggggt
   105061 cgaaggcgag cgccgggcgc cagggctcgg ggaagagcgg gtggtccgcg agccgcgccg
   105121 cgacctcggg gcggcagtag gccgccagcg ccgcggcgct gggcgcgggc gtgtggtagt
   105181 ccccgggcgg cacgcggcgg aagccgccgt cggcggcggg gccgccgggc ggcatgggcc
   105241 ccagcacgcg ggcgggcagc ggcggctccc gccgcgccgg cccggccgcg tcggcggcgg
   105301 cggcttttcg ccggcgcctc ggcccagagt cgtcctcccc cgaggggccc cccgcggcgg
   105361 ccggcagggc cgccgcctcg ccgtccccgt ccccgtcccc ttcttcctcc tcctcctcct
   105421 cctcctcctc ctcggccctt cttccttccc tcggacccgg cggcgctccc gccgccgggc
   105481 cggggcggcc ctcttcctcc tcttcctcct cttcctcctc ttcctcctct tcctcctttt
   105541 cctcctcttc ctcctcttcc gcctcttcgt cctccccgtc ctccccgtcc tccgcctcgg
   105601 acccgtcctc cgggtccgcc cgcggcgccc cggccctcat gtcctccacc tccacttcca
   105661 ccggcccccg gcccggcgcg gcggcgccgg cgccggcgcc cccgccggcg gcctccaggg
   105721 ccgcgagcgc ggccgccagc cgcgccggca cctccgccgg cgggctgaac agcgcgcgcg
   105781 ccagcgccca ggccgacgcg cgggccgccg cgccgcgcgt cgagtaccgc gcgagcgggg
   105841 ccacggtccg cgccgccagc gcggccgcct ccagcgcggc ggccgcctcg gcgcgcagcg
   105901 ccgccggggc cgcgcgctgg agccgcgcgc gctccaccgc gtcgcgggcc gcgccgagca
   105961 gctcggcggc ccggagcacg cgctccgggt gcgccgccag cgcgtccggc gcgcaggccg
   106021 cggccggcag gccgcggccc gccgcggccg agagcaccgg gagcccggcg gcgccggcgg
   106081 cgcggcgggc cgcctccagc gcctcgcggc aggcgacggc gcagcggtcc gccagctcgc
   106141 gcagccgctc gcgcgccgcc cgcgccgtgc tcgccggcgg caggggcgcc ggcgccgcgc
   106201 ggccggcgag cacggcgcgc agctcggcga gcgcggcgcg ggcgccgctg ccgccggcgc
   106261 cggcctccgg gtaggccatg ggggcgtacg cgcgccgcag gctctgcagg aggaacagct
   106321 tctggtcgca gtcgtagcgg cggctcatgg ccacgcaggc cgccacgtgc ggcagcgccc
   106381 acagcgcgtt ctgcgcggcc atggcgtccc cgaccggcgg cagcggcgcc gtcacgctcc
   106441 cggtgatgaa cgagctgtgg ccccggcagc cctgcacgcg ccgctgcagc aggcgcgcca
   106501 gctgcaggtc cgggcccgcg agcttcgcgc tctgcagcca ggccatggcg tcgcggcgcg
   106561 cgtacaccag gtccaccagc gccgcgtact gcttccccgc gtcccccatc tccggcacga
   106621 acacggccgc gggccccgcg gccgccgcgt agcgcgcggc cgcctcgcgg atctcggggc
   106681 agtcccagag gccctcgcgg gtgtcgcccg cgccgccgaa gcgcacgcgg ccgggcggcg
   106741 gcggcgcgct gccgggccac gcctcgccag aaggcgtcag cagcgggccc tccagcggcg
   106801 gcggcccgtc gcgcggcgcc gcggcgtagc cagcgcgggc gccggttgcg cgcccgcgct
   106861 ggcgccgcgg cggggggggc gccgtctccg gcggcgaggg cgccgggggc ccgggcgcgc
   106921 ggccccgcgg ggcgccgggc ccggcgcccg cctctcgcgg ggccgctttg gttctggtcc
   106981 cggccccagt cccggcctca gcctcggcct cggcctcagc gtcggcgtcg gtgctcccct
   107041 cccgggcctc gcccccatcg tcctcgggcc cggcatcgct gcagtcctcg ggcccgctgt
   107101 cctcggaccc ggcgtcgctg cagtcctcgg gcccaacgtc gccggcctcg gtcctggccc
   107161 cgagggcacc gccgcccccc gcctcagtcc ccgcttcggc cttgaggggc gccgcccccg
   107221 cctcggcttc gatggcggcg gctatgacgg ccgcttcggc cgcggccgcc tccgccccgg
   107281 ccgcggccgc ctccaccgcg accgcgagcg cgcgcgccgc ggcccaggcg ctgtccgcgt
   107341 cctccgcgcc ctccgccccc tcggcctcgg cgcactccgc gacgtccgcg tcctcggcgc
   107401 cccccgcgtc cctggcgccg gcgtcctcgc cgatctccgc gtcttcggcc tcggcgccct
   107461 cggtggcccc cgcgtctccg gcgccgtcgt cctcgctgct ctccgcgtcc tccccgccca
   107521 ccatccgcca cagctcggcc agctcggcgc gggcggcccg ccggcgctcg cgcgcctcag
   107581 cccgacgcgc cgcgtcgagc agggccgggt cttcctccga gccccccgtc gggccgaggt
   107641 ccgcggactc gatgaggtcg tacaggtcga gcgtggccag ctcgagcctg ccgggcgacg
   107701 acatgaccgg ccgtgggtgc gtgcggtggc ctgggggaga cggggtaggg gggcgggtgg
   107761 gtcggccggc cgtcaaaacg caggggaggg gggggggcgg cgggcagcgg cagggccccc
   107821 gcgccgctgc gaacgacacc gaccgcgccg gcggcaacag cgcccccccg agcaacctcg
   107881 ctatcgcgcg cgccgggggg gcagctgggg ctgcggcggc cgcggcaaag cgcggcggcg
   107941 gcggcgcgga ggggaagctc gggcgaccgg cggcggctcc gacgggacgg acggcgggcc
   108001 gggagcgggc ggcagtgcgg cgccttctcc ttccccttcc cctccttctc tttcccttcc
   108061 cttccccccc cccaccccca ccgcgcgtgc cttttttttg ttttaccgcg gcgcgggaga
   108121 agccctcgcc ggctctctcg ccgcggcggc cggcggggcg cgcgcggcaa agggtttgcc
   108181 tgcgtctcac ctttagatcc ggagacccgg ggacgggggt acggcgagcg cgacggcgag
   108241 ggtcctggca gaaggccggc cggtcggagc tggctagccg gccgcggctg gatgtctgtc
   108301 tctctggctg gccggctttc tgctccttcg tccccgctgg ctcttccttt tctcgctcgc
   108361 tccccctgcg tgttgcccga cggcggtggc ggccgcgtct ctctcctttc cccgcgcctc
   108421 tttcttgttc cgcgggcttc tttcttggcc gtctcctcct tcctcgcacc ggcggcggcg
   108481 gcagcagcgg cagcggcagg tgttgcagta cgggtgtcaa aaagcgcgcc gcggcggagg
   108541 tacagtcggt ggcgacggtg ctcgccttat agaccctttg aaggcccgcc caggcgcgaa
   108601 ggtgggccgg ccggggccgc ccagacccgg cagttcaggt gcgcctggga gggcttacct
   108661 gcccgcgggg cggttcgccg ccaagctcat tataatagga gcggctgtcg gggctcattt
   108721 gcatgaaagc atggccgaac gcccccggcc ccgcgcccgg caggcccgcc ttgcaccagg
   108781 cccgccccta ccagttcccc tccccattcc cgcccctgcc tcgcgcgcgt tggtctggca
   108841 gccgctaggc ggatgggcgg cggacgacgg gcccgcccgc tgcttctagc ctcccctcct
   108901 tcccctttcc cccttcttcc ctgcttgctc acggccgccc ctcacccttc tccctttcgc
   108961 gattggcggg aggaccccgg cggtgagcaa gcagggaggc gcggcaattg tgtccaggct
   109021 catttgccta ccccctcccc attgggactc cccgcttccc gcccaggacc ccggcggtga
   109081 gcgagcaggg aggcgcggca attgtgtcca ggctcatttg cctaccccct ccccattggg
   109141 actccccgct tcctgcccag cgccactgct ccctccgccc ccagcattgc cttcgagcgc
   109201 gccttttgct tttgcctatt tgcgcggcat ttagttttgg tggttggccc tttttgtgcg
   109261 cgcctgcgcg cccgcccgcc cgccctggtc tgaccgcccg cggccccctt tggccctagc
   109321 cgctccattc tctccacggc caccaccccc ctccccctcg caccccgcac cccgctcctc
   109381 ctcccttgct gcatttgcga gatcgccaca cagtgtacca gttgcctccg ggcgtgtgtc
   109441 ccaaggggaa aaagcctggg ccacagccgc cggtgcgagg gcgcgacctg ttctaaccgc
   109501 aaattactcg ccgcggccct gcctccctac ttttgcctgt gtgaagggcc cagccgcggt
   109561 gccttatgcg aggaacacag tgttccttca agcctgtgct agcgggggga gggaggagga
   109621 ggatggggag gaggaaaaag gagcagcaga ggcgaaaaga aaacggcggg ggaggaaact
   109681 aaccgtaacc tgacaacccc cctttttttt aaaaaaaaaa actaaaaaaa gggggagcaa
   109741 gcaggcgcgg cgataacaaa agcggggagt tggggggggg ggcggcgctt gctttggccc
   109801 gccttgcgct tttgcatttg gctcgcccct gcccggttta atttgcatag ccccctggcc
   109861 cgcagtgctt ccgcggtccc cctccgccct gccgccgccc cctgccatca gcttgccggc
   109921 gtgggtagtt tgtatatgca cacccgcgcc cctgtggacg accaccgcag cttcccaccc
   109981 cgctgctaac ccccttaccg ggcatacccc cagcccacta tcccgtgtgc ttgcatgcaa
   110041 gccgcagccc accttgccgg tcttgccccc tccccttcgg gcgtgtcgcg ctcgctcgcc
   110101 cgggcggttc atccgcttcg gctttaggca gccgcggccg ccgcccgctc tcttctctct
   110161 gcgctcgctt gctcgctcag cttgcctttt ttccccctcc ccccccccat cgttccttgc
   110221 tccgccttgc ggtttagctg tgtaagtgca cagagaggcg gggcgaaaca aaaaaaagat
   110281 ctgtattgat ggctctgttg ctgcgccacc tgccgggcaa gccgccgcag ctgctgtacc
   110341 tttatggggg gggggggggg ggggcgtact tgcagcggcc cgcacccttt ttgggtgccg
   110401 ttattttgcg cgtcgccacc agatggcgcc atccccctcc cactcgggtc gtagcccccc
   110461 tgagtttcta ttcgtccttt tgtgcccccc cccctcccct cccccctgtt gactcgggcg
   110521 cggctggatt gatgcggggt ggggtggggg ggtgggtggg ggggtggagg gaccacagag
   110581 aaggatatcg acacacagtt tcggtcaata gatgatcaat agctgaaact ttaaagtcca
   110641 atcggcgaaa ataaatatcg gcgagggtcg atcgattaac ggggcgcata tgcggccggt
   110701 tgtacaattg gcaatcgatc taaccgatat tgatagattg gtatcgggcc atcagattaa
   110761 atcaatacga ttgatctgta agcgcgatcg atgtatcggg ccgtttgggc cgccagaccc
   110821 aaatcgattg gcggatcgat tatgaagaaa ggaagaccct cccgcgcgcg ccgcgccgga
   110881 gttcgcgcca tgcgggtttt tagggccctg ctcgggcccc ccctccactt ggacatcgcc
   110941 cccgcgcggg caaaaaatcc aatggcggat aatcgagagc tattgtattt ttgcgccagc
   111001 gggggggcct gtccaccacg gcgaggcgcc gacccacgtg gccccgtaca accgcggggc
   111061 gggcgggccg acgagcctcg cggggctgct tggctggcct ccagcgttcg cacaaagctc
   111121 aataagttta tatatatatt attggcccga gtgcgagccc tgggacccgc gccagctctc
   111181 acgaccgtgc ccgtgagaac gctggcagaa tgccagcgtt cgcacaaaac tcaataagta
   111241 tatatatatt attagcccga gtgcgaattc tgggactggc gccaagccgg cccatggcaa
   111301 ccaccaacgc cgggtttcga tggggctgcc gggatagcgg gagggcatat gcaaatcatg
   111361 tcgggtcgga ggcggcgccg ggtcggaggc ggcgccgggc cgggggcggc gctcggccgg
   111421 gggcggggcc ccttacgtgg gccccctggc attctgccag tgttctcacg tggggtcccg
   111481 agagggctac cgggacggtg ggagggcaca ggcaaatcag gccccgccag gggcggcgct
   111541 cggccggggg cggggggagg agcgccctac tcaaagacat ataagcgcgc gacatcgcgc
   111601 cccaagccca cacacggggg gctagaggag gggggcgcac tgcagaacct tcaccgaggc
   111661 ccagccccgg caaaggcaag gtaagcgcat ccgccccggg gccggggccc tttttttttt
   111721 tttttttttt tctcgctcac ccccaccccc acccgagctc gagcgaacgg cttcctcgag
   111781 ctcaggtggg ttgcttccat aggaactcgc cgacgacccc ggacgccccg ccgacgaccc
   111841 cggacgcccc gccgacgacc ccgccaagtg agctccgccc acccagcccc caccctcatc
   111901 tcgggcccgg gggcgggcag acgggggtgg gggctgggtg ggcggagctc actcgggacc
   111961 ccacccgagc tcctgtgctc cgcccccccg tgcagcgctc cattgcagcc ggctcgacga
   112021 gcacctccag gaaccgcgcc tcgactgcac ctagggacct gccgcaaggt tagcccagcc
   112081 caccccagcc cagcccagcc caccccagcc cagcccagcc caccccagcc cagcccagcc
   112141 caccccagcc cagcccaccc cagcccagcc caccccagcc cagcccaccc cagcccagcc
   112201 caccccagcc cagcccagcc caccccagcc cagcccagcc cagcccagcc caccccagcc
   112261 caccccagcc cagcccagcc cagcccagcc caccccagcc cagcccagcc caccccagcc
   112321 caccccagcc cagcccagcc cagcccagcc caccccagcc cagcccagcc atgctcttgc
   112381 agaaccccgg cggcgacccc ccagagctga aacccaggac cgcgccggtg gaccagggcg
   112441 acattgcgag gtaagccagg ttcccctcgc cccccatccc catccccccg atccctcgcc
   112501 cccatccccc cgatccctcg cccccatccc cccgatccct cgcccccatc cccccgatcc
   112561 ctcgccccca tcctcccgat ccctcgcccc catccccccg atccctcgcc cgcccggggc
   112621 aagcccgccc tccccggacg cgccctgcgc ggccactcgc ttgccacgcg accgggcggg
   112681 ccctgccccg gggcgcccgc ttaccgctcc tcctcttctc tgtcccgccc cctttgtccc
   112741 ggcagaccgg cccggcccgc cgccgccatg agccacggcc agccttgccc cacctgcgac
   112801 ggctcctgcc gcctctgccg ctcgcccgac cgcgtggtct cgggccccgc ccccgcggac
   112861 gagcacgctc gccgcggccc gggcgccttc tgccccgagg actggcgccc cgaggcgctg
   112921 cgcctcgcca tcgacgtcaa caccctcttc cgctgcatcg ccaccggctc cgcgttcgtc
   112981 acggccgaca cgcgcgcgct gcgccgcgcg ctcgtcggct tcttcctgct cggctacacg
   113041 ggcgccacgc ccacggacgc gtgctgggag gcgctgctgc agctctcgcc cgagcaggcc
   113101 ggcccgctgc gccggctttt gcgcgccgcc gccgccgccg ggcccagggc gcgcccgctg
   113161 tcgcccccgg cgcgcctgcc gggcccgctt ttcggagccg agtgcgacgt gagcggcagc
   113221 gactccagca gcgaagacta cgaggaggac gaggaggcgg acgaggaggg ggaggagaac
   113281 ggcggcgagg gggccgccgc cgaaagcccc ccccggtgcc gcccgcgagc cgcggtcctc
   113341 tcctccgcct cgcccgcggc ctcggccgtc tccttcgtct cgtcgcccac cgcgtcctct
   113401 tccacctcct cgtcgtcgct gtcctcgttc tccgcctcgg acggcgacga cgacgtgttc
   113461 ttccccgggc ccggggaccc gcgcccggcc ggcgccgggc ccggcgccgg cggccccccc
   113521 gcgcgcgcgg gccggcgccg gcccgcgccc tgctggcgct ggtcctccgg ctcctcgccg
   113581 ggctcctcgc catacccgtc gccggggggc tcgccctccg gtcgcgcccg ggcgcggccc
   113641 gcgccggcca agcgccgcca gcgagtttag gggggcgggg ccccgcggcc ccctctcccg
   113701 ccctctcccc ggcccttgtc atattttttt aaataaaacg ccgcgcgcag gcgcgccttg
   113761 cctctctata tcttgtggtt ctagttgttt tattcgcccg cggggcggga gggggaaggg
   113821 ggagccggag ctttggcccg ctcgctcggc cggcccgaat cctcggccgg cccgaatccc
   113881 ctccttcccc tccctcccct ccttcccctc cctcccctcc ttcccctccc tcccctcctt
   113941 cccctccctc ccctccttcc cctccctccc ctccttcccc tccctcccct ccttcccctc
   114001 cctcccctcc ttcccctccc tcccctcctt cccctccctc ccctccttcc cctccctccc
   114061 ctccttcccc tccctcccct ccttcccctc cctcccctcc ttcccctccc taagaagaca
   114121 ggcgcgggcg tgcggaaaaa attagacagc ctttactcgc gggcggacgg gggggagggg
   114181 ggaaggggac agtcgggccc cgccccaggg cctcagggcc gggggtctcg gggcaagctt
   114241 gctcgcacgc gcgctcggcg tgagttcgca ccagcatgca gcggcgcgcg ctcactgggc
   114301 gctcgctcca aacgcagcat ccgcgtgtca atcagctcaa aacagtcctc cgtgtagcgc
   114361 tcgcccgcga cgcgctcgct gcccagccga agtacatatc gacgatgtgg caggggcgtt
   114421 cttgccgggc cagggacttt cgctctgagc tcgcgctgga aagcgtcggg gagccgagta
   114481 aagtactggc tcatgtttcc cacgggcagg gattgcggat ccacgtcggc gttgaggtag
   114541 aagcggtccg ccagcggggc ctcgtcctcg tagcactcgt ctgggaagtt gtgcggaagc
   114601 ttaacgaatg ttccgtcgta aagctgacga aagaactgca gcggtcggcg cggcgcggga
   114661 acacattcaa agtgaactgc gcccccagtt cggtcgggac tcgcgccggg agcgggaact
   114721 ttcaccagca ggggcttgga cgagggcacc accggaaaat agtccggcgg gagcatagca
   114781 tacaggccgt cttcttgctc gtggcggcac gccttaaaga gtcgccagcc accaagcccc
   114841 ccctcgcatc cgggaccggt gccggcggtc gcggtcgcgg tcgcctctct gctcaacggc
   114901 actgtgctga tcaccacgcg gttgggggtg ccctggcggt acatggtccc tcggcgcggt
   114961 cacaaagcaa atgaccaaac gccggcgctg ggtgcggcct ttaaaggata gcacatggcg
   115021 cgcgcggggg cgagcccctg gggcacgggg gctcgcgttt ggcggggcgg ggcgccgccc
   115081 cgcggtctac gacttcgtag accagccgga aaaggacacc accggccacc agctcaggga
   115141 gtgtcggggt atcgtagggc ggccacgggc tagcgatggc cgggccgcgc cgcgggagcc
   115201 gccacgccgc tcccgcaaac gtacagtcca gctgcgcgta aaccaagcgc gtcgtggcgg
   115261 caatgtgcgc aaaaataggc gcgtacaaat cggcggcgcc aaaaacccac atgtggaagg
   115321 gccgagccct cgcgcggccc gagttcagca agttgtagcc gtcgaccacg ctgacccact
   115381 ccgccggttg gcggtggcgg gctaagccgg cgcccccggg cgcgggccaa gggcgctgtg
   115441 tcgacaaaag ccaccccgcc gctggcgttg acgttgacgt cgacgtgcag cccttcgccg
   115501 tttttactag ggcgtgatcg aagacaacga ccgtcgtccc cagccggctt gccgtcagcg
   115561 cccggctctg ctcggcaagg aaacgccaca cccgcgcggg cacgtctggg cttgcccctg
   115621 gaagggcgcc gcgcctatcc gcacacgtga ctatagtcac catggcgacc gccacggcaa
   115681 cgcttaagta cgggccgcgg cgatcgcggg cgtcgatcgc gtgcggcttg gagtccggct
   115741 gccgtttctg ccgcaagcgc gatcccgcga cacgacccga cgttcttggg cacccatgga
   115801 gcgcgcggcg gagcggctgg cccggcagcg ggcgcgcggc ctttggcgct cccgctttgc
   115861 ctgctgcgtc gccgcggagc cgagcgggga gccggctcgg ccagagcgtt cgcggagccg
   115921 ctgcggctcc gcgcgctgcg ctgcggcggg ctctgcggat ttatacttgg ccgtcaacaa
   115981 cgagggaccg gaggtcgcgc cgccggccag aaccggtccg ccggacgcgg acgggatcga
   116041 agggggggct gccgtcggga acgagcaggg aggggtcgcc gctggaaacg agagaagagc
   116101 tgccatcggg gacaaaaaaa aaagcgcctc cgggggcgag aatgagagcg aaagcgagag
   116161 cgaaagcgag agcgaaagcg ggagcgaaag cggggccgac gacggcgact gggacgacga
   116221 tgacgacgcc gggcctgccg gcggggtcac gcgcgaagag gccgagggcg ccgcccgtgc
   116281 gctaaacttt cgcattatcc ggcggttgac ccccggctcg gagggacgcg tgtttgaggc
   116341 aacggggcct gctcccgcgc aggagcacgt ggtgctcaag atcggggcct cggcctctac
   116401 gctggccgag gctatgctac tgcgaacctt ggaccacgcc aacgtggtca agctgaaggc
   116461 cgtgctcttc cacggggagc tggtgtgcgt ggtgctggcg cgctaccgcg aggacctgca
   116521 cacgcacctc tggagaatca accgcccgct ggcgctcccc gcggcgctgg cggtgacgcg
   116581 ggccgtgctg cggggcctcg cgtacctgca ctcccgccgg atcgctcacc gggacgtcaa
   116641 aacggaaaac gtcttcctca acggcccagg cgacgtgtgc ctgggcgact ttggcgcggc
   116701 acacgggccg gtcaccgagc cccgctacta cggcctggcc ggcaccctgg agacgaactc
   116761 gccagagctg ctggcgcgcg cgcgctacga ctgccgcacg gacgtgtgga gcgcgggcgt
   116821 cgtcgcgtac gagatgctgg catacccgcg cgcgctgttc gacagccccg cgggcccgca
   116881 gggcgaggac gccgaggcat cgggcccgcc gacgatcttg ggcgaccgcg actgcgcccg
   116941 gcagctgctc cgcgtgattc gccggctggc cgtgcacgcc gaagagtttc cacccagccc
   117001 cactgaccgg ctgacccgca acttcaagcg ccacgcgagc acgcgccgag agccgcacag
   117061 cccgtaccgc tgcctggcgg tgctccggct gccctgcgac gccgaccgcc tcctacacca
   117121 gatgctgacc tttgactttc gcgcgcgccc caccgccgcg gagctgctgg agcaccccgt
   117181 cttcggtgcg gcctcggggt agccccgggg gtttcccgca aaactgaggc atataaggcg
   117241 cgggcaccgg caagtttggc atccacactt cgcgctgtgg acacgagagc gaacgcgagc
   117301 gaacgcgagc gcaagcgcga gcacacgact gcgatcatgc ctgccgcccg gaccggcacc
   117361 ttggccgccg tcgccctaat cctgctctgc ggggccgccg ttttggggcg ccccgcgccc
   117421 gacgacctct gtttcgccga cgtgcgccgc actggcatgg cgccctcccg cccgctgggg
   117481 cccgtcctga acctagcggc ctcggatttg acctcgcggg tttcggtgcg cgcggtggac
   117541 gcttcgcgcg gctgcgccct ggccctcttg gacatggcgg agacggtggt gcccggcgga
   117601 ccgcgagccg ccgacgtcgt cgacgtcggc tgggcttacc aagacgggga ctgcatggtg
   117661 cctctggcat atcgccagta ctttaactgc acggggggcg cgctgcccgg ccaaaacgtc
   117721 tgcgccgggc tctctgagac ccgcatccgc ggtggctttg gaacctccga ctacgcgctc
   117781 tacgggacgt cgctagtact gcgccccggc ctgtacgacc gcgggaccta catctacttc
   117841 cttggatacg gcccagacga catctacgtg ggcagcgtca cgctcatggt gggcgccgac
   117901 atccacaaat acccctgcgg gctggaccga gggctcggtg tggccctgca ccacaagagc
   117961 ggaccggccc gacctctgac agaggacgac gccaccggcg actgggcctg cggctgcttc
   118021 cccgcccttg ttgaggttga cgcggtgtgg ggcaacgtaa gcgccgcaga gctgggcctg
   118081 gccgacccga tcgactacgc cgacgaaggg ggtgaggtcg aagtgctcga ggacgaagcc
   118141 gggagcgcca gcggaaacct gccgcaggac gaccccgacc ccgacctcgc agattgccgg
   118201 accgtcgggc tctttagcga aagcgacatg ttccggaccg ccagcgggcc cgaatcgctg
   118261 ctgatcggcg ccgttgccaa ggacgtcctg acggtgcccc tcaatctgcc gcccggccgc
   118321 tcttacgagg ccctgcgaaa cgcatcgctg gagtgcaact cccgcccgcg cgagaccggc
   118381 gacgcagcgg tggtggtgat gtctctccag gagcccgctc gcctcgagcg ccgccccgat
   118441 gcccgcgcca ccgatccgga gtttgggctc tttggcctgc ccgatgaccc cgccgtgcgg
   118501 cgcggcattc tcatcggcct cgcgatcgct ctgctggtgc tgctgttttc gctggtgatc
   118561 gtgctcgtct gcgcctgccg gctcgcccgc gcagccaagg ctgcgcgacg cgcccgcgcc
   118621 gccacgttcg ccaagagcaa ccccgcgtac gagccgatgc tcagcgtctg atcgccggca
   118681 ccccacgccg ccccgacccc gctgtcccgc gtttacaata aacagttatt cttaccaacg
   118741 ttggtgcgcc tgtcgcgtgt ctattgcgag ttaaaccgag tgccccaccc aggcagggcg
   118801 ggggttgggc cgggccgcag ccccggctgg gtatatatcc ccgacgggcg actagagata
   118861 cactcgcccc gcgcggctgc tgcgagcggg cgaacatgca agggccgaca ttggccgtgc
   118921 tgggcgcgct gctcgccgtt gcggtgagct tgcctacacc cgcgccgcgg gtgacggtat
   118981 acgtcgaccc gccggcgtac ccgatgccgc gatacaacta cactgaacgc tggcacacta
   119041 ccgggcccat accgtcgccc ttcgcagacg gccgcgagca gcccgtcgag gtgcgctacg
   119101 cgacgagcgc ggcggcgtgc gacatgctgg cgctgatcgc agacccgcag gtggggcgca
   119161 cgctgtggga agcggtacgc cggcacgcgc gcgcgtacaa cgccacggtc atatggtaca
   119221 agatcgagag cgggtgcgcc cggccgctgt actacatgga gtacaccgag tgcgagccca
   119281 ggaagcactt tgggtactgc cgctaccgca cacccccgtt ttgggacagc ttcctggcgg
   119341 gcttcgccta ccccacggac gacgagctgg gactgattat ggcggcgccc gcgcggctcg
   119401 tcgagggcca gtaccgacgc gcgctgtaca tcgacggcac ggtcgcctat acagatttca
   119461 tggtttcgct gccggccggg gactgctggt tctcgaaact cggcgcggct cgcgggtaca
   119521 cctttggcgc gtgcttcccg gcccgggatt acgagcaaaa gaaggttctg cgcctgacgt
   119581 atctcacgca gtactacccg caggaggcac acaaggccat agtcgactac tggttcatgc
   119641 gccacggggg cgtcgttccg ccgtattttg aggagtcgaa gggctacgag ccgccgcctg
   119701 ccgccgatgg gggttccccc gcgccacccg gcgacgacga ggcccgcgag gatgaagggg
   119761 agaccgagga cggggcagcc gggcgggagg gcaacggcgg ccccccagga cccgaaggcg
   119821 acggcgagag tcagaccccc gaagccaacg gaggcgccga gggcgagccg aaacccggcc
   119881 ccagccccga cgccgaccgc cccgaaggct ggccgagcct cgaagccatc acgcaccccc
   119941 cgcccgcccc cgctacgccc gcggcccccg acgccgtgcc ggtcagcgtc gggatcggca
   120001 ttgcggctgc ggcgatcgcg tgcgtggccg ccgccgccgc cggcgcgtac ttcgtctata
   120061 cgcgccggcg cggtgcgggt ccgctgccca gaaagccaaa aaagctgccg gcctttggca
   120121 acgtcaacta cagcgcgctg cccgggtgag cggcctaggc cctcccccga ccgccccctt
   120181 tgctcctagc cccggctcct gccgagccgc gcggggcggg agataaagcg cccgcgcgtc
   120241 ggcgactcaa gccattgccg cgaccttgtc ctccggcgcg ctcgcgatgc ggtgcctgtt
   120301 gctctggatg gtggtgctgg ccgcgcgagc ggcgcccgct cgcagccttg tgtatcgcgg
   120361 cgaggcagtc ggcctgcgcg cggacggccc cgtagcgttc gctgtccacc cgaccgacgc
   120421 aacgctcgcg ctgcggggcc ggctgatttt cctggaacac cagctcccgg ccgggcggcg
   120481 ctacaacggg accgtcgagc tgctgcgcta ccacgccgcg ggcgactgct tcgttatgct
   120541 gcagacgacc gcgttcgcct cctgcccgcg cgtcgcgaac gacgcctttc gctcctgcct
   120601 gcacgccgac acgcgccccg ctcgcagcga gcggcgcgcg agcgccgcgg tcgaaaacca
   120661 cgtgctcttc tccatcgccc atccgcgccc aatagactca gggctctact ttctgcgcgt
   120721 cggcatctac ggcggcaccg cgggcagcga gcgccgccga gacgtctttc ccttggccgc
   120781 gtttgtacac agcttcggtg agcccggaga cccagaggcc gcggccgcgc accccggcgc
   120841 cgtcgaggca gtcgcgaccc gctgcgagcg gggcctcgac gccagctcgg cgagcctcta
   120901 cgaccgcgcg ctggcggcgt tccccgcagg cgccgccacc acgcccggcc ccaccgcgag
   120961 cagcgggagc ggggccgcga cgccggagag ggtcgacgag acgacggaag tcaaggccgc
   121021 gacgagagcg ggctcggcgt ttgccctcac cacgcccccg gccggcctga ccgccagccc
   121081 cgccgccagc ccctcccgtg cctttagcgc ggccgccccg gccgccgctg cgcagccggc
   121141 cggagacacg cccgctcgct tccggcgcca actggcgtcg atcctagtgc ctctgtgcgt
   121201 gctggtgctg ctgctgcttg cgctctgcgc cgcgacggta aactgcgcgc tgcgccgccg
   121261 cctgctgccg tgctctcggc gcgtttacaa gccgcggacg tgcgcgacat gcgggagcgg
   121321 cacttgcgcg gggcggcccc cctgccgcgg cgcggcaccg agcgccccag ccaccgtcgt
   121381 ggcactgggc tcccggccaa aggcgccccc cctcgccacc atcagcgaag aataaacgcc
   121441 gcgcgcggca aacgatctcg ctcgcgtgtg tcttggtttc tgcgcggcgg gcggggtggg
   121501 gagcgggcaa ggcggaggaa gaccgggggc aggagctgcg tggagggcgg agccgttgag
   121561 cggcccgacc gccgccgggt tgttaaatgg gtctcgcgcg gctcgtggtt ccacaccgcg
   121621 ccggagaacc agcgcgagct tcgctgcgtg tgtcccgcga gctgcgttcc ggggaacggc
   121681 gcacgcgaga gggttcgaaa agggcatttg gcaatgcaac ccaccgcgcc gccccggcgg
   121741 cggttgctgc cgctgctgct gccgcagtta ttgcttttcg ggctgatggc cgaggccaag
   121801 cccgcgaccg aaaccccggg ctcggcttcg gtcgacacgg tcttcacggc gcgcgctggc
   121861 gcgcccgtct ttctcccagg gcccgcggcg cgcccggacg tgcgcgccgt tcgcggctgg
   121921 agcgtcctcg cgggcgcctg ctcgccgccc gtgccggagc ccgtctgcct cgacgaccgc
   121981 gagtgcttca ccgacgtggc cctggacgcg gcctgcctgc gaaccgcccg cgtggccccg
   122041 ctggccatcg cggagctcgc cgagcggccc gactcaacgg gcgacaaaga gtttgttctc
   122101 gccgacccgc acgtctcggc gcagctgggt cgcaacgcga ccggggtgct gatcgcggcc
   122161 gcagccgagg aggacggcgg cgtgtacttc ctgtacgacc ggctcatcgg cgacgccggc
   122221 gacgaggaga cgcagttggc gctgacgctg caggtcgcga cggccggcgc gcagggcgcc
   122281 gcgcgggacg aggagaggga accagcgacc gggcccaccc ccggcccgcc gccccaccgc
   122341 acgacgacac gcgcgccccc gcggcggcac ggcgcgcgct tccgcgtgct gccgtaccac
   122401 tcccacgtat acaccccggg cgattccttt ctgctatcgg tgcgtctgca gtctgagttt
   122461 ttcgacgagg ctcccttctc ggccagcatc gactggtact tcctgcggac ggccggcgac
   122521 tgcgcgctca tccgcatata cgagacgtgc atcttccacc ccgaggcacc ggcctgcctg
   122581 caccccgccg acgcgcagtg cagcttcgcg tcgccgtacc gctccgagac cgtgtacagc
   122641 cggctgtacg agcagtgccg cccggaccct gccggtcgct ggccgcacga gtgcgagggc
   122701 gccgcgtacg cggcgcccgt tgcgcacctg cgtcccgcca ataacagcgt agacctggtc
   122761 tttgacgacg cgccggctgc ggcctccggg ctttacgtct ttgtgctgca gtacaacggc
   122821 cacgtggaag cttgggacta cagcctagtc gttacttcgg accgtttggt gcgcgcggtc
   122881 accgaccaca cgcgccccga ggccgcagcc gccgacgctc ccgagccagg cccaccgctc
   122941 accagcgagc cggcgggcgc gcccaccggg cccgcgccct ggcttgtggt gctggtgggc
   123001 gcgcttggac tcgcgggact ggtgggcatc gcagccctcg ccgttcgggt gtgcgcgcgc
   123061 cgcgcaagcc agaagcgcac ctacgacatc ctcaacccct tcgggcccgt atacaccagc
   123121 ttgccgacca acgagccgct cgacgtggtg gtgccagtta gcgacgacga attttccctc
   123181 gacgaagact cttttgcgga tgacgacagc gacgatgacg ggcccgctag caacccccct
   123241 gcggatgcct acgacctcgc cggcgcccca gagccaacta gcgggtttgc gcgagccccc
   123301 gccaacggca cgcgctcgag tcgctctggg ttcaaagttt ggtttaggga cccgcttgaa
   123361 gacgatgccg cgccagcgcg gaccccggcc gcaccagatt acaccgtggt agcagcgcga
   123421 ctcaagtcca tcctccgcta ggcgcccccc cccccgcgcg ctgtgccgtc tgacggaaag
   123481 cacccgcgtg tagggctgca tataaatgga gcgctcacac aaagcctcgt gcggctgctt
   123541 cgaaggcatg gagagtccac gcagcgtcgt caacgaaaac tatcgaggcg ctgatgaggc
   123601 cgatgcagcg cccccttcac cgccgccgga aggctccatc gtgtccatcc ccatcctcga
   123661 gctcaccatc gaggacgcgc cggccagcgc agaagcaacc ggcaccgcgg cagccgcacc
   123721 cgctgggcgc actccagacg cgaacgcagc acccggcggc tacgtgccag ttcccgcggc
   123781 ggatgtggac tgctattata gcgaaagcga cagcgagacg gcaggcgagt ttttgatacg
   123841 catggggcgg cagcagcggc ggcggcatcg gcggcggcgc tgcatgatag cagcggccct
   123901 gacttgcatt ggcctcgggg cctgcgcggc ggcggcagcg gcaggcgccg tcctggcgtt
   123961 ggaggtagtg ccccggccct gaggccccga gacccccggc cctgaggccc tggggcgggg
   124021 cccgactgtc cccttccccc ctcccccccg tccgcccgcg agtaaaggct gtctaatttt
   124081 ttccgcacgc ccgcgcctgt cttcttaggg aggggaagga ggggagggag gggaaggagg
   124141 ggagggaggg gaaggagggg agggagggga aggaggggag ggaggggaag gaggggaggg
   124201 aggggaagga ggggagggag gggaaggagg ggagggaggg gaaggagggg agggagggga
   124261 aggaggggag ggaggggaag gaggggaggg aggggaagga ggggagggag gggaaggagg
   124321 ggagggaggg gaaggagggg attcgggccg gccgaggatt cgggccggcc gagcgagcgg
   124381 gccaaagctc cggctccccc ttccccctcc cgccccgcgg gcgaataaaa caactagaac
   124441 cacaagatat agagaggcaa ggcgcgcctg cgcgcggcgt tttatttaaa aaaatatgac
   124501 aagggccggg gagagggcgg gagagggggc cgcggggccc cgccccccta aactcgctgg
   124561 cggcgcttgg ccggcgcggg ccgcgcccgg gcgcgaccgg agggcgagcc ccccggcgac
   124621 gggtatggcg aggagcccgg cgaggagccg gaggaccagc gccagcaggg cgcgggccgg
   124681 cgccggcccg cgcgcgcggg ggggccgccg gcgccgggcc cggcgccggc cgggcgcggg
   124741 tccccgggcc cggggaagaa cacgtcgtcg tcgccgtccg aggcggagaa cgaggacagc
   124801 gacgacgagg aggtggaaga ggacgcggtg ggcgacgaga cgaaggagac ggccgaggcc
   124861 gcgggcgagg cggaggagag gaccgcggct cgcgggcggc accggggggg gctttcggcg
   124921 gcggccccct cgccgccgtt ctcctccccc tcctcgtccg cctcctcgtc ctcctcgtag
   124981 tcttcgctgc tggagtcgct gccgctcacg tcgcactcgg ctccgaaaag cgggcccggc
   125041 aggcgcgccg ggggcgacag cgggcgcgcc ctgggcccgg cggcggcggc ggcgcgcaaa
   125101 agccggcgca gcgggccggc ctgctcgggc gagagctgca gcagcgcctc ccagcacgcg
   125161 tccgtgggcg tggcgcccgt gtagccgagc aggaagaagc cgacgagcgc gcggcgcagc
   125221 gcgcgcgtgt cggccgtgac gaacgcggag ccggtggcga tgcagcggaa gagggtgttg
   125281 acgtcgatgg cgaggcgcag cgcctcgggg cgccagtcct cggggcagaa ggcgcccggg
   125341 ccgcggcgag cgtgctcgtc cgcgggggcg gggcccgaga ccacgcggtc gggcgagcgg
   125401 cagaggcggc aggagccgtc gcaggtgggg caaggctggc cgtggctcat ggcggcggcg
   125461 ggccgggccg gtctgccggg acaaaggggg cgggacagag aagaggagga gcggtaagcg
   125521 ggcgccccgg ggcagggccc gcccggtcgc gtggcaagcg agtggccgcg cagggcgcgt
   125581 ccggggaggg cgggcttgcc ccgggcgggc gagggatcgg ggggatgggg gcgagggatc
   125641 gggaggatgg gggcgaggga tcggggggat gggggcgagg gatcgggggg atgggggcga
   125701 gggatcgggg ggatgggggc gagggatcgg ggggatgggg atggggggcg aggggaacct
   125761 ggcttacctc gcaatgtcgc cctggtccac cggcgcggtc ctgggtttca gctctggggg
   125821 gtcgccgccg gggttctgca agagcatggc tgggctgggc tggggtgggc tgggctgggc
   125881 tgggctgggc tggggtgggc tggggtgggc tgggctgggc tggggtgggc tgggctgggc
   125941 tgggctgggc tggggtgggc tggggtgggc tgggctgggc tgggctgggc tggggtgggc
   126001 tgggctgggc tggggtgggc tgggctgggg tgggctgggc tggggtgggc tgggctgggg
   126061 tgggctgggc tggggtgggc tgggctgggc tggggtgggc tgggctgggc tggggtgggc
   126121 tgggctgggc tggggtgggc tgggctaacc ttgcggcagg tccctaggtg cagtcgaggc
   126181 gcggttcctg gaggtgctcg tcgagccggc tgcaatggag cgctgcacgg gggggcggag
   126241 cacaggagct cgggtggggt cccgagtgag ctccgcccac ccagccccca cccccgtctg
   126301 cccgcccccg ggcccgagat gagggtgggg gctgggtggg cggagctcac ttggcggggt
   126361 cgtcggcggg gcgtccgggg tcgtcggcgg ggcgtccggg gtcgtcggcg agttcctatg
   126421 gaagcaaccc acctgagctc gaggaagccg ttcgctcgag ctcgggtggg ggtgggggtg
   126481 agcgagaaaa aaaaaaaaaa aaaaaaaggg ccccggcccc ggggcggatg cgcttacctt
   126541 gcctttgccg gggctgggcc tcggtgaagg ttctgcagtg cgcccccctc ctctagcccc
   126601 ccgtgtgtgg gcttggggcg cgatgtcgcg cgcttatatg tctttgagta gggcgctcct
   126661 ccccccgccc ccggccgagc gccgcccctg gcggggcctg atttgcctgt gccctcccac
   126721 cgtcccggta gccctctcgg gaccccacgt gagaacactg gcagaatgcc agggggccca
   126781 cgtaaggggc cccgcccccg gccgagcgcc gcccccggcc cggcgccgcc tccgacccgg
   126841 cgccgcctcc gacccgacat gatttgcata tgccctcccg ctatcccggc agccccatcg
   126901 aaacccggcg ttggtggttg ccatgggccg gcttggcgcc agtcccagaa ttcgcactcg
   126961 ggctaataat atatatatac ttattgagtt ttgtgcgaac gctggcattc tgccagcgtt
   127021 ctcacgggca cggtcgtgag agctggcgcg ggtcccaggg ctcgcactcg ggccaataat
   127081 atatatataa acttattgag ctttgtgcga acgctggagg ccagccaagc agccccgcga
   127141 ggctcgtcgg cccgcccgcc ccgcggttgt acggggccac gtgggtcggc gcctcgccgt
   127201 ggtggacagg cccccccgct ggcgcaaaaa tacaatagct ctcgattatc cgccattgga
   127261 ttttttgccc gcgcgggggc gatgtccaag tggagggggg gcccgagcag ggccctaaaa
   127321 acccgcatgg cgcgaactcc ggcgcggcgc gcgcgggagg gtcttccttt cttcataatc
   127381 gatccgccaa tcgatttggg tctggcggcc caaacggccc gatacatcga tcgcgcttac
   127441 agatcaatcg tattgattta atctgatggc ccgataccaa tctatcaata tcggttagat
   127501 cgattgccaa ttgtacaacc ggccgcatat gcgccccgtt aatcgatcga ccctcgccga
   127561 tatttatttt cgccgattgg actttaaagt ttcagctatt gatcatctat tgaccgaaac
   127621 tgtgtgtcga tatccttctc tgtggtccct ccaccccccc acccaccccc ccaccccacc
   127681 ccgcatcaat ccagccgcgc ccgagtcaac aggggggagg ggaggggggg gggcacaaaa
   127741 ggacgaatag aaactcaggg gggctacgac ccgagtggga gggggatggc gccatctggt
   127801 ggcgacgcgc aaaataacgg cacccaaaaa gggtgcgggc cgctgcaagt acgccccccc
   127861 cccccccccc ccataaaggt acagcagctg cggcggcttg cccggcaggt ggcgcagcaa
   127921 cagagccatc aatacagatc ttttttttgt ttcgccccgc ctctctgtgc acttacacag
   127981 ctaaaccgca aggcggagca aggaacgatg ggggggggga gggggaaaaa aggcaagctg
   128041 agcgagcaag cgagcgcaga gagaagagag cgggcggcgg ccgcggctgc ctaaagccga
   128101 agcggatgaa ccgcccgggc gagcgagcgc gacacgcccg aaggggaggg ggcaagaccg
   128161 gcaaggtggg ctgcggcttg catgcaagca cacgggatag tgggctgggg gtatgcccgg
   128221 taagggggtt agcagcgggg tgggaagctg cggtggtcgt ccacaggggc gcgggtgtgc
   128281 atatacaaac tacccacgcc ggcaagctga tggcaggggg cggcggcagg gcggaggggg
   128341 accgcggaag cactgcgggc cagggggcta tgcaaattaa accgggcagg ggcgagccaa
   128401 atgcaaaagc gcaaggcggg ccaaagcaag cgccgccccc ccccccaact ccccgctttt
   128461 gttatcgccg cgcctgcttg ctcccccttt ttttagtttt tttttttaaa aaaaaggggg
   128521 gttgtcaggt tacggttagt ttcctccccc gccgttttct tttcgcctct gctgctcctt
   128581 tttcctcctc cccatcctcc tcctccctcc ccccgctagc acaggcttga aggaacactg
   128641 tgttcctcgc ataaggcacc gcggctgggc ccttcacaca ggcaaaagta gggaggcagg
   128701 gccgcggcga gtaatttgcg gttagaacag gtcgcgccct cgcaccggcg gctgtggccc
   128761 aggctttttc cccttgggac acacgcccgg aggcaactgg tacactgtgt ggcgatctcg
   128821 caaatgcagc aagggaggag gagcggggtg cggggtgcga gggggagggg ggtggtggcc
   128881 gtggagagaa tggagcggct agggccaaag ggggccgcgg gcggtcagac cagggcgggc
   128941 gggcgggcgc gcaggcgcgc acaaaaaggg ccaaccacca aaactaaatg ccgcgcaaat
   129001 aggcaaaagc aaaaggcgcg ctcgaaggca atgctggggg cggagggagc agtggcgctg
   129061 ggcaggaagc ggggagtccc aatggggagg gggtaggcaa atgagcctgg acacaattgc
   129121 cgcgcctccc tgctcgctca ccgccggggt cctgggcggg aagcggggag tcccaatggg
   129181 gagggggtag gcaaatgagc ctggacacaa ttgccgcgcc tccctgcttg ctcaccgccg
   129241 gggtcctccc gccaatcgcg aaagggagaa gggtgagggg cggccgtgag caagcaggga
   129301 agaaggggga aaggggaagg aggggaggct agaagcagcg ggcgggcccg tcgtccgccg
   129361 cccatccgcc tagcggctgc cagaccaacg cgcgcgaggc aggggcggga atggggaggg
   129421 gaactggtag gggcgggcct ggtgcaaggc gggcctgccg ggcgcggggc cgggggcgtt
   129481 cggccatgct ttcatgcaaa tgagccccga cagccgctcc tattataatg agcttggcgg
   129541 cgaaccgccc cgcgggcagg taagccctcc caggcgcacc tgaactgccg ggtctgggcg
   129601 gccccggccg gcccaccttc gcgcctgggc gggccttcaa agggtctata aggcgagcac
   129661 cgtcgccacc gactgtacct ccgccgcggc gcgctttttg acacccgtac tgcaacacct
   129721 gccgctgccg ctgctgccgc cgccgccggt gcgaggaagg aggagacggc caagaaagaa
   129781 gcccgcggaa caagaaagag gcgcggggaa aggagagaga cgcggccgcc accgccgtcg
   129841 ggcaacacgc agggggagcg agcgagaaaa ggaagagcca gcggggacga aggagcagaa
   129901 agccggccag ccagagagac agacatccag ccgcggccgg ctagccagct ccgaccggcc
   129961 ggccttctgc caggaccctc gccgtcgcgc tcgccgtacc cccgtccccg ggtctccgga
   130021 tctaaaggtg agacgcaggc aaaccctttg ccgcgcgcgc cccgccggcc gccgcggcga
   130081 gagagccggc gagggcttct cccgcgccgc ggtaaaacaa aaaaaaggca cgcgcggtgg
   130141 gggtgggggg ggggaaggga agggaaagag aaggagggga aggggaagga gaaggcgccg
   130201 cactgccgcc cgctcccggc ccgccgtccg tcccgtcgga gccgccgccg gtcgcccgag
   130261 cttcccctcc gcgccgccgc cgccgcgctt tgccgcggcc gccgcagccc cagctgcccc
   130321 cccggcgcgc gcgatagcga ggttgctcgg gggggcgctg ttgccgccgg cgcggtcggt
   130381 gtcgttcgca gcggcgcggg ggccctgccg ctgcccgccg cccccccccc tcccctgcgt
   130441 tttgacggcc ggccgaccca cccgcccccc taccccgtct cccccaggcc accgcacgca
   130501 cccacggccg gtcatgtcgt cgcccggcag gctcgagctg gccacgctcg acctgtacga
   130561 cctcatcgag tccgcggacc tcggcccgac ggggggctcg gaggaagacc cggccctgct
   130621 cgacgcggcg cgtcgggctg aggcgcgcga gcgccggcgg gccgcccgcg ccgagctggc
   130681 cgagctgtgg cggatggtgg gcggggagga cgcggagagc agcgaggacg acggcgccgg
   130741 agacgcgggg gccaccgagg gcgccgaggc cgaagacgcg gagatcggcg aggacgccgg
   130801 cgccagggac gcggggggcg ccgaggacgc ggacgtcgcg gagtgcgccg aggccgaggg
   130861 ggcggagggc gcggaggacg cggacagcgc ctgggccgcg gcgcgcgcgc tcgcggtcgc
   130921 ggtggaggcg gccgcggccg gggcggaggc ggccgcggcc gaagcggccg tcatagccgc
   130981 cgccatcgaa gccgaggcgg gggcggcgcc cctcaaggcc gaagcgggga ctgaggcggg
   131041 gggcggcggt gccctcgggg ccaggaccga ggccggcgac gttgggcccg aggactgcag
   131101 cgacgccggg tccgaggaca gcgggcccga ggactgcagc gatgccgggc ccgaggacga
   131161 tgggggcgag gcccgggagg ggagcaccga cgccgacgct gaggccgagg ccgaggctga
   131221 ggccgggact ggggccggga ccagaaccaa agcggccccg cgagaggcgg gcgccgggcc
   131281 cggcgccccg cggggccgcg cgcccgggcc cccggcgccc tcgccgccgg agacggcgcc
   131341 ccccccgccg cggcgccagc gcgggcgcgc aaccggcgcc cgcgctggct acgccgcggc
   131401 gccgcgcgac gggccgccgc cgctggaggg cccgctgctg acgccttctg gcgaggcgtg
   131461 gcccggcagc gcgccgccgc cgcccggccg cgtgcgcttc ggcggcgcgg gcgacacccg
   131521 cgagggcctc tgggactgcc ccgagatccg cgaggcggcc gcgcgctacg cggcggccgc
   131581 ggggcccgcg gccgtgttcg tgccggagat gggggacgcg gggaagcagt acgcggcgct
   131641 ggtggacctg gtgtacgcgc gccgcgacgc catggcctgg ctgcagagcg cgaagctcgc
   131701 gggcccggac ctgcagctgg cgcgcctgct gcagcggcgc gtgcagggct gccggggcca
   131761 cagctcgttc atcaccggga gcgtgacggc gccgctgccg ccggtcgggg acgccatggc
   131821 cgcgcagaac gcgctgtggg cgctgccgca cgtggcggcc tgcgtggcca tgagccgccg
   131881 ctacgactgc gaccagaagc tgttcctcct gcagagcctg cggcgcgcgt acgcccccat
   131941 ggcctacccg gaggccggcg ccggcggcag cggcgcccgc gccgcgctcg ccgagctgcg
   132001 cgccgtgctc gccggccgcg cggcgccggc gcccctgccg ccggcgagca cggcgcgggc
   132061 ggcgcgcgag cggctgcgcg agctggcgga ccgctgcgcc gtcgcctgcc gcgaggcgct
   132121 ggaggcggcc cgccgcgccg ccggcgccgc cgggctcccg gtgctctcgg ccgcggcggg
   132181 ccgcggcctg ccggccgcgg cctgcgcgcc ggacgcgctg gcggcgcacc cggagcgcgt
   132241 gctccgggcc gccgagctgc tcggcgcggc ccgcgacgcg gtggagcgcg cgcggctcca
   132301 gcgcgcggcc ccggcggcgc tgcgcgccga ggcggccgcc gcgctggagg cggccgcgct
   132361 ggcggcgcgg accgtggccc cgctcgcgcg gtactcgacg cgcggcgcgg cggcccgcgc
   132421 gtcggcctgg gcgctggcgc gcgcgctgtt cagcccgccg gcggaggtgc cggcgcggct
   132481 ggcggccgcg ctcgcggccc tggaggccgc cggcgggggc gccggcgccg gcgccgccgc
   132541 gccgggccgg gggccggtgg aagtggaggt ggaggacatg agggccgggg cgccgcgggc
   132601 ggacccggag gacgggtccg aggcggagga cggggaggac ggggaggacg aagaggcgga
   132661 agaggaggaa gaggaggaaa aggaggaaga ggaggaagag gaggaagagg aggaagagga
   132721 ggaagagggc cgccccggcc cggcggcggg agcgccgccg ggtccgaggg aaggaagaag
   132781 ggccgaggag gaggaggagg aggaggagga ggaagaaggg gacggggacg gggacggcga
   132841 ggcggcggcc ctgccggccg ccgcgggggg cccctcgggg gaggacgact ctgggccgag
   132901 gcgccggcga aaagccgccg ccgccgacgc ggccgggccg gcgcggcggg agccgccgct
   132961 gcccgcccgc gtgctggggc ccatgccgcc cggcggcccc gccgccgacg gcggcttccg
   133021 ccgcgtgccg cccggggact accacacgcc cgcgcccagc gccgcggcgc tggcggccta
   133081 ctgccgcccc gaggtcgcgg cgcggctcgc ggaccacccg ctcttccccg agccctggcg
   133141 cccggcgctc gccttcgacc ccgaggcgct ggccgagatc gcggcccgcc gccgcgcggg
   133201 ccccgcgggg cgctcgccgc caccgctgcg gcggcgcgtg gcctggatgt cgcagatcgc
   133261 ggaccccgag gacgtgcgcg tggtggtgct ctacgacccg ctgcccgggg aggcgctggc
   133321 ggcgccgccc ggcgaggacg agcgccggcg gcccgagtgg ccgccgcgcc gcggcgggct
   133381 ctcgcacgcg ctcgcggcgc tgggcaaccg gctgctgctg agcgccgact cgcacgcctg
   133441 ggccgggcgc tggacgggcg cgccggacgt gagcgcgctc ggcgcgcagg gcgtgctgct
   133501 gctctcgacg cgggacctgg ccttccgcgg cgcggtggag tacctctgcg cgcggctggc
   133561 cgcggcgcgg cggcggctga tcgtgctcga cgccgtggac cccgagaact ggccgcgcga
   133621 cggcccggcc gtcgggcagg cgcacgtgta cctgcgcgcc gcggtgctgc cgcggcgcag
   133681 tgcgccgcgc gctggcccga gcggcgcgct ggcgcgcgcc gtgctggcct cgcggcgcgt
   133741 cttcggcccg ggcgccttcg cgcgcgccga ggccgcctac gcgcggctct accccgaggc
   133801 gccgccgctg cggctctgcc gcggcggcaa cgtgcgctac acggtggcca cgcgcctggg
   133861 cccgcgcacc gcggtgcccg tgccgccgcg cgagtaccgg cagcgcgtgc tgccggcgct
   133921 cgacgggcgc aaggacatgg ccgcgcaggg cgcggcgctg gggctcgggg agccggactt
   133981 cgtggagggc gaggcggcca gccaccgcgc cgccaaccgc tgggggctcg gcgcgccgct
   134041 gcggccggtg tacctggcct gcgggcggcg cgcgctggag ctggcgcccg acgagctgcc
   134101 ggccgcggcg gtggccttct gcgcggccgc gctgccggag ccgcgcgccg aggcgccgcc
   134161 gctggtgctg gaggccgcgg cggcgccgcc cgcggccgcg gcgcccggcg tggactggga
   134221 cgcggaccag ggcccgcggg agacgctcgt gctgctgcgg cgcgccgcgg gcggcggcct
   134281 ggtggagcgc gtgccgccgc cggcggcgga agccccgccg gcccgggtgc cggcgcagtc
   134341 gtccccgggc gcgggctcgg gcttcccggc gccggcgggc ggcggccggc ggccgcggcg
   134401 gccccggcgc gggccgccgc cgcgcgtgga ggtgctctcc tcctcctcct cctcctcgtc
   134461 ctcgtcctcg tccgcggcgt cgtcccccgc ctcgtcggac gacgacgagg ccggcgccgc
   134521 cggcggcggg ccggcctcgc cctagggggg cccgcgggaa gggagggagg gggcgcgacg
   134581 gcggcaataa agacgagtct gtgcgaacac acgcggtccg agtgcggctc tttcttcatt
   134641 gtcgggcctc gggggcgggg ggaggcgcgg gccgcgcgcc gctgcggagc ggccgcggag
   134701 ggccaggacc cggcgccgga gacgcggcgc tggcgtccgc cgccacgttc cccgcgtcgg
   134761 gcacttgccc tccgcggaca ggggggttgg cgcgcggccg ccccgccgcc gccgctgctg
   134821 ccgccgccgc cgccgccgcc gccgctgctg ccgccgccgc cgccgcccgc ccgccccggg
   134881 ccctcggtct cggtcggagc gcggtccggc gcgcggcgcg cggggcgggc cccggggcgc
   134941 gaagcccggg agggacgcgg gcgtggagcg cgaagctccg gcggggcgcg gggacggcgc
   135001 ccgcgcgggc tcggcggccc ccgggctcgg gcccctgggc gccgggcgtc ggggcgcgag
   135061 gcccgggctc gggcccccgg gcgccggggg cgggggcggg ggcgggggcc ccgggggcca
   135121 agacgcagaa ccccggcccc ccggccgggg cccgaggccc gcgggcgggg ccggggcgcg
   135181 gggcgccgga cccaggggcg gagcccagag cgggcccggg cccgccgcgc cgaaatttcc
   135241 gccccccccc aaaaacaccc ccccggggtc gcagggggcc cgcgcggcgc ggcgcggagg
   135301 g
//

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH