NCBI Nucleotide banner
My NCBI
[Sign In]  [Register]
PubMed Nucleotide Protein Genome Structure PMC Taxonomy OMIM Books
 Search  for    
  Limits Preview/Index History Clipboard Details
 Display   Show    Hide:     
  Range: from   to  Features:  
1:  AB024414Reports  Gallid herpesviru...[gi:5689266] Links
LOCUS       AB024414              110637 bp    DNA     linear   VRL 04-AUG-1999
DEFINITION  Gallid herpesvirus 1 (serotype 2) DNA, UL region complete sequence.
ACCESSION   AB024414
VERSION     AB024414.1  GI:5689266
KEYWORDS    homolog of MDV1 pp38; MDV2 ORF966 protein; UL55 product homolog;
            ORF-1 product homolog; UL54 product homolog; UL53 product homolog;
            UL52 product homolog; UL51 product homolog; UL50 product homolog;
            UL49.5 product homolog; UL49 product homolog; UL48 product homolog;
            UL47 product homolog; UL46 product homolog; UL45 product homolog;
            UL44 product homolog; UL43 product homolog; UL42 product homolog;
            UL41 product homolog; UL40 product homolog; UL39 product homolog;
            UL38 product homolog; UL37 product homolog; UL36 product homolog;
            UL35 product homolog; UL34 product homolog; UL33 product homolog;
            UL32 product homolog; UL31 product homolog; UL30 product homolog;
            UL29 product homolog; UL28 product homolog; UL27 product homolog;
            UL26.5 product homolog; UL26 product homolog; UL25 product homolog;
            UL24 product homolog; UL23 product homolog; UL22 product homolog;
            UL21 product homolog; MDV2 ORF273 protein; UL20 product homolog;
            UL19 product homolog; UL18 product homolog; UL17 product homolog;
            UL16 product homolog; UL15 product homolog; UL14 product homolog;
            UL13 product homolog; UL12 product homolog; UL11 product homolog;
            UL10 product homolog; UL9 product homolog; UL8 product homolog; UL7
            product homolog; UL6 product homolog; UL5 product homolog; UL4
            product homolog; UL3.5 product homolog; UL3 product homolog; UL2
            product homolog; UL1 product homolog; ORF 4; MDV2 ORF759 protein;
            homolog of MDV1 pp24 protein.
SOURCE      Marek's disease virus serotype 2 MDV2
  ORGANISM  Marek's disease virus serotype 2 MDV2
            Viruses; dsDNA viruses, no RNA stage; Herpesviridae;
            Alphaherpesvirinae; Mardivirus.
REFERENCE   1
  AUTHORS   Jang,H., Cai,J., Izumiya,Y., Murakami,Y., Mochizuki,M., Song,C.,
            Lee,Y., Kai,C., Takahashi,E. and Mikami,T.
  TITLE     The complete DNA sequence and transcription map of the unique long
            genome region of Marek's disease virus type 2
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 110637)
  AUTHORS   Jang,H., Izumiya,Y. and Mikami,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-FEB-1999) Hyung-Kwan Jang, The University of Tokyo,
            Faculty of Agriculture, Department of Veterinary Microbiology;
            Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan
            (E-mail:aa77147@hongo.ecc.u-tokyo.ac.jp,
            Tel:81-3-3812-2111(ex.5398), Fax:81-3-5689-7346)
COMMENT     Sequence updated (30-May-1999).
FEATURES             Location/Qualifiers
     source          1..110637
                     /organism="Marek's disease virus serotype 2 MDV2"
                     /mol_type="genomic DNA"
                     /strain="HPRS24"
                     /db_xref="taxon:36353"
                     /note="synonym: Marek's disease virus serotype 2"
     gene            <1..323
                     /gene="ORF 1"
     CDS             <1..323
                     /gene="ORF 1"
                     /codon_start=3
                     /product="homolog of MDV1 pp24 protein"
                     /protein_id="BAA82891.1"
                     /db_xref="GI:5689267"
                     /translation="DAGDDAGDDPGADPGDDPGDDPGDDPGADADEAHARLLRRAERE
                     NKKLRRGCNLVFTISNKTLVVGTCFMLAAGVLVGASGADHETACNKTNLLLVFVTALL
                     TRFI"
     gene            join(560..655,732..2915)
                     /gene="ORF2/3"
     CDS             join(560..655,732..2915)
                     /gene="ORF2/3"
                     /codon_start=1
                     /product="MDV2 ORF759 protein"
                     /protein_id="BAA82892.1"
                     /db_xref="GI:5689268"
                     /translation="MSSKGDVDHHAGYGVALAIIALLLVHATALIMIFSDVKFRPVSQ
                     DLSTQYPSHKHYDDAYSPHMSGVDHGHSDVWTNTVNDPSGGINSNLPGAKSVEKIYPS
                     VEPSTSHDKVSYGNAWGGDINTGSVSPSDDKALPATVEPSTDIVSIAITGSSLNGESS
                     WRISKDGPRRVYTPHQTKRSPPQIDGTRLSTRTAYLSVWDEQEGIFKTFPANAAAFNL
                     LDANQLEKARREVFFVVSVWHGNTNETRIFLSATRLLTRMMSTSLVVYLSWDSRGALG
                     TTTDAAFLARSVNISQFLTAVPPHSQVRCMGHSLGMYTCGSICRQYNSVGTTRCKSIL
                     SIDPYGASSPDSHVSSADSSNTIRFDADYVAIFATSEWHLNTSDSNADEYIIVDGLNA
                     NAVCVDPYEWSVLLCVSNRQRNAVCERFGANNVTTTGDPAEDGSETCMRILPILSVLQ
                     SLDKNSAYPLLRMDPPGASAAVPSLPSTWNIYVMGKDYRYSTYGKNESLWYSSAVHMG
                     GPGFFPASVFTVFLPSGIPAVVSNVVQHSSISYGDVAVHSAFLTDRSLYYPRVMVQTS
                     GPILSAYSWRARLHNDSLYLLPLPEQEIMQYKCAVAQGSYACSPTGPILTTVMWRSLL
                     FAGRSSPVPPNGSCLTYIPANTIIRSRSPIEIGPRSIITASFQLSRQLMAMTLENHFT
                     STNRTLLTFHDVCHDTAMESDIYFEYNWLGASMNITILNPGLYTFRWFFPFEVFVMPV
                     VVTPPKSRADTVTIAPVGL"
     gene            3782..4873
                     /gene="MDV2 ORF 363 protein"
     CDS             3782..4873
                     /gene="MDV2 ORF 363 protein"
                     /codon_start=1
                     /product="ORF 4"
                     /protein_id="BAA82893.1"
                     /db_xref="GI:5689269"
                     /translation="MFDGRATIELAERLATSWLTAIRLILVWHPVYALGQQHEPLERI
                     CRQGREYIAMLSGTIQTSYATWPFWQMMQRCLDWCCSFHIPDDRSCEHGSPRLGIQLE
                     GENQIFAPSLGLYSAVMAWTPIPCHVQVPVFPRPGESDDVSTPPSGAQIGRVRPHSLQ
                     RLALKHRPIDADVHRPMPLGRPLPSMHMDDPDDPQPGPSGQGRAPRTPTLEGVRVAEQ
                     PVSLRRARTPPPPLNVDEDDNDLPPGQPPRPHLRTPPSSPSSSETEIDEELNAQPDPW
                     GTNRSSTPTDNSSASEDEARGSGLPRPLRSATTEPRVTRRSRREARSRSRSRSGDRRW
                     GPSRLRSMPGRRRASRQDTVLVDSSEEEP"
     gene            4975..5547
                     /gene="ORF 5"
     CDS             4975..5547
                     /gene="ORF 5"
                     /codon_start=1
                     /product="UL1 product homolog"
                     /protein_id="BAA82894.1"
                     /db_xref="GI:5689270"
                     /translation="MHVSLVWVLCLLFGTSGGVLKWSDVDLSRGFISVPNVSSLMLLD
                     CAPNSILSTARFADLTTDDVPTGIFIKINCSVPEFILWYGSKSVAARLNPIIASALMM
                     DDVLKSGLDDSVKAELRVFLKRISERLPWSSLRKRHGCLNLDAPYDFSCYGSARLDRF
                     ERDIEDDGRGMSCRAKSTRAKAARTNAIEG"
     gene            5414..6385
                     /gene="ORF 6"
     CDS             5414..6385
                     /gene="ORF 6"
                     /codon_start=1
                     /product="UL2 product homolog"
                     /protein_id="BAA82895.1"
                     /db_xref="GI:5689271"
                     /translation="MTSPVMARHGSTDLNETSRTMAAECHAELNQPELKRPAPTPSRD
                     SSAAIKKRRRPIGPPPGFAPLGDNAPSPQGETDAYGHQLSMTENVRAELWPVIAESYN
                     IDWSWKDWLLPELCCPNGSKLLAEYERRAAVEDVFPPRADIFAWTKYCAPPDVKVVIV
                     GQDPYVHPGQAHGLAFSVKRGITIPPSLQNIFSAVKACYPSIELGAHGCLEDWAKRGV
                     LLLNSVLTVKKGEPGSHHSLGWQTLVRNVLRRLSLSTRGIVFMLWGARAQTIYFQTDR
                     DDRHLVLKYSHPSPLSRRPFASCTHFKDANEFLCKSGKGGIDWSIGA"
     gene            6460..7107
                     /gene="ORF 7"
     CDS             6460..7107
                     /gene="ORF 7"
                     /codon_start=1
                     /product="UL3 product homolog"
                     /protein_id="BAA82896.1"
                     /db_xref="GI:5689272"
                     /translation="MNDTAPSVLAVLSNWGWKSTPLGTVGPVPIRDETECAREDLPAH
                     DCDHWCKTANAENGPMAPSPGNRDFAGNQEYTHFDTLFMVSSLDELGRRQLTDTIRRD
                     LRHSLAKFTIACTKTSSFSSSHATKKVRAKMFQRGRQSNKSLQMFILCRRAHAKHIRA
                     QLQAVIQARKPRKYYTRAVDGTTHPVVPVFVYEFAAIDVVSLHRDNVIEVDTPGS"
     gene            7125..7394
                     /gene="ORF 8"
     CDS             7125..7394
                     /gene="ORF 8"
                     /codon_start=1
                     /product="UL3.5 product homolog"
                     /protein_id="BAA82897.1"
                     /db_xref="GI:5689273"
                     /translation="MFVVSAALASASDYAAFLRDNKQAARKLQFPLSPMPSQRIPHLS
                     KDGRTAVARETGSSEVMSASGQTRVDPTGRRSFRQPRHREMTRSI"
     gene            complement(7488..8300)
                     /gene="ORF 9"
     CDS             complement(7488..8300)
                     /gene="ORF 9"
                     /codon_start=1
                     /product="UL4 product homolog"
                     /protein_id="BAA82898.1"
                     /db_xref="GI:5689274"
                     /translation="MMGSTFIAYTLENVTAQPAWTMPPYEQMVCSCAGGTRSIAVGKM
                     TRCDHIPSSNFIIQRGPVGTLIIVDSGADICSYLLRVGECGAEYHAAPLSFLPESLCV
                     IPFATCTVTGPDAYLYSSSGGILTVMWMGTSLYITITIYGKPGSLTQTANAMRVGHES
                     SARLYCQAIADPNKDAHRQSCDPIRSLPENAPEISKCIEAHEIGAVHGYGPSKVDAFS
                     TGYEEDLLTEAIREADIQIDQSCMPEDRSSPLACCVADAVDVLESARTLPIL"
     gene            complement(8338..10914)
                     /gene="ORF 10"
     CDS             complement(8338..10914)
                     /gene="ORF 10"
                     /codon_start=1
                     /product="UL5 product homolog"
                     /protein_id="BAA82899.1"
                     /db_xref="GI:5689275"
                     /translation="MSRENDFFSEATYLNFTAMHGIQTIIARVRSLADASVSDDIVPP
                     LSYFMNASKLESPLDLELRELPFAVYLISGNAGSGKSTCIQMLSEILDCIITGTTKVA
                     AQNIYCKLSNSYTSQHINTIFQEFGFKGNHIQANLGKYQYVCPTSPPTMKELQKKDIV
                     YYWDVLSDITKCALKAVSNEVGPGRFEMIRALEDLLSKPRGSMAWTIFGIHGSMPSFT
                     RSNIIVIDEAGLLGKYLLTAIVYSWWLTNAVYRTPQYCRRRRPVLICVGSPTQTNSLE
                     STFEHSKLKCNVRTSENILTYIICNQTLRSYLELSKNWAIFINNKRCTEPEFGDLLKT
                     LEYGLPITEEHARIVDSFVVPEAYINNPANLPGWTRLYSSHKEVSAYMSRLHDYLKTS
                     GNTKFVVFTLPAYTFVSLDSFERYRTAANQPHVTLEKWLAANAGRLSNWSQSRDQDAT
                     QAKCEIRSQQGLAVSCVDIAYVLNSQVAVTTRLRKWVFGFCGTFETFLSVLKDDSFIK
                     THGDGSVEYVYRFLSQLLFNGMIQFYNYLQRQGLPDNSVKSAYDRLAMLTSALLYPGR
                     QPPDRAEQRESFAIPGHRYGSEKELDCIANDQISHVEDTDDALFMDFDDQMIDMLYCN
                     YEFGRAETSAEIYTQFSMLKSMFMGRYSILTELFGQKFAASRFDSYVDNVSFKGCEIF
                     INSMRGGMLSLALQTDSYTLMGYTYARINTFADEPIRRKIHPQVAEALGELHMPTLVL
                     KDQHGFMAAINTNVNDFVETVDDQELRMAVTADYGISSKLAMTIARSQGLSLERVAIC
                     FAQSGIKLSSVYVAMSRVTSSKFLRMNINPLRETHTRDDNNISAHLLAASGIRKSTLY
                     TN"
     gene            10838..13204
                     /gene="ORF 11"
     CDS             10838..13204
                     /gene="ORF 11"
                     /codon_start=1
                     /product="UL6 product homolog"
                     /protein_id="BAA82900.1"
                     /db_xref="GI:5689276"
                     /translation="MIVCIPCIAVKFRYVASLKKSFSRDIVGLGEDGSDESTYLLGSG
                     LACCLFPMESSDVRAARSPALKQIRRPQLQSVTRQWKLSSDGDSQQSLEQDWIIIHPT
                     RQTRMFKEVLTGQLGYTDGQGIYNSVRSTEAAIRQIQSTILTLSLDAVRYDDLKEDWS
                     KHMDRRGMSAKEIAKKYGVHSEAEAVRMAKGVFSTWRKTLQMTLIELVRHATDCFAAA
                     EKTTSCFSKYIDWICCLGIVPVVRSERSMQASRPDSNCRDRATIRPNWVFSDATAKLL
                     VADSVMARAQQIADYLTASMQALTVIEYDRAQIEYNFLKRELRVKDVLSGERGECIVI
                     WRPVMNDGGVIFDSPMQRIYKEMIECHDLRMHAALCRLVNTAPIKVLIGKRDEDSKSM
                     AGAQRAIDKVLGDQTETAASSAASRLVKLIIGLKGMRHVGDITDRVRDYLEETGGHLL
                     DASPVDTSQPGFGRANRPQSSTISDGTCSNTARLRDAFHASVVTSINEMLEGYINKLF
                     HTVEGLKAANKDLSAKLSSKEIELDRIRTEALISERARADASCDPHCNPTMETLVREL
                     KHDVIDVTNAMEDESYIANSFQSQYIPSYDGDLKRLSNIWEQEMLRCFKMTRITSNQG
                     REVSISYSNSAITLLLAPYFFSVLQIYDIGAMVTSQDVYKSEEELCNSVLEKTRLCTY
                     LDDLALVFEADVKRAVAKYSLRAGNAEIDLAPEEFSYGSHGSKCETRFSSARHERHVG
                     RSSFKHAKWRSRPKRDRRRTNLATDGADDDGDPRDSRRSYSIHGRLRE"
     gene            13002..13907
                     /gene="ORF 12"
     CDS             13002..13907
                     /gene="ORF 12"
                     /codon_start=1
                     /product="UL7 product homolog"
                     /protein_id="BAA82901.1"
                     /db_xref="GI:5689277"
                     /translation="MEANARHGFHPLDTSDTLDALVLSTLNGEVGQNETVEELIWQPT
                     ARMMMEIREIQGGPTQFTGVSVSKLRVARCDTRFHLTLTGADLDDEMASDVYHSQCIV
                     NSAFKGFVFMVLTVTEDIVRTIGVPPPLLKYRLVFYNPSEHLDFALCLLVAYLENLHA
                     SACDVTFFVQVQSFLRYAWTRVTPMTKMRRFLCATNVWLLNTLMSMGSCSPFDGDRVL
                     PHYAIYRHLCSTSGVCDVLLTLFEPDTRQVRDRTHGKGLVMLNRGIMNKAFRQTWISD
                     TVYDWWTGEREKLIGEESLFNTYNI"
     gene            complement(13962..16256)
                     /gene="ORF 13"
     CDS             complement(13962..16256)
                     /gene="ORF 13"
                     /codon_start=1
                     /product="UL8 product homolog"
                     /protein_id="BAA82902.1"
                     /db_xref="GI:5689278"
                     /translation="MSTMAEANTVAVQKIRGCICYTTLYRVWTSRDRTDGLTALCYLL
                     FRNECGTYSAHYSTVNVSGRSIARAWGLNPDSVTDAALAIMASAGSVTGVWPSCRPDQ
                     HALWKALLAVTLAKLRIKLGYHAYFAPVDMYVDTTTGLVISCEPLPGDRCAPRPGLLK
                     TDGAVHVEESRLVSTAMEYTEGAHLAHIKLSALKHDDTIPEFDSRIEIYTKEDRFIRE
                     YKTVGRRSKKIKWGNTNRIFTIVERVLSLPDSQAPIKTAAPVPTSFDCLVTTPAEFSL
                     TALLAIYAQWHKKIYSLADDSEKRLAPIFVYIGPETSPRGEDVDYACTIGFPLWPLLK
                     TSTAAPSAIRKAVGSYSETDGLWPLAGPRTFHLLAPWHPETHPTPGIDVLENLKGRTS
                     STRRQVADDWTAGRITCIFREPTFIEQAYIAKFDFSAFFATLYLGLFPDHSRLRAAVK
                     ARLQREKNWLKQPIIEFGGLLKRVREDVYRAIICIGNHISLEVEATASALGFAPCTYV
                     KDGLWGTFTDGANNVLHSSKGTETALETLRVACGKSANKLATSVGLRFPEDIRLEFRM
                     EGVYTHAVSWNANCYWLWNETKRETDFVGFPARPAFAGQVKKALSALLEEISACNDSD
                     ESLRTIQERSRAVFEELVTAAFEARGDACFWSCPAESRDHTHYITALGLRAAARFDTS
                     AFSNDAVHTVTVDGSIAPLTCSLFEGGQVILPAIACIDHMKPIMSIFSRLLIGALTSK
                     WPNVDLSKFTFDVEPYRFLFVRNK"
     gene            complement(16279..18906)
                     /gene="ORF 14"
     CDS             complement(16279..18906)
                     /gene="ORF 14"
                     /codon_start=1
                     /product="UL9 product homolog"
                     /protein_id="BAA82903.1"
                     /db_xref="GI:5689279"
                     /translation="MIDYVCSASLSRILYGEGLIDWIAKNRPGVTTERQSDGPVTFPP
                     PLSSRARNVLVVRAPMGSGKTTALIDWLQRILYNPDTSVLVVSCRRSFTNTLFDKLSN
                     AGLSGFGNYLTASDYSIRGREFYRLLIQIVFDKLSNAGLSGFGNYLTASDYSIRGREF
                     YRLLIQIESLHRIDPDLLGRYEIIILDEVMSTISQLYSPTMRHLSRVDSILTTLLRNC
                     PRIIAMDATINTQLVDMLASMRGEDNIHVIVGEYAAPGFSKRSCTILRNLGTDTLLSV
                     MNSDQSDCFHVRPTPKHGADGTHSRHRSVTETTFFSELSRRLAGGLNICLFSSTISFS
                     EAAARFCLIFTDSVLVLNSTRDIPIDINSWTRYRVVIYTTVVTVGLSFISSHFHSMFA
                     YIKPTRNGPDMVSVYQSLGRIRSLRRNEVLVYIDASGARSEPVFTPMLLNHVIASGGG
                     WPAQFVCATNMLCNNFRRDCVPTFKSADALYIFPRFKYKHLFERCTLNNLSDSINILH
                     ALLDANLISVRFDGSDSQLDAETFCAFLADLTADALIAQRDLKHLRKIACGQIQADLI
                     DNEMVEPFIHKYLRHDGSPSDLAQLLTKLAEPLTREQFINITMLEACRATPAALYSEE
                     VFCRIYQYYASGSLPIIGPDGGLGTVAITADFNVSGRWHLYRLCCRWATSLGINPLEG
                     TAKNLDPLSMLRVMQNEYDTFIRSVLEVTRCYLLDARTASKRSVKTTKSALSGLARYP
                     LGRQTEENHAFSVFKVTWEILYGLRLVKSATTFPGGTKVKNLRKAEIEALLDGAGIDR
                     TSIKTHRALYTLLMKNKASFRKTRYEIRRPKWYALVKSRLDAELGIYHDILDLETVLA
                     EVPPACWPRVEGAIDFHSL"
     gene            19000..20274
                     /gene="ORF 15"
     CDS             19000..20274
                     /gene="ORF 15"
                     /codon_start=1
                     /product="UL10 product homolog"
                     /protein_id="BAA82904.1"
                     /db_xref="GI:5689280"
                     /translation="MSKGPRSEGARRGADHIDYIHKKMWVVQAACFSVAVLVFLGTLI
                     AASINMTEGFPCFFAAVVDYGMTNVTLVHTGMTNPRLGGVVPVLFFQTKAVAFLFYSA
                     SVVFVCITCYIAVGAIITSKKRVGAAYTGRGAFVLSLMASPSTILLGTVSIWLLQAVV
                     IVLAHKLIVLAAAVYLVHFSTITFFYGYFCGRGVDSKVYAEDIAAAKNVDAGLHRLIG
                     NGRAVMINLVSIVYSMLLIMASLMLGMLLANSFTLKFWHVIVTVLITSSVLTLMYLLV
                     LEFLVARYVHMILGAYIGLLIAYGMLWTTSCDYVNRFYFAMGVGAGNLRTACHSVLAF
                     FTVLIVAGMIVRLIRAGLYHRRRSTRAYAKARQLQRNVKERLRRMSRGRDRPDSRAED
                     ERALTQTQYSETSDDETIYDRVYSGSDSEWDE"
     gene            complement(20337..20582)
                     /gene="ORF 16"
     CDS             complement(20337..20582)
                     /gene="ORF 16"
                     /codon_start=1
                     /product="UL11 product homolog"
                     /protein_id="BAA82905.1"
                     /db_xref="GI:5689281"
                     /translation="MGQAISVTELFRRCRKRNTVLTKTGHVIELDDEQYDTVDLDGLR
                     SSDPLIHSDTVLAGSTCARGKTLFRFKDGREQCNDTL"
     gene            complement(20561..22138)
                     /gene="ORF 17"
     CDS             complement(20561..22138)
                     /gene="ORF 17"
                     /codon_start=1
                     /product="UL12 product homolog"
                     /protein_id="BAA82906.1"
                     /db_xref="GI:5689282"
                     /translation="MEIDSTAMFRLGENGPRKRKKESEFKSCPKVFACAEHAEAVQSK
                     PYDTVCYSVVVDYTFSDYILRNVDPKQSGPSPHPLYHRLLYITDVIKRGISEGRWPAS
                     SYSSLLEAEDKLLYESGANATSPSNHALFWCKIVETLTRPQADCELWHVLRQWLLTAS
                     TLKWTADGRINTVGIRPAEITAQGMPESVVFGTRNEPLARALIETYCLENPRYRPREP
                     SRVLENARVPDETITVSSASDKYACGLMIDARTGMLGASLDMAVCPRSARGILTPALP
                     DHSIETYEIKCRAKYAFYPECRSELSQCYERLLQTRTVAALRRFLYAINHPCVDYFKP
                     DDFPKAKEALITCDDDWKVGLSRFRAISSNIKRNDFDSRHLASNKNCSSRVWLFGEPD
                     LQTNAIHPLCWSTGEQSVLVPIFANPRHPNFKQIFVQNYVASNYFESNPVIPHLATFI
                     GRRRRPGELGRRLTISEGNTGEPTPSVKIDPEQAIPVLLLITPVVVDVTFYGEVEEAG
                     YRAFGELVQQVWAKQYP"
     gene            complement(22129..23631)
                     /gene="ORF 18"
     CDS             complement(22129..23631)
                     /gene="ORF 18"
                     /codon_start=1
                     /product="UL13 product homolog"
                     /protein_id="BAA82907.1"
                     /db_xref="GI:5689283"
                     /translation="MDLDLKARKPGRGRENDECPHVKWLSDISDQEDFSGPKGYSSTT
                     DDLQGTFSAPRRDSCRKKDHKQHISVNIRRCLKQFYRRRKHISRKTSDILLSRPSLPD
                     HIFTLSRIKNITSLIFDISPGLHYSTIDLQETPIYAGSGSYGEVKVFKGANVAVKKVF
                     ECFKTELLMTLIAGECACRARSTLALNSVISLLAFSIPSRELVFPAYDMDMDSYCHRL
                     RKMDKTARHWRAIEKAFMGLGRAVVYLNVSCGLTHLDIKCGNIFVNVREGSNPIIVEA
                     VIGDFSLALLNTNSTITKARFDITVDSDRVYSVKVSRANIRPVFDLVLGHGQTQPCEL
                     LVKALNGTGLERGSSQLSSDEGVAIDMYALGQSLMEVLLAAGMNFTRDFAIPGNPVHF
                     YYHKMMPADYLLDMLAYRCMLYQYLFPATPLTAKIGIPWERAEKIRSQLHGSHHRVAF
                     EKYLEGYEVTHRKLFDSLRVPPYLSNLFELVALYCHSNSEARAATRLLWK"
     gene            complement(23403..24071)
                     /gene="ORF 19"
     CDS             complement(23403..24071)
                     /gene="ORF 19"
                     /codon_start=1
                     /product="UL14 product homolog"
                     /protein_id="BAA82908.1"
                     /db_xref="GI:5689284"
                     /translation="MFAVNTIRRRRRQILAECRTREKIYKERTLTLLSQGVEADDPEL
                     IEALTSARNAHSDYKTQLHSNMRIEEAHRKSRIIQRHIDEQVDRRIVLDANRRFLNPR
                     LQSQLDRAEEDILANEDILTQISDDISDRLPDIELDAECEALLSKWILTSKPESRGAA
                     AKTTSVLTLNGFPTSATKKTSAGLRDTQAQQTICREHSVPPEEIRVEKRTTNNTSPST
                     LGDA"
     gene            join(24116..25159,28607..29809)
                     /gene="ORF 20/23"
     CDS             join(24116..25159,28607..29809)
                     /gene="ORF 20/23"
                     /codon_start=1
                     /product="UL15 product homolog"
                     /protein_id="BAA82909.1"
                     /db_xref="GI:5689285"
                     /translation="MFGGALGESAKKHFERLLRDRNERLGASRKNECLARGGSLVDAP
                     FLNFAISVPRRHQTVMPAVGTLHDCCDGTGIYSAIATRLLYAGIVSSEFGEVRRESLS
                     NGHISKRNREALLAPTLTRVANSITFHEYDDAQCAAHRNAYYSTMNTFGSMRTSDAFQ
                     QLASFIDRFSKLLAASFKDVNILDRNNAPKRARITAPSYDKPHGTLELFQKMILMHAT
                     YFLTSVLLEDHAERAERLLRVIFDIPDFSDAATRHFRQRATVFLVPRRHGKTWFLVPL
                     IALAMSSFEGIRIGYTSHIRKAIEPVFEEIGDRLRRWFGTQCVDHVKGETITFSFPSG
                     SRSTVTFASSHNTNSIRGQDFNLLFVDEANFIRPDAVQTIIGFLNQANCKIIFVSSTN
                     SGKASTSFLYGLKGSADDLLNVVTYICDEHMKHVTNYTNATSCSCYVLNKPVFITMDG
                     AMRRTAEMFLPDSFMKEIIGGITMDRNTCQGDRGVFTASAVERLLLYRPSTVRNQDIL
                     SRDLYVYVDPAFTANTRASGTGIAVIGRYGADYIIFGLEHFFLRALTGESADAIGECA
                     AQCIAQICAIHCERFGTIRVAVEGNSNQDSAVAIATRISIDLASYVQSGVAPAPHDVC
                     FYHSKPAGSNVEYPFFLLQRQKTAAFDFFIARFNSGRVLASQDLVSTTISLSTDPVEY
                     LTKQLTNLSEVVTGATGTRTFSGKKGGYDDTVVALVMAVYISAHASDATFAPIRGVEA
                     TCRGPTEA"
     gene            complement(25205..26260)
                     /gene="ORF 21"
     CDS             complement(25205..26260)
                     /gene="ORF 21"
                     /codon_start=1
                     /product="UL16 product homolog"
                     /protein_id="BAA82910.1"
                     /db_xref="GI:5689286"
                     /translation="MTTRRRRTPGSPRRSERTCDTAAVEFVNKLNDRICVWRTLRAES
                     RLAVLVALTTLDFTLCTYVPLGARPQKTKWVEIFMYLTRPKEMYLDRNTFQLLFLVNG
                     TRAYSVTAALRITPILRDGSSADLIFFSDVAPSRTCIGLPDVAIEPLSTISCIAPDIN
                     SLVQRTQPPDDPHNCIAISIGAWWSLSKRRFYYLRMEESLLSICPAGWQQRSLGATLA
                     KFLNHRSGCAECRGHFDLHVDVCNVRWECGSLGQACVCRGPCMWMKARQTDIQVKGEK
                     SLCCVLFMDTVNAVRVVGNSGTKACITERLEELIEAEVDSRKIPVNSCGWHLVYLPEM
                     WSSILVQGCIRLSRVCV"
     gene            complement(26318..28486)
                     /gene="ORF 22"
     CDS             complement(26318..28486)
                     /gene="ORF 22"
                     /codon_start=1
                     /product="UL17 product homolog"
                     /protein_id="BAA82911.1"
                     /db_xref="GI:5689287"
                     /translation="MEAHIESETAYSLSTPKHGPNRHVLTHVLLPDECLSAAGIDIAR
                     FKDAAQRVPSSAYQSLPIPVSVQMRYNATGKCSGWRESPAAYVPSGALHILLIPHVPG
                     HAKLFATLNRNDQGGLFMSLPIQYDSKNRFDPFTSVAIRFNVQDRETGEYEAYMDLLF
                     SQEELVPPGTRYDIDANRLKTLFRQFIRYTKRYEVELPSAVIELGAKLEACLSAVELP
                     GQFDIMRQVTDSPNVFDTPTLDTRLETDNIEIANLIKKAAEAITRRAPVSAKRPAENI
                     HASVVSGLRQGAIACLENNLCTPSSSVSQKAVIDGLEPVGKGRFARNHDTRRGLEGRN
                     KDQQSTGTALNLEDILMFDEPSQNSLSPKDLLSSAVGILADGLTIANRWRCGGISIVP
                     RTHSMTKKTLYLISYERSIALGGRSSDSATIPSSLSNLLATACMEEGVDHPSRLPQRR
                     KTEIATEAPILAAPLLKAEENQLRAFSPGSETELMINFKSYVSACVIRAVGEALKTGP
                     NLYQLISYDVYARDVQCVAEIASRTPHSVRAVLQAIASSSPEKFSVGALRSASISFLA
                     RHVKRTGGKTYYIHTTGNNAEVLGGDYQPVATRTPNLFLFDYYSAGGECMMLNKRPIP
                     VILRDAAHLSPGGPGDESIRTCAFPEWFVSRATCERFLPGESYAYICVGYDERMRVAI
                     VLPAGFMLAAHAGAEFNWPLARADAVLSRLCSSNTTLSFP"
     gene            complement(29923..30888)
                     /gene="ORF 24"
     CDS             complement(29923..30888)
                     /gene="ORF 24"
                     /codon_start=1
                     /product="UL18 product homolog"
                     /protein_id="BAA82912.1"
                     /db_xref="GI:5689288"
                     /translation="MAASNGTTVEIELPCGLSTCDANLLQRCEGRVLFLPSVRARVLL
                     KEVDYKSYYIAGAEPDTLSLLSTYKRRFAAVVTRALPGRMSAVVLGMGTIPSGLALQN
                     TGPFDLCNGDAVCLIPPLFPNVCSRIRLESIDTELLFPSTVPARLAREIIAKTLSRAT
                     EGIAIGGGLAPPPTSREAESITYNGKTYTISPTLHSLDASESAVRTLLLNMIFAIDEG
                     NMLLYALIPTLLTLGASDGYVNALVGLQTATRAVGQLIRIPRPPPLQDAWRRYPIYEA
                     LSSWITMALHLGDMLALRPLLKVCTFDGPASIKVGDLCPVISNWN"
     gene            complement(31017..35195)
                     /gene="ORF 25"
     CDS             complement(31017..35195)
                     /gene="ORF 25"
                     /codon_start=1
                     /product="UL19 product homolog"
                     /protein_id="BAA82913.1"
                     /db_xref="GI:5689289"
                     /translation="MAGCRCPPATDCPPIAPCAISTPFNVGATLAPTGRLLTAIEMTS
                     HRCMFDYFKQFSSDDNGRYSAQFDILLGTYCNTLSLIRFLETGLSVACVCTRAPDLLY
                     MREGTVQFEIQQPMIAREGPHPADQPLYTYMVKRVCKRSLSAAFVVAAEALALLSEVS
                     LDGTAISNHLRLRAIQQLARNVRTILDSFERGTVDQMLRILMEKAPPTPLLIPLSRST
                     TEGRVNGQVMRANLVSELKRRVCNDTFIMSKAGASKDSIVSFLAKMVNSTHQTIAMPR
                     LTHSDSKGRLVDGVLVTTSMVRQKLLSGILDMADTSARVPVTYGEMIISGTNLVTAVV
                     MGKAIRNMDDIARYILNLDENDIIDRTDEVVRGDDDVPQTAEVPAELVTIGDKLIFLE
                     AMERRVYQATQVQYPLIGHIDLTFVMPLGLYQKRADRYARHIGDYAPGPGCQGDVRGF
                     PPRELYFHNKDNQIISVCLSDAIGTVCHSSFLDIEATVSHLRRDRRDLTCVFGAYVTN
                     PPALPLREASRRFFENIGDVLCGSPRWVDECHMSQEQFLSAGNPHLSMELHPAFDFFV
                     VPGDVELPGPHNVPQVMASIAASWRVCNCNTPLPLCSSDFRDALGQELASSRHKMSAS
                     TINAVCATFSDVSYPTAFYVIEAVIHGSERNFGILMRLIIQCIRSYWDNCKRVAFVNN
                     FHMVAFIDTYLCSGELPEDCTNIYKELMRHVRALRSIVKDYTVQTDSLTGQSNEELNH
                     ALIDRAILPPLLWGCDPLMYQAHGVRDRNLYLNVGSDENYAVRPWLELQDADFERTGN
                     VLVHNRPVGDADRQTFAPHHTHEWSILSKIYYYVMVPAFSRGQCCTMGIRFDNIYATS
                     QSVIIPDIQPDEEPPLGAEDPRHPLNAKNLVPNTFNVLLHNARILVDADALLTLQETV
                     NNMAERTTAILYGTTPDVGGTSSATRHMRTFDGALHHGLLMMAYPCNDETIAAGTYFY
                     PVPVNALFACQDHLTAVGELAGNARTLLGRAPPVPQFLGANYYSTFRQPVAQYICESR
                     CGPNEMSYALMAGYFKLTPIGLYHQLRTGFHPGIAFTVVRQDRFLADMGLFAERASES
                     FFLGQVSVSKRPHAGGVQFSLTQPRANVDLGVGYTATCTPLLLRNATTDMGNTVQSLH
                     LTRGSPPLINPEADDFLRKAATRGQRTAPQRTVPFLGTLMPMLPDGLEHGQMSICEFI
                     PTPVSADLEYFRTPCNPRGRAAGAIHSDEEVSDIEKLMYDHRQGDPAYPFRATNNPWA
                     SQKFSYADKLYNGTYNLSGASPLFSPTYKFFTPAEVCCKSRCLDKLISEAGSAVAAFA
                     SDGEVQFKRPVGSTELIEDPCSLFQEAYPLLCATDKALLRTYFAGGADNPETHLAQYL
                     IKDASPIGGCLPAC"
     gene            complement(35488..36192)
                     /gene="ORF 26"
     CDS             complement(35488..36192)
                     /gene="ORF 26"
                     /codon_start=1
                     /product="UL20 product homolog"
                     /protein_id="BAA82914.1"
                     /db_xref="GI:5689290"
                     /translation="MPWYRRGYHTTKPTDCDILLDYIGDEQLETNMQDTESIVTRVSD
                     DIDCEDAAEYATMSSYLSGSIFTISKSCDMNPKFTRYVVLSWLSAFVLRPSCCIIFLV
                     YAMDGHDNRFLILGATITAVFYGTLLLETYYMYRNIKNDVMPMDNCQQIFVGILSTLG
                     AVIFGVFSYRMVFQDPRFMEKVLQLEENDKTDGAVVYLLMGATITYATVAVSDALGFL
                     LPRLWTRALIKTCVPF"
     gene            36301..37899
                     /gene="ORF 28"
     CDS             36301..37899
                     /gene="ORF 28"
                     /codon_start=1
                     /product="UL21 product homolog"
                     /protein_id="BAA82915.1"
                     /db_xref="GI:5689291"
                     /translation="MDIKYEQKILYRNVHFYISECGRIAYFFCGGCLMAVGRPPTDDS
                     QAEFAKFGLALRGDGESKPLAAYVRRELLRRGMKWALPPGDDELFIDCMAFLNLDGAC
                     SEREICDLVCLETYDPEITKHMVSTNVISGLLIQTAHESPRDCVIHLPGAPQVTDAHS
                     NAVYECNSGAFVLTCATLVELPTSLNDLVEGLFDGVPIPRDALSSRSLSRRTNVIITS
                     TKAAETTTIQRMHVPRHKQRGNLNTIAATLRPVKKHARFSPFVQVKYIPRVLKIWSCD
                     SDSHSPSLKELRELFCKVDMVRRENMYAESQLEPESVTSELVLIVDTVFGRPLAPFIG
                     VGSENIRVSHFQKFLLLQGVLILNRLPNCYGPLRELCIQHAPAGEESPPLVSDSVIAD
                     MANHMFRVAVFIGMVVEIVAGCVSFASEELETRFPSATAFTDAGILLNGIEASPKPNC
                     LSELKTRKLALILDGIYRDMDPIDVALQESVGLNTAELLSAAIDISVMSAFEHSGWCS
                     GYMEHFVSLLDARLREGGCLAIFR"
     gene            complement(36498..37319)
                     /gene="ORF 27"
     CDS             complement(36498..37319)
                     /gene="ORF 27"
                     /codon_start=1
                     /product="MDV2 ORF273 protein"
                     /protein_id="BAA82916.1"
                     /db_xref="GI:5689292"
                     /translation="MFSDPTPINGASGLPNTVSTIRTSSLVTDSGSNCDSAYMFSLRT
                     MSTLQNNSRNSFRDGEWLSESQLHILSTRGIYFTCTNGLNRACFFTGRKVAAMVFKLP
                     LCLCRGTCIRCIVVVSAALVDVIITFVRLLSDLDESASLGMGTPSNNPSTRSFRDVGS
                     STKVAQVSTNAPELHSYTALECASVTCGAPGRWITQSRGDSCAVWINNPEMTFVDTMC
                     FVISGSYVSRQTRSQISRSLHAPSRFKKAIQSMNNSSSPGGSAHFIPLRSNSRRT"
     gene            complement(38067..40583)
                     /gene="ORF 29"
     CDS             complement(38067..40583)
                     /gene="ORF 29"
                     /codon_start=1
                     /product="UL22 product homolog"
                     /protein_id="BAA82917.1"
                     /db_xref="GI:5689293"
                     /translation="MCVTLLRKPELELAIRRGNDRRRVIGMAVCTLLLLALASSPGAP
                     TSDNIPSVWSLLDIRRPPSVKLDFSSADENATSPTSWVRDNATFVYIGASTPASGILF
                     HLPISEVKQMVFFKRPISRLLTSNNLIKVLNAKPDLDYSLTAAVLSHRRDEKKTPDKP
                     GPKAHGGAKSQPTGANPPTVLENIKPNDFFTPENRFILNSELSGAFAKRACFVDPMDT
                     LVPTDYAHVRTTIFGSNTAEVLMKVGVQFASVTISMEAASPVELILSSGTTNMTLLWP
                     PMKQYDPMNGSSRHLLSTYLLGTYQNASDMELKAHADMVSSVDDLLDYNLHITQAHSR
                     LFISASMPASTSNYIHGFRIVTTRLFLALVASVHAAFKSGYVSLDELIKREADLKVIA
                     AALCNFAPSTDPGTCFLLSRTHVWNEKAAILTSVLKKKISDVSRGTHSLGIARQLYLF
                     RSVYAFDIPREKGEWGARISDLALNFITSLHEESVRDAISWNASTRHALYYAFDSVFQ
                     RSPMEWRASHNARKSLLFASSMCTEEHIAAAELTVQDMYIRLTRSTEPVHILDAYTPC
                     MTSLRIDISERRHRVYAMANVVYRPVIEEYLENTSQGVRIEEDLQAKAESVIAKLRTS
                     IGRTVATYASEVLECSGTDRLESDTLLVLPISGIGSYIVTRRAGVRGIVYTVDGVDVN
                     NQLYITYARLPCTSTSGIISPAVLPRPLGKECPYCGCVLLRYSASGHVRHAIYISSRD
                     LQRELLAAGNSSVRYFNPTTSNLYGTSLLLYPNGTVVRILAFESQRIAILSATYIATT
                     AAGVLIAAAIAIVTAKMLVSNFRYHGYEKLRRKDDLEGPI"
     gene            complement(40696..41754)
                     /gene="ORF 30"
     CDS             complement(40696..41754)
                     /gene="ORF 30"
                     /codon_start=1
                     /product="UL23 product homolog"
                     /protein_id="BAA82918.1"
                     /db_xref="GI:5689294"
                     /translation="MSDVRPWSVMPSQMTSAQLIRVYLDGPLAIGKTSMLNEVPSHSA
                     TGVPVLKVFEPLKYWRRYFTDLVAAVNDASERRRRGELSLFQSSMIVMALQAKFADPF
                     IVLHERISSKCHQLAGTRGNPSLILIVDRHPVSATVCFPIARHLIGDCSLEMLISAIT
                     RLPHEPPGCNLVIAHLPDETEHLKRLSARNRAGETTDVRMLRALNAAYSALADTVAYA
                     NCICPYSKDEWETEWMQLPWFDASMASTFIDGPRSGYHGSRVSLQHTLLPIFKRKELC
                     SEDGSLLTVYGWILWGMLMKLRNINVERLDVSDMSVQKCAEYLMDSMAERLITHMSWN
                     DVFEIEADVQAFNKEMDI"
     gene            41673..42623
                     /gene="ORF 31"
     CDS             41673..42623
                     /gene="ORF 31"
                     /codon_start=1
                     /product="UL24 product homolog"
                     /protein_id="BAA82919.1"
                     /db_xref="GI:5689295"
                     /translation="MARRGRRGSAARMSSERALPTTAARPTCPARKKTARRRYNRRRS
                     TSGRSSYRAAVNLKRTLAAGVRCHARFYQKLYAESMHLRTQADDWTGRALSKILGKIM
                     GFDVFKAATDFRLVFEVNLGRRKPDCICMIRCPRGLWEASCDGACVIIELKTCRFSNN
                     LGTASKKEQRLTGTKQLLDSKLLIDYLAPVGSERIFICPLLVFVSRRKLNVLRVTCLR
                     RNVVSTDFHRLATLITLASEYKIKQVDRRRTAVRKPAQCARNFASLENARRDDRSEEV
                     EIHTFPNCSIVLPPRTILPGAANTTMHRLASIVSCLVRKQ"
     gene            42747..44531
                     /gene="ORF 32"
     CDS             42747..44531
                     /gene="ORF 32"
                     /codon_start=1
                     /product="UL25 product homolog"
                     /protein_id="BAA82920.1"
                     /db_xref="GI:5689296"
                     /translation="MASFAWDARILTDPGPESHPADVKNFIAPPWPLHFWREPIFSGN
                     LGDAERQLAIVKARNSAAIAALTSLDDRTDLIAVEVERRLRPLEDKMEQIATTLADLE
                     RAASAAELADAAADEAQNVVDSNECQKNIGSAASREVQIVRNDPSLRYDSNLSVDLLN
                     IIYASRGAANSGVAFGTWYRTLQNSLIAENPSAARKIDYRDGRMSRTFIATAITSLQS
                     CGRLYVGTRNYSSLESAVLCLYAFYTKTGANVSHPSSFKSALESVPIYLDHMSASLAS
                     TDTRQIYGFDTGKLPKDSFAAPSGKYERGALSDHSVLRALANSRVLPPSAGSIPRGDV
                     APELDADQSVRNDEVNAAAAALLGRAQPLFLMEDQTLLRATLDTIVALLLLRRLLWNT
                     NIYSARVKNQFQLGAFVPGVPPDLTVGASVDTPGDVIKSDGRNLTFLFQRYVVPVYSV
                     VKGIELTQLFPGLVALCLDVPFSDRGLYSTRTPPSRIIDVSLSKYQASLVKLISLELQ
                     NRSRANVVSVCEVIATHDLVTLQYERGLESLMQVQRPRTRFFETKKALAFNVETDYDL
                     LYFVCLGYIPRSVSASVKYTQNIGTCPA"
     gene            44549..46468
                     /gene="ORF 33"
     CDS             44549..46468
                     /gene="ORF 33"
                     /codon_start=1
                     /product="UL26 product homolog"
                     /protein_id="BAA82921.1"
                     /db_xref="GI:5689297"
                     /translation="MNPTEKYSSVYVAGYLFLYGADDGSELHIDREDIRAAIPTPAPL
                     PINIDHIRNCTVGAVLALTDDEHGLFFLGKINCPVMIRTLETAASQEIFSEFDNLKTE
                     ERVLYLITNYLPSVSLSSKRLEPGEKADKSFLAHVALCLLGKRIGTIVTYDLTPENAI
                     EPFRKLSPTTKTALLSEGQETERLLGDKVWHPSKEAMSTALLGTALNNMLLRDRWRTI
                     SSRRRMAGISGQKYLQASAWTALAESMTSNNASTIHPIGETANSDGIQKDDRIEVCAT
                     SPQTNKTLESRAFSGGSGFAGTHAISPPPQMSAQSPTEMSMNTKSHFPPGDDFIWVPM
                     KSYNELVSRQATHAINAPEAAVGSQAPYSSSPLMIPAHLGQHAHIGGYGHASNPQFAS
                     GAINYMGGFPYALPIHPVPTGQSSLETKLSALLDCMTREKKSVDGDRGRDDMFSGQEE
                     RGRRGRKRPYNCDKSPEQEPYYPGEFQQSEHRNLRCEDGIEYGRDATQTRPALAGLVN
                     AVTSLQKEVERLNGRAQAHSIPAVQHMQGMGTGFQAPVYYAYPPLPIPHVFSRPPEDG
                     RPISSGEGRASLGSATGTPPSGSVPPNASQERVDAAPKSDTVQSQDTVNASTIANVHR
                     ADDAGADIFIKQMMA"
     gene            45467..46468
                     /gene="ORF 34"
     CDS             45467..46468
                     /gene="ORF 34"
                     /codon_start=1
                     /product="UL26.5 product homolog"
                     /protein_id="BAA82922.1"
                     /db_xref="GI:5689298"
                     /translation="MSAQSPTEMSMNTKSHFPPGDDFIWVPMKSYNELVSRQATHAIN
                     APEAAVGSQAPYSSSPLMIPAHLGQHAHIGGYGHASNPQFASGAINYMGGFPYALPIH
                     PVPTGQSSLETKLSALLDCMTREKKSVDGDRGRDDMFSGQEERGRRGRKRPYNCDKSP
                     EQEPYYPGEFQQSEHRNLRCEDGIEYGRDATQTRPALAGLVNAVTSLQKEVERLNGRA
                     QAHSIPAVQHMQGMGTGFQAPVYYAYPPLPIPHVFSRPPEDGRPISSGEGRASLGSAT
                     GTPPSGSVPPNASQERVDAAPKSDTVQSQDTVNASTIANVHRADDAGADIFIKQMMA"
     gene            complement(46592..49189)
                     /gene="ORF 35"
     CDS             complement(46592..49189)
                     /gene="ORF 35"
                     /codon_start=1
                     /product="UL27 product homolog"
                     /protein_id="BAA82923.1"
                     /db_xref="GI:5689299"
                     /translation="MNHFSGICVPLFISVVFYFFGRVARAQNVTSREAVSSVQLSEDE
                     SSFFLCPPAVGTTVVRLEPPRKCPEPLKATEWGEGIAILFKENINPYKFKVTLYYKNV
                     IQTTTWTGTTYRQITNRFTDRTPVSIEEITDVIDAKGRCSSKARYLRNNVYVEAYDGD
                     AGEKQVLLQPSKFNTPESKAWHTTNDTYTVWGSPWVYRTGTSVNCIVEEMDARAAFPY
                     SYFAMANGDIANMSPFYGVAPPEAAAEPMGYPLEQFRQIDGYFPMDLSKRQKASIPVK
                     RNFLVTPHFTVGWDWAAKTARVCSMVKWKDVTEMLRATVNGKYRFMARELSSTFISNT
                     TEFDPDRIRLGQCVKRDAETTIKRIFAQKYNDSHVKVGKVQYFLALGGFLVAYQPVMS
                     KSLAHMYLRELMRDNRTDELLDLVHNKHALSNKTNVSLSRLRRELRNAPKEKLALNEG
                     ATIRSTSSVQFAMLQFLYDHIQTHINDMFSRIATAWCELQNKELALWQEGMKINPSAI
                     ASATLGRRVAAKMLGDVTAVSTCTGIDAESVTLQNSMRVATSTNMCYSRPLVLFSYGE
                     NQGRIQGQLGENNELLPTLEAVEPCTANQRRYFLFGSAYALFEDYNFVKMVEVADIQT
                     ASTFVDLNLTLLEDREILPLSVYTKEELRDVGVLDYAEVARRNQLHELKFYDINKVIE
                     VDTNYAFMNGLAELFNGMGQVGQAIGKVVVGAAGAVVATVSGVSAFMSNPFGALAVGL
                     IIIAGLVAAFLAYWYVNKLRGNPMKALYPVTTEELKSQATRELHGEEPDSEKAPIDKK
                     KLQKAREMIKYMALVSAEERHENDLRKKTRGTTAILSNHLTKLRLKSSGQHYDRLSPV
                     YSDSEDDAV"
     gene            complement(49189..51624)
                     /gene="ORF 36"
     CDS             complement(49189..51624)
                     /gene="ORF 36"
                     /codon_start=1
                     /product="UL28 product homolog"
                     /protein_id="BAA82924.1"
                     /db_xref="GI:5689300"
                     /translation="MPHGNAQALDVERDSIFASQKLLAVWGQLQSYLFQVELLKRCDP
                     RVGVRMIKPLKLNVLMVRYLENLMAPGLTEQLERNISPLSYGLWLALRRARLDGEVLL
                     RALCEFTDTGDVHGFFIKSMTISGDCPYHEVVELDTYGGSVRTEIKFLHDVENILKQL
                     NYCHLIVKAGTAENFMLALDRYLIETLGAGSVVSPELCDPSQPCSVCFEELCVTANSG
                     DSAHKRIIGKICNHVTKQIVLRVHPDDMVAHIPHAACLSDEKRSVVQAALSLIRPTRG
                     DKDPGGSGDTVSVADAATAVLDAHNVFLPASGNLYAISELQFWIASSERKPNQPRANT
                     IDSFADNLEDLAFKERLFDLRTSVVEMTVFGRRMDHFERVFAQEIENMNAADRLLLGG
                     RAVAPDDIIEALIRACYDHHMSTPLLKRLLYPEEAAQDALKTTLEQVTSHSTRNGPLC
                     QDGDGAPEDDFSNSEHLRIREGVTPLPDVREHYDWLELVRSASADVARRRKMYAERLS
                     KRSLASLDKCITEQRKELEKMLRVNVYGEILIDSYTTLFNGFRSRNRLLEAIRKRCTN
                     IIDNRITADAFDAHRFMQTSLLKHRIDPAMLPSLTHKFFRLLNGPMFNHDVHRFAQPS
                     NTALYFSVENVGLLPHLKEEIARFMIHSCSSSDWIVSKFRGFYDFDGIDSITAAHRMA
                     WKYIKEVILATTLFSSAFSCGELHLRRADCLPLNVNVEYIWEDGIYVTYETECPLITV
                     LGAESDNVTVILDADVFSLLYSILQYMAPAAAIRYVRNEQTMTTPPLDQCDIFRTAAR
                     LSTLSMRLVKINP"
     gene            complement(51951..55523)
                     /gene="ORF 37"
     CDS             complement(51951..55523)
                     /gene="ORF 37"
                     /codon_start=1
                     /product="UL29 product homolog"
                     /protein_id="BAA82925.1"
                     /db_xref="GI:5689301"
                     /translation="MDVGKSVKITGGPIGYVYAAPTSSMPAEDLSIFAAKSNDCEDAI
                     LPLVSGLTVEADFMWNVAAVAGTKTTGLGSGSTTLKLVPTHYHPCVFVFHGGECIKPC
                     TKAPNLTKACDLARGRFGYSTYSPPVATSFETTGEQICDNLGMNPQETMLYLVVTELF
                     KEAVYLCNSYLHYGGTGVVSINGVDVRRMPLYPLHLVFPDFNRVASDPFSTKPRALGE
                     GALMPKAFYNDSLCRLLHGYVLSTAAVGLRVRNVDAIARCAAHLSFDENHEGTLLPAD
                     TAFNAFTPIESASKSQYKAGKKEGMELSGGGYERRTASLMASDATLSIENVIATSVYE
                     ESIPDVKKWPLYCSPIGYTDRVEALSAYMARVAGLVGAMVFSSNSVIYMTEVGEASSA
                     DGKDTSTTAASFYRFFQIAAPHLASNPLIDRDGKPIPGEDLSKATSASPSEYSLDYLI
                     LACGFCPQLLARFLFYLERCDGGSQACHHDLDTVKFVSSAMDADVPCDLCDKASRIYC
                     AHTTIKRLEYRLPKFGYQMRGAMGLFGSMTNNYCDVNALGSYAPFSTLKRSEGETSRS
                     VMQDTYKLTVERVMKALEKEGLLTCEDPADMTPADAIIRDGKSFMRALSTMANIIESE
                     AGQLMRNLTEIREYNIREGLGDATHTLSLAIEPYSSGICPVLSFLSRRTIIAVVQDMA
                     LSQCSMIMHGQQVEARNFRTQFQAVLRRRVLDLQNAGFITSKNITVTLEDQQISVPDP
                     SKSQHDPLAVHMEGDLVKVTFEIFREFKVKNKVMFVGGVSSTVSDATKSRLAGMIEAY
                     QRPAKAMHVLNGPLGFALKRYHTQLFPNVKMPNGTTPNALWFWILLQRNQLPAGILSK
                     DAEENTSFIKRFTNSYADMNYINISPTCFGELAQFYLANTILRYCSHKHFFINTISAL
                     VATSKRPRDPAMVLPWIEHILTQGSDVAPAAQQLLKNICDHKEAWCAAFSSTNLVGPI
                     MASKPFVVIAVSISKYHGMAGSTKVFQSGNWGNIMGGRNVCSIMSFNRTHRFVMACPR
                     VGFVSEQTGFSSGLKETTLVDRARAVLSEECGAPHAAVYMIALKMVGDRVRQMELDDW
                     MEITNDAYISSLIDELNKQVEGCEGGWSVDAAAILAKEMVDMSKALPLDGPTFNYDAL
                     DENTERRADGPSILEPTLKRPCSDVFDLEPVPEKRAPGLSVDML"
     gene            55773..59345
                     /gene="ORF 38"
     CDS             55773..59345
                     /gene="ORF 38"
                     /codon_start=1
                     /product="UL30 product homolog"
                     /protein_id="BAA82926.1"
                     /db_xref="GI:5689302"
                     /translation="MSVDGARTFFNPYLGARKRGRDEDSTIPPLSRPRDGERYLRQHR
                     NAITYIATIDEFKYIAPKCLDAAEIKQRGTHIGKLKRSPILYKNGEEREFLNFEALGD
                     AWPRRCFSWNNVSFLPTEFDPRFSRFHVYDMIETVEFANGATGRDKNRFLELLRPMGT
                     IITMMGMTECGRRVAVHVYGVKPYFYMRKIDVDTACGSRSTRGLAEQMASVVRSSVNE
                     SARKRFYGSSTVTADCFEVDVVRRKDIYFYGTDCEEYYRIRCQSGKFVALICDNFHPS
                     IIKYEGSVDTITRMVLDNAGFSTFGWYSLKIGNCGEKVQVRAPQHHVTSCDIEINCTV
                     DNLIGHPEDDHWPDYKLLCFDIECKSGGANECAFPVATNEEDVVIQISCLMYSVRQKQ
                     LEHALLFALGSCDLPETFQETFRDTYGVLPEVLEFVTGYNIVNFDWAFIVNKLTTVYG
                     IRLDGYGVINQRGTFKVWDAGANAFQKKGKFKATGIIALDMYCIATEKLKLQSYKLDV
                     VAEAALGERKKELSYKEIPTHFAAGPSQRGIIGEYCFQDSLLVGKLFFKYVPHLELSA
                     IAKLAGILLSRAVFDGQQIRVYTCLLRLAGSRNFILPNKPQVRAGTEFENSIASTDEF
                     EGEPSPSNPKASSSFHGNGGRVVGYQGAKVLDPISGFHVDPVVVFDFASLYPSIIQAH
                     NLCFTTLINDDRKLADLRPRDDYMEIDVQGKSLHFAKPHIRESLLGILLKDWLAMRKA
                     IRAKIPASSDDTAVLLDKQQAAIKVVCNSVYGFCGVANGLLPCIDVAATVTTIGRDML
                     LTVRDYVKVKWGTRDALLREFPALTNYMLGDDYSVSVIYGDTDSVFIKFKGVAIQGLV
                     ANGDDMAKRISSDLFPKPIKLECEKTFDKLLLITKKKYMGTIHGGRMLMKGVDIVRKN
                     NCRFINTYAKKLSDLLFQDDAVAKAAALVAERPSSFWATAPLPEGLKPFGDILAEAYG
                     QMTASTLSDVGDFVMSAELSRPPQAYANKRIAHLTVYHKLAMRSEQLPMVKDRISYVI
                     AAATPEVLRDAERVAEARGERKFRFSEVSVPEVPGTFSNSAKTRAVQKPKVLISDMAE
                     DPTYLIENNIPLNTDYYLSHLLGTLCVIFKALFGNDTKTTDTVLKRFIPETYTEDRAY
                     ATRVARAVFAEIRSGAGLSSSEEEETLQRLNRAFRILTEVRRRY"
     gene            complement(59269..60183)
                     /gene="ORF 39"
     CDS             complement(59269..60183)
                     /gene="ORF 39"
                     /codon_start=1
                     /product="UL31 product homolog"
                     /protein_id="BAA82927.1"
                     /db_xref="GI:5689303"
                     /translation="MTGCIFIRRRSVGRSGGIARRSRRQWRDLQAPACGTKRGSRKPD
                     VDLYRAYFDFVEESPSEELMVVKDLAVPIIKTTPVSLPFNMSEAVADNCLSLSGMGYY
                     LGVGGCCPTCTASGDPRLGRNDRASLILAYVQQINNIYHYRNFMASIVALGGRMGCGE
                     ERGKDSEIALSRILAIPELFFAYYVLLDSGMKNVKVLFYLDQEAGSLEYMMYVVFPGK
                     ALHLHYKLIDCLKTACKNYSIIAHVWRGNFLLVIRKEYDRQTDSSDVPAVNADDVYCK
                     LCDINIDGELLLEYGKLYSVFEEFLPPR"
     gene            complement(60200..62080)
                     /gene="ORF 40"
     CDS             complement(60200..62080)
                     /gene="ORF 40"
                     /codon_start=1
                     /product="UL32 product homolog"
                     /protein_id="BAA82928.1"
                     /db_xref="GI:5689304"
                     /translation="MAHRTVELPFIRSPGASASEGWVEESLKCPYIAFDPEILTYNDT
                     LFNELLLSAHAIKTNSLQAGQSCSGSESAEDCEDGIEHQELATFIGTAAEVFALDRQC
                     LVCRVLDIYKHKFGLSAIWMADYAFLCSKCLGSPPCATTMFIAAFEFVYIMDKHFLVD
                     HGCTLVGSFGRKHLTFEDIQRHFFLHGCFRTDGGVPGRRHNEVIVPRANQGRSAGKRG
                     RSLCAGDAKVLYSNYSYLAQSATRAMLTTVSDMGHSSYEGQCDTAAGHESKRKVPQTG
                     QTVGSIPTSLSVALAGWKDCARSVECNFSQTESCIIRALSDDDIYERELQLRLSKALP
                     DGENDLGALAPCTNRSQYTERSSGEDSTMGYTNLVLLLLSGTGSAPDGASELALMAAK
                     FRKETVSKFWKDNRIDLARGATRAYSHCYEDDSEPDLELGPLMVTQLKHAITKGGTSA
                     ECLLCNFLLIRTYWLAMRQFKRDIIAYSANNIGIFHSIEPVLEAWGTQERNADFEDDG
                     YFVALLKGTGTEAIYKHFFCDPMCCARIAQTNPRSLFDHPDLASREELALHKARLASH
                     NRFEGRVCAGFWALAYTFKTYQVFPPRPTTLSAFVKDAGAFLQRHSISLISLEHTLQT
                     YV"
     gene            62079..62474
                     /gene="ORF 41"
     CDS             62079..62474
                     /gene="ORF 41"
                     /codon_start=1
                     /product="UL33 product homolog"
                     /protein_id="BAA82929.1"
                     /db_xref="GI:5689305"
                     /translation="MAAETNTRQVDTPRLADAIPDVELLSDDVDKLAERYICDGIVYR
                     VWFEYLIPDELDLIFPTTDGKFNYLSFTRRLASAIRHGRAGAGSATPTSFISAERVCD
                     HGAVLRGRSERFASVINRFLDLHQILKDC"
     gene            62542..63381
                     /gene="ORF 42"
     CDS             62542..63381
                     /gene="ORF 42"
                     /codon_start=1
                     /product="UL34 product homolog"
                     /protein_id="BAA82930.1"
                     /db_xref="GI:5689306"
                     /translation="MMSAPQSKPCRRAGLIARIRLIVGGDLTMGNSDPGLAESFSGRV
                     PARCVFQFSGADGVESAFPVEYVMRMMNDWAGGECDPYIKIQNTGVSVLIEGFFAPPT
                     NAARAPLCADKVNVLLNTTDSTGVVLSDIKRFKKSVGVDCRPFQACLNVHCFVRLPNV
                     QLAFRFVGPTDPARTSKLLDSAVASYNSKAKQRFKNSSRAIDNESRPCALHECVPIPV
                     RDETQKLTSQSDIRTPRRVLTILKKISSGEYVTTVRVSIRKIILCLVSVFVVITAWWC
                     YPL"
     gene            63467..63850
                     /gene="ORF 43"
     CDS             63467..63850
                     /gene="ORF 43"
                     /codon_start=1
                     /product="UL35 product homolog"
                     /protein_id="BAA82931.1"
                     /db_xref="GI:5689307"
                     /translation="MSRTPSPQLSPVSQAFDPSDLSTYKLDVLVNYPLSDLVHHLNAI
                     PRNLQVSDRHSDLNAAKINVLRALCVGFSDVRRKNDTRTLQRTPMFAIGDAASRLRPS
                     IGLKRTFPTGIFSTTIINSPADDDA"
     gene            complement(63918..73112)
                     /gene="ORF 44"
     CDS             complement(63918..73112)
                     /gene="ORF 44"
                     /codon_start=1
                     /product="UL36 product homolog"
                     /protein_id="BAA82932.1"
                     /db_xref="GI:5689308"
                     /translation="MAASESRGSTTRPSKKSTRLQPSPSTRRLETSDNSRDSSVSNMQ
                     NRAMRSGTNMDSEVILDEWARMVVDATDFTLVAVGNRNQFAPDLSPGSSVSCLRSSLA
                     FLRVVFAYGLDAVLSTEAIDRLLLQGKEWTIETSRDGRYTTCVPHDLPNRILSNEPDG
                     NLCVAFSSSYGELDFYVDENTSTILETQISARTFIEKVWKQKRGDIYCLIVIGVIGIG
                     VYRSDNGIYIFDPHGHGHIGQACIVRVSEGYFYQYLTSYADPSTAPEWSATFVYFVSM
                     ISSTPPKEEIISAVSRLYGTADIVLDLGRVNEEENIKVVLANLDPPYRPQPTTTRIII
                     GTSTSRSEDIKVAVDSRSDRSPVAAGDVDVRREMGYAEEDAYVLPPEEAPVDAICDIT
                     NHESIVNAWTTAFPDIGDDLSVLTRPDLPKTRENVVRLETDTKSSSPPKQSFERHKRR
                     RPVWTPPSSSENLSVDGQGQSSSRKPSRKTKRCLTYTDNPVAPSISLSEQADSGSSTT
                     HNIPGQEEATRPDNVSFNEFISSQARAEHFVHGQSLRDRPPFNPHTVAGEGDESLRDG
                     LWTSEHVPSSILSDINANIDDLEQSIALSMGMTIHLSRSGDYDGLLDICGLDTFTRLF
                     NYVIENGARTTTEIGSVVEAEMASLFKAFTRPAHFSAFIDSTGMAVSRAGESADLIES
                     VLSENSKIGKLALSKLVLVALEVEELTDALHKTLDSIEREASTADADRIYERMATSLV
                     SAFNSNPGKIYSENTSLHAEQSLTDRVASLCRFIRDRETVARRKAELILAELEALDAG
                     VRLMHASFDAFIMGGSGGTSGSRDDESIAKVSPSVVTQRLTAIERAAVDAVGNALHEY
                     YLKGALYSANALRANVASTSRFKMVVVEQHEKMARLFASLSVLDDVIALVAARSGAQA
                     PPPVTTAPESKLLGDLLENDSNLENPENLAVWKTAMAAVQAGGWISRQEFETLIKEVD
                     AVNNNAARRETALADLDRLHELEARVASYTDLETTADLQKLEEVMKDVVELVKLSNAL
                     GGDKFANLLSSDDRAAIARRRLDAETLIAALQYRYEEIRTLYSSIKLMLRPLQRFAGL
                     RALDSTVKTITQSIPGDTGPLETFLALAPPDVIGTLRTDLWLLFSQYRTILSHPSTST
                     AAELSGLGIPFSLAIRVILGPIGGYPAASVFFGKHADTLSAAVAAARLEPMSVEKTTA
                     AVTALQNAVSDVNRATADTPSTGIMADLPAGQDDAFSFLTVLLSDAEVAAGVAQHGDR
                     LDGLHRAVRAALNSVIASITKVKTSDPKTAAADSDASVIMSARTEIAHALQSARDANT
                     AIAALESHAHVTDPHIQRKIADLAKSVGLVNQRTVELEAAVTTYERNLISAQRSHSED
                     VWVSSIHSLLSNAELKSEFDAMEMSDLEKRAVVAGYDTIRFRARAEKIVMSHGRAIHD
                     AIETVLKFNPFSTPNRILPPIAFLKNMTWLDAFIAAAPYYTKLFGVSCDALLQLIKIV
                     LAILRHADARGGNLDYYTLLGEIEPDVRAVPTLAKYVDFYRNGHEEFTGFLARHEQMR
                     VEALHAAGRVDIEIREALENLARMYSPEGARRALEYGVSIVIPSANAILTITNDLEKE
                     DITAFNGTAYAEYSAHTLQRDIEAVSSIKLRVTTAIEGAKSRAEVILKSLAEVSYAAD
                     RETAEQLANLKNLLRLVAMPPHIAKAIEKAETANDIVTQAAILLSKVEETKELDTQTV
                     EWLKHARSVIDSHELTSRIDESGPMTIYAERIDALADLASRLDELKSELALAEVAWDD
                     TWSTFMHDKDRMDKSSEGFAAARDSAARAKVSSNTINALRDNAEYARLPAKIIGLIDA
                     KYRDRAGVMDAFLAALKETESIQKQMDTLCAKIPPTFVLNDLSTIASQFDILSKRLPK
                     WYVRHVTRYSRLVKLRLALYAAYSAILPGVAGCPSLLPSDTGLNADANNRPAAGFVDR
                     YLKHRVAAWIRPSVVVTLQEAFSEIDIPGIHTYLDASDAPLRYSVCYRTVGEKMAACL
                     CEPSGLSLRPAIPSKVMSTRDMVVAAGMLGDIMALRLGFVQAAADNFRAFTKYVRTQN
                     YDWLADGTVKAIGSIYCALMAITLTRKTGASLSDIFFLPGQVAPAADKKGLKKIAANG
                     RPVRLELADVMVAIMTCMPGHVLTFSQLDLISQYDFMDKTLYGAINESLSTTAFINCL
                     STQLSKDAPSDSNCRPMSLTGGAWDPSGGSLFALRYSDWKQGSLSETDPLKPWEGVGG
                     ATSTGLAKIRAVVPSNLLTTTTVLARMCIPPTALAVMWSSLLPAEIEQSCRSYDDVVT
                     ARGDAASTLDVTTSSVLRPADKTIPKGSDGPNLYEPTGVAMTFTVTSTPPSGVLKVNA
                     MDLAAAATLFGARIVIAAECPEAYSSGSGLNLCVRLFDSRSGSEGCFLEPAAVSSDTT
                     SWGGKLLADDSNPIENACLGQQLEHLSHLIASKPLSSAPPCLVIVDTGMVPVKVLWPK
                     TVFDPIPVIRLTSSDDAVLSELPYIDAGIRVETGASYDDIAVLDRQDAANFFSDESRQ
                     YPIPVYNKSRDGDVEDVLSIGTASEDEELPGNDFSRDRESMWDGMAAEKDVYDNAETG
                     FLFHKELNDRSDRVVPENVECPSTVSTDASDGASSKLAFHYKLAPPNNETLSPSLLSP
                     ATQKLVVTKKTHNEQSTYAAVGIEERQKGRPVKHIDVSERSHDMPKPVYRGRLKFTDT
                     AAACNAPGCALDQKSPAVVISDNSVRDDRKKHGTPNIPHRSDSDSTSTPFVVASSTKS
                     LIPDDEDGGIGIRALKPSRAGTRIDSIGRISDKGAAVVRPNNASRPRCDTLGGLASVR
                     RDSSPLLQRASPAVITADLNLEPVDRSVDISTAPGGKKQAAVGSPAHDGLYDHFAFAP
                     PDVILADLRRRVVRFWETFCRDPRTSSSQSKPINTCRRSPCKATTAKHDHHNMYRGFV
                     VTEAEAGQNKQQDSNIDPERYLFALESLSSVDSNTDGESQSSVPDSDRSSTDESSASR
                     VISADRLLTRRDFRQVGRSALYALTRACEKMARQIAHARQQLRARIDTLTIEIFKIKM
                     LLTG"
     gene            complement(73300..76422)
                     /gene="ORF 45"
     CDS             complement(73300..76422)
                     /gene="ORF 45"
                     /codon_start=1
                     /product="UL37 product homolog"
                     /protein_id="BAA82933.1"
                     /db_xref="GI:5689309"
                     /translation="MSETQGEARFPLKTLLDTLRSLSAGTAPLEPWGNATAAEARTAI
                     GSFFQALETMSIQQVESTWRDAFAAVLEVYKQTGSPEAAMLAQNFVGFILWRTSVRWD
                     KMSWKDDSRRLRRLAAEMTGEEAIAWLTRNGLRRSCPFGPSVLWPLISEWLTIFEEIA
                     TDAFDYTSEGLLSGRQPAPNALELPASLTQTRFKLIYDFPFVQEGIRLISIAVGWITP
                     FVIMSRCTTNRAFTPLTRILFTLALVDQYFKSPRSPHPSQLKDLFAEDASALGSRELI
                     SAVEANNMKRTAYDVRASAAIAYGDPYVYAVQPGMVAEKLRNGPDIILADHALTEDAL
                     AIHMSAVVRLITDGDLNDGGGALDAAKAKLSESARRAWGAVQHSSSPRQLLEALIERG
                     FVRQACRVYESALKANLGKTRGTVNELDTFDDVQQVIGNIVFGLMESYGPGMTYLTNY
                     MDNGLPPDADSDFIKVLGLDSAIIAQILGRCIPPNPHEDYVKSARAILAAEMDSAIRQ
                     SGAGTANRAIQFAKESLMLWFDSRAEHIWGIVPPEELIGGEPSEHLASVDHSDLESIS
                     GPNAVDPDLESRMIRLAMTIRYPESMPITPESTTPHFLRYILATVCVDALSAITTSVF
                     SERPINTVIEILTWARDYGAPYIGSFVNHRNKLNALISSLAPFARDLTAKPTTDDAYN
                     LEMLMGELYDVVYAAVQMVPPETRPIMPPRPEISNSLLLISMHGTALGLQFNYLADRT
                     LKCAAYLADDSRQLVKFAYIFKHFFACKFAAGTAGGTVTVYRRGEPRANFGTWKIVDV
                     LSALREFYDSSGDVMANVRLKSMVLRTLIEETGKQVHTCDNLMERAILFSVKAASYFS
                     TLGTDYARLARLQNSLDLHVRALTSCSTPPGTGDIVWLLDKWQTLSEINSTFRDRSSQ
                     DLASAIENVGVVWQKIADRIEVPRDMEDRVTNDEIDAAVATLLGRLPVVTDDSPALVV
                     ELTSRHNLTHRDELNFDTLDLDTVAHDDVDLANFAKDFLIKPRVTVDGLVDIVDTVFN
                     NERQARDRNA"
     gene            76792..78204
                     /gene="ORF 46"
     CDS             76792..78204
                     /gene="ORF 46"
                     /codon_start=1
                     /product="UL38 product homolog"
                     /protein_id="BAA82934.1"
                     /db_xref="GI:5689310"
                     /translation="MKTTFRTSDVQASNTQSNASDRLHDILRSINNSMHSGIVRRINI
                     GYPHAGNRRGTLTAGLELLSNTITTTPPGANIHRSIANSAGERTATIIQSLRTYSGSG
                     DLNTNGDNNVLSRQISLTDFCFPDAEMPGLIVLSMRHPLDINSEHLYSTPAGRDPRAL
                     ESAWYELSELAAVSVNRLDGSGVRPSLLSLSFLIASRAGDYADKCGAEAVRAHVISNY
                     GRRRIEDRLDRFGSCQAAMLRCHVFPHRHMQVLGGMVSWIAQREIASITAVVKGSQES
                     ARTEQTNNPRSSVYVPACAYLDLDKEIHMLHDDRASSLLYLVFVYAQHLGRESIRVYL
                     MRSRLGESVFREGLGYLYSGLRAGNAINGLAGIIAPHGVDANTEFPLSKAFEVHKHAC
                     RNTGIGPRDSEKVDWRLDLRGRPTKNSCMYAAYCRVGHLNEYSMPAKKSERCGGSVEV
                     PVVWVPGVVWDIGEWTECYQ"
     gene            78383..80776
                     /gene="ORF 47"
     CDS             78383..80776
                     /gene="ORF 47"
                     /codon_start=1
                     /product="UL39 product homolog"
                     /protein_id="BAA82935.1"
                     /db_xref="GI:5689311"
                     /translation="MQRSDENESLEANRNLDTASRNCTDVQVALIMATKLHRIQQQLA
                     SMGYLSGYDSVPDITTPVKVLRERITHLVNTLKPVCRFDERVYYACGELVHLRIKSQE
                     ATFDAWLMSKKLSLKGEIVDNIQRHRGHVETDMLRFYGVTYPWLKRLGLQSALKYEEY
                     LTELEDGKKESLCQFFVRLAAAAATEASNKKAFMSALGTEVSTWETAFTAFFFALARQ
                     IFVPSTPCMLFLGREGTSTASCYLMDPRTINTHDTLKAIADDIVPHLLARGGIGISLQ
                     HLNQKTGLMPVMKVLDSLVMAANAGERRPTGVCVYLEPWHADIMSALNMRGMMATEES
                     RRCDNVFIALWTCDLLFKRYERHANGEKNVTWTLFDSRASILATLHGSEFEKEYNRLE
                     AEGLGVASLPVRDLMFAIIKSAASTGSPFILFKDACNKHYITDTQGDAIAGSNLCTEI
                     IQKTDGNTNGVCSLVSVNLARCVFDENGEKKFDFSALRRAVRLATVFVNSIMSSSDVP
                     TAKSRSGKDRHRSMGIGVQGLHTALLSMGLDLSDERVKPLNKQIFELMLLEAMTVSCE
                     FCEGGLPAFADFSNSYYSRGRLHFDGWANVGLSMPEEWNALRERIQASGLYNAQFVAL
                     MPTAASAQVTEVSESFLPVFSNMFNKVTTAGELLRPNNQLMGELREIYADNEDRRLKA
                     IAALECANWCVETALGNKPECSQLLKYKTAFEYDQSLLIDLCADRAPFVDQSQSMTLF
                     VTEAADGTLLASHVMNLLLRAYKAGLKTGMYYCKIRKATNAGVFSGNGELTCSSCIL"
     gene            80803..81864
                     /gene="ORF 48"
     CDS             80803..81864
                     /gene="ORF 48"
                     /codon_start=1
                     /product="UL40 product homolog"
                     /protein_id="BAA82936.1"
                     /db_xref="GI:5689312"
                     /translation="MATQARGNEFVSGQTAPLHKNPCPENAAAVLKMEGIEIEPSTSS
                     ARDNYKVSRYFYVPECPDIGHLRALSIMNRWTETEFVVAEDLGDVAKLSEEEKNFYRF
                     LFTFLSAADDLVNLNIDNLLGLFEQKDIHHYYFEQECIEAVHSRAYSIIQLMLFDNDS
                     SARAKYVQSALESPVIQSKLEWLDRRILECTSIPEKYILMILTEGIFFSASFARIAYL
                     RTNNLFVVTCQINNLISRDEAIHVEASCCIFKNYIAGNKPSTARIQALFSEAVDLECA
                     FLRAAAPRDSRLLDIGSICSYVRYSADRLLRMLDVPPIYGEPSPAADFPLSLMSASNN
                     TNFFERRSTAYSGSVSNDL"
     gene            complement(81926..83197)
                     /gene="ORF 49"
     CDS             complement(81926..83197)
                     /gene="ORF 49"
                     /codon_start=1
                     /product="UL41 product homolog"
                     /protein_id="BAA82937.1"
                     /db_xref="GI:5689313"
                     /translation="MGVYGCMHFAYANGLVRSHISGSISGGAMTPIAVDLWNVMYGLL
                     EKIYPGKVDGVDNSVATLRCLYCLLRLLHQRSYYPVFVSDRGFSKYGKTLYGAKALAA
                     TRIARGGGSGRLQVRSRDECENADTGEARNKRTRKPKRPRRWSDKSDTPKILHRLCMD
                     TIRYMGYPYVDVAMMEADDICANLFHTKTVAYVLSSDTDMLLMGCDIIIDLTRIFPPT
                     IYCRDVLAALKMDYFTFLSNFVRCQTDLHCEHTLKSMQEIIDLGTLKQGSGTICGKAS
                     DNERGRSSLMNCCNPEITGGHHYERPADMPDANRDLASNYSLLRSLHPPKTRCEVLEY
                     KFIKHVIATIMPERRTPRISILKRFPIMQDIRDDVAVEELVFRSIPNEAEASVISTAF
                     LRCIPEVRPFDSVLIRYWGRDASQTTRCEKR"
     gene            83861..84970
                     /gene="ORF 50"
     CDS             83861..84970
                     /gene="ORF 50"
                     /codon_start=1
                     /product="UL42 product homolog"
                     /protein_id="BAA82938.1"
                     /db_xref="GI:5689314"
                     /translation="MARITMSDEHIIDDAGATSNDSPNSWKVVLAGEKFRTVSAAVRA
                     IVDSVKNPLIIFSDDGLMIQGTICGQQTFVPIECAAFSEFEWRGSAAIFLALTDSRRT
                     LLDAFKCDKKKAIEVSFTFRGEPPSRHLTQTVTYVTDNGSFSSAIIKYELWCASVLFP
                     QKIPDVTFSVNKQQLNKILAIAAKRRHEQLTFALKAEGGFYAGTVCDVISFDVDGSAM
                     TQYPYNATTAVSSALVLACGKKRAARNAPVTAYGSGKPFCLALEDTTAFRNVVQKIKT
                     GSAGADLGFYTACNPPMLCVRPQAFGSLTAFLFCNSDCMSIYELEEASVAVGAVTSKR
                     INEYFPRVSTIDSRKRRPSSVLSEGDGKLLKPDGQ"
     gene            85077..86321
                     /gene="ORF 51"
     CDS             85077..86321
                     /gene="ORF 51"
                     /codon_start=1
                     /product="UL43 product homolog"
                     /protein_id="BAA82939.1"
                     /db_xref="GI:5689315"
                     /translation="MEPVDNASPLPPTGAGHCLHRIVCIDPPCTATIGSGRSGNRCIK
                     CIMVTTGSLLSMAAHLTVTVFCVSVIPCIDRTAAYPRCTMGAIFAFLFFFNMRLTARS
                     SEIVLLIGRPTQFLCALTASIADTVAKHLAATHKDYLTTLRAIEVMSLLTFVMLGALI
                     ASYHYVCIATSGDVTWKTGFLVVAAGTIAGITAPYGDISPLAGFLSAYTALLFTWSET
                     PVGSLMNTCYYRARREITVNGAYRLGRARLPPSTDAEATREEDVSSYDTLGGNIPTII
                     LSLIAVISIPAIASFQKYMSNATKHQSTLTDTLRSICGFLVGTSVAIFLPSRYHEVLF
                     RPILVLLLIFGAMATTLAGFGLLLGPTLFSATAAVLCCYTCINVRNANSGIKQLAAAA
                     AGKCILGTAISSMLVCVLIQYS"
     gene            86531..87967
                     /gene="ORF 52"
     CDS             86531..87967
                     /gene="ORF 52"
                     /codon_start=1
                     /product="UL44 product homolog"
                     /protein_id="BAA82940.1"
                     /db_xref="GI:5689316"
                     /translation="MHASRALRALGWTRLLFVVLFSGRVLSASINPDLATPPVIAFNP
                     SSIPADDGPLAKVPASPPAGEKEESHKNASDARRMPSIVCDKEEVFVFLNKTGRFVCT
                     LKIAPPSDNEWSNFALDLIFNPIEYHANEKNVEAARIAGLYGVPGSDYAYPRPSELIS
                     SIRRDPQGTFWTSPSAHGDKYFIWLNKTTNTMGVEIRNVDYADNGYIQVAMRDPFNRP
                     LLDKHVYIRVCQRPASVDVLAPPVLSGDPYKASCIVRHFYPPGSVYVFWRQDGNIVTP
                     RKDTDGSFWWFESARGATLVSTITLGNSAIDPPPKISCLVAWKQGNMMSTTNATAIPT
                     VYHHPRISLAFKDGYAICTTQCVPFGITIRWLVHDEPKPNTTYDTVVTGLCRTLKRHR
                     NIISRILLQDDWQKTKYTCRLIGYPFDEDKFQAFDYFDATPSTRGSPMVLAIAAVVGL
                     ALILGMGTLLTALCFYASGKKYILLSSV"
     gene            88591..89223
                     /gene="ORF 53"
     CDS             88591..89223
                     /gene="ORF 53"
                     /codon_start=1
                     /product="UL45 product homolog"
                     /protein_id="BAA82941.1"
                     /db_xref="GI:5689317"
                     /translation="MMSPTPEDDPRLGPVRGLLRMMDETTSERHKRSRSGCPRLLCGC
                     TIGIALTVFVITATVVLASLFAFSYMSLESGTCPHEWIGLGYSCMRAMGSNATELEAL
                     DTCSRHNSKLVDFTHAKILIEAIAPFASTDANSSNVFRLRDSRTTCVRPTAAGPVAVD
                     CPRTCTAICQRPRPLSIVASIIRDARTSLRLERREYYEVYTAILSNGSVK"
     gene            complement(89343..91088)
                     /gene="ORF 54"
     CDS             complement(89343..91088)
                     /gene="ORF 54"
                     /codon_start=1
                     /product="UL46 product homolog"
                     /protein_id="BAA82942.1"
                     /db_xref="GI:5689318"
                     /translation="MDRYACASMSPELFTPTSPEPETDSLALNSRSRGSPTRVQEYPC
                     QLSETTGTSLSGIRAQEDALVEVLPSGFLSALRQTLLRDAPSNKVPECIVVYLALGDA
                     SEEYTRPYRARIARRMKKKKLTRASVKRCYQASYMNYLEMRRDGCRAGSPETCDPTRR
                     EAALLFYPIINRNALVKKPFQLAKDNALYLRCWREIRDGTELIQKYAYYMRPDDVTAP
                     SADTSIRLQLLLSYVRTLYTWAVWLMDVLDLRACPNVFGPRAPSDFDTVFLALAEAVS
                     SLPSESWADTTMLCHFIGTVLAPLVHMGALWTCCAWRSSPESEVSRPVVAIVALVGLL
                     NYRCQYILNMVFNGYAVWLQGGMANSTLRRALRQQKRFQCFLGELFPTMNSCTWADTE
                     STVALWFKHARVKSTVTYQPAAKGGDSVVRCLQDSPQQSKRAWVEDGGETSEAPASNG
                     QSIFTMHFTQDSPPPAQCSLTYLRSPTPTTASTSNGTRTDAEPSPASDRAATLPATFS
                     IERNGCASTTGLAIPADMCNAVAVGSPSTVPETPPERLLEAPTGPRPKAVRKHRGGTV
                     TVTEILRRLTMTSDV"
     gene            complement(91268..93700)
                     /gene="ORF 55"
     CDS             complement(91268..93700)
                     /gene="ORF 55"
                     /codon_start=1
                     /product="UL47 product homolog"
                     /protein_id="BAA82943.1"
                     /db_xref="GI:5689319"
                     /translation="MLALHRHGDVGQEQRQRTGSVRDYVTRGTKTRVRLSRSPYNMAS
                     IHVGPSETNYDDTYDRLETDGYRSSAGSTSRRNGQGFIGYIRDTFRDRRPLEHTGRDV
                     PRDAIDASSRSKPRSKRRRSSSRRRHRNASAHTHYRRDREGRSSDRSGRDASRDMTDA
                     SSRSRPRSRRRRSSSRRRHRNASVRTHYSRGSGRSSIGSNGSEGRHRSRRWVQFRGRS
                     SRGGEYTHAARSGRVRGRRRGSSRRRGPRAGGHEDRTSFNRDSSLERAPSDLKQNWIS
                     KGSGASSREKSQSLGSDSFSGDDDDLRPYERVVSAYTVPSPLSAEPDLNSIKVEGTSP
                     TFIESLGTFIPLRRLLEPVPRVEAIREDKLLHTRGNTFGDGPLWHSDSRSDYAKGDMY
                     TSAPPKGALAWKRTAKQAHALILCLGRDALRSAVVSGELNQKDAIIFLITSALELAVR
                     IHKGGFSKFGRAKLLSSLPRVPTGDAKMFEGGAIRKAKGPAAAILRASYGSLAYWPES
                     VAFWDRSVKVQCAMRAAMLRAEVFLLSRVSSDTVSVTKEELEMLSSCVTVGCVAASIA
                     AQFLYVSSGRMLHRFKANRVRAWARLLGRGHKKLPMESLDVLYAEGMCLGRLESASYG
                     TGGAPLGETFVGAYVATRSALTELMNEFVSRSTSANERDIESGDTLTATVVATTIVLQ
                     RLLGHLNIGVAHLTIAAMYHDLAVDVWSETFKLYRHLCYVCKGLYRPVSVDEYIADRD
                     DAMEYLELEFERGDPPDGIATAIRGEEKNGELEALKLVPPPSGYNLLGTLASLQDVLE
                     DAKEAIFKKTDR"
     gene            complement(93953..95227)
                     /gene="ORF 56"
     CDS             complement(93953..95227)
                     /gene="ORF 56"
                     /codon_start=1
                     /product="UL48 product homolog"
                     /protein_id="BAA82944.1"
                     /db_xref="GI:5689320"
                     /translation="MATRRMGPGSRDARRDSTDLSAEIEAPVNGMTDCLDSDILRGIE
                     SFSETLCSQTRCAEQSASFSLSAPFSIKISLPSPNPNPPNRLYNRLLHELDFTEGPSL
                     LSRLEKLNVDLFSCFPINGHLYEHATLLSVSPSEVLDAASEEKWAYTAINLNEHCGME
                     VPRPPLTKDGLPVYVTEIQKFFSMELEAREKSYVTLLCGYCRALACYLRQGANEPSRC
                     DMCVGGSETPRRSIAGAYYREAARFARLLYMHLYLSVTRDVSRRLEASQRKRQNLFAD
                     LRCDWHQLRHFQCLFQPVIFNHGVVIVEGRALTAAELRTQNYVRSELGLPVMRCELVE
                     ERGMPLTAPPAFLANAPRASAYLFQCIKSKLEVYSLMHPPRPRSSARGESGRAGKAGP
                     SCGHGTIVKAMLRDSTHPGPAIAEDIAAARTM"
     gene            complement(95275..96000)
                     /gene="ORF 57"
     CDS             complement(95275..96000)
                     /gene="ORF 57"
                     /codon_start=1
                     /product="UL49 product homolog"
                     /protein_id="BAA82945.1"
                     /db_xref="GI:5689321"
                     /translation="MGDSDRRKSSRRRSTMRTSPDNSAHISSTRARRDSSKNESPDRI
                     SPPSHSLQRRRSVKIERKDSSSETQRGESLSSKVRAKPGARAIEKGKFAFSTTPASAT
                     STWRSNTLVYNERIFCGAVAAVAQYHAYRGALSLWRRNAPRTNAELEEFLARAIIKIT
                     IQEGANLLDEAEACTRKLSEESGLSPDMGNPKSRSQYGKRDGDESTPVDKRDRRSKTP
                     GRAPTTSRRHYSSSRGNYSSESE"
     gene            complement(96138..96425)
                     /gene="ORF 58"
     CDS             complement(96138..96425)
                     /gene="ORF 58"
                     /codon_start=1
                     /product="UL49.5 product homolog"
                     /protein_id="BAA82946.1"
                     /db_xref="GI:5689322"
                     /translation="MGLSDIHHVVCKVLICVIASLVESRATSIDSGRPIAVAGNFWES
                     TCSAVGVSIAFSSGFSVLFYLGLVAVISALLAGSYHACFRLFTASMFDDGW"
     gene            96402..>97586
                     /gene="ORF 59"
     CDS             96402..>97586
                     /gene="ORF 59"
                     /codon_start=1
                     /product="UL50 product homolog"
                     /protein_id="BAA82947.1"
                     /db_xref="GI:5689323"
                     /translation="MMDVGQTHPCGNALEKMSSHASGAPWRMQFSVDEAIYARNPEGW
                     TCYIEERDPRCLRVINDCAISLPKRDVKRKYEICALDLGVRVAVPRNYVVVLAKLTDP
                     DPTSRGVPVIRVANGLIDSGYRGNVRVVLLYEAACTIPKNGLVIRLALVQLAYPDFNS
                     RVLFDLADITPHLDCGPNFSMSIATAAKSHSAQARPLLPPGGEKLWPGTGCRALVCLY
                     SDRVSRATHYNTLDSNVIFAVRYNDSTTVIGLKDVPKYVHKTFVRFYTSGQFATFVPF
                     YETFNTKRHEDAAYDIFAPSDIVLESMSSVTIAIQQRYACADKSMVPWIFGRSSMNLR
                     GLIISPSRWMPDSWLTLTLCNLTEAKATIKRGDRIAQLLLVNQEAAALLPTEGGTVRC
                     SLQ"
     gene            complement(97778..98524)
                     /gene="ORF 60"
     CDS             complement(97778..98524)
                     /gene="ORF 60"
                     /codon_start=1
                     /product="UL51 product homolog"
                     /protein_id="BAA82948.1"
                     /db_xref="GI:5689324"
                     /translation="MHAGLRRRSRKIQPEYTALSTSSSSDRVMHRFREAVQAVNLMLP
                     TPITLEMAILSADGVRKLVRGQSLARMYSACLRNLDCLSRHVSGQGTPGLDAVVETHR
                     KNAHEVVDTCAAALLQIYMSVGTGRTDAFVEHAIQITAATETAMNDIALVERALGLKS
                     SPNDCSLEALAACPETENLELSEATDPRNCGDESGADIYGRVGGLPSPPHSEAEQAAC
                     ATSCDVSKGSGRRAKTCGVNEGMLPDCVTE"
     gene            98544..101759
                     /gene="ORF 61"
     CDS             98544..101759
                     /gene="ORF 61"
                     /codon_start=1
                     /product="UL52 product homolog"
                     /protein_id="BAA82949.1"
                     /db_xref="GI:5689325"
                     /translation="MSDIPEDADPGIKVLFAVDGCAVSFSLALLTGQVPSINPVYVIS
                     HWDPGNRLLDVLCHRADDRDCGRIPNERGDLNAVSDPLKVEFCLLSQMTRGLGGADLK
                     LRTRAIFVCRFTSHSEINSIVASIASGAPIQTDLLIATLSEYDTFRLHDDFNIALHIS
                     LACLSQKRRNGKEPAKSPDRNLLSIMAGTFSGGRRGLAGLYLQYEQKVTAAYRRVYGG
                     STTTAFWYVSKFGPEEKSLVLALRYYLLQAQAEPTGIATGYDLQAIKDICDTYAVPVE
                     ANPTGFSTADLTSFARLSRFCCVSNYANGPVARAFPLYVEHRIAADVTEVDALKEYIE
                     RDRSGLKISDLEFVKYIYLAYFECYNRAQLRRHLRDVTVRCPEEDVYKRSSLGKHAVD
                     NFFTHVRSRLNVNDHIACNVSPDQVEMGNVLTRAFCRARTYPPSTMESDARFTGICEP
                     SSVIIKRLDALESTLHKYGWPRARSETVNMMSECANLPIASSADSLRPPGLPLEHPGT
                     HCRGGPMIVKRLLALVSADARVGDIGPTNMLTGIRESAVKGPLPIYRIGMSKGKQAFA
                     VMVADCWDKIIPSPGIVKAHLSKLGRSGRAPEDDVIARDIFFTSELERVTGHAAELPY
                     FTCGPAEEQQYINRNEVFNDNLIVGNIILDVDVHLRTPVPVKLLHVAMRGFRTGALKA
                     LSLLLPKAKIDHGSYPCYFYKTSCKKSRVVHVKHWMSSTTDFALDCDGPAVESADCEL
                     EMGFDDPLLMDQIDDSISRCESDASSLPSDADLPCNCHEKIGLRVCIPVPPPYLLVGS
                     RTMSGLARVLQQSVLLERSFVEPIGSYLKNYDIVDSGVYGHGRSLRLPFFGKIDETGL
                     ISGRLLPFCVIPERCGDAEQFVLSHLQPKTFHFHSPMPEEDHASVVLKGLGGEYAGFF
                     EKKITINRDTFFGIRLSLAVALKARGVDINDSAAIVSFVTEHILDDIIQYMHDHIPDH
                     AAEYNHVSVSCCVIRPDWILLQLMANKTLGRAHGFTCVRFKHTRTTRMSSRSYLSLNI
                     DAHGRLCACVIQQCFAAKCGNNKLRTLFTVDVDSKCQAEHR"
     gene            101738..102802
                     /gene="ORF 62"
     CDS             101738..102802
                     /gene="ORF 62"
                     /codon_start=1
                     /product="UL53 product homolog"
                     /protein_id="BAA82950.1"
                     /db_xref="GI:5689326"
                     /translation="MPGRTSIALSGIILCISTYAIALVIYTTMIAKHGSGCIYAVLVD
                     SDHRDAKNFTWEPYNSTLVYTPLGNKLPLDGGFGGFSDVCNTYLINATDLFGRASHAS
                     AKSKIRSVVGTRNCAAYFWKTHIQALTFSLSSYIMFCVIREWRRMFGVVRSENDRIPP
                     TTYTKNYTARVIANGLLKTVYTRMSEFMCEITIYKNSMCRIFTDDPISFILRHPLAAI
                     LLITERLIRLGGQCLCVLTVSIFFVPCKIVLSKWFLSITGVFLGIVICTEMGLLIDPG
                     PAEKPVMFAEVAPAPKTQQNGVAVPFGAHAVCSNCCASIISSIVIKVLYVLFMVTLIV
                     TLVRYERALQIALFGRAYLP"
     gene            102967..104397
                     /gene="ORF 63"
     CDS             102967..104397
                     /gene="ORF 63"
                     /codon_start=1
                     /product="UL54 product homolog"
                     /protein_id="BAA82951.1"
                     /db_xref="GI:5689327"
                     /translation="MSVGAFSRDWDDIMSLSDYDFTEEESLDESGELKEFKNTSALNA
                     IETARDAIERSANSNPPIEEPSFISKSHAGETSASKYRSLPLDIEKAERCDDTRGYNV
                     SSGKRMRLAVSATVDLCESEIERQCLNTETRDRARSPKHFASHYEIAAKIHDLPRSTG
                     KRQRHRTLDSRSRRHLAGEHRRRGAHDEESRHFSLRMRDPHSAPGKSPLSKRRSPVRL
                     RNLSVQEELNAMLQREKLKLDMISRERNFRTSSKNRWASVLAFSCTGKSGAYGSQITW
                     QYLLQEGPELRKTFENRPRTSLLASAAREAVLRGENLVAALESAEETLAWLKLHSVLK
                     LRLMNHDPIFRTAGAVLDNLKLKLAPIMMCRNGTDKRSLGDMLRRSATDDIADSLTLC
                     LILLSRIHRMMMYRVSGRKDSSMIDPRGYMREYTPGECMAGILHYVDAHAKTCSDRAC
                     NLYISCTLMPVYVHGRYFRCNSAFDM"
     gene            complement(104641..105309)
                     /gene="ORF 64"
     CDS             complement(104641..105309)
                     /gene="ORF 64"
                     /codon_start=1
                     /product="ORF-1 product homolog"
                     /protein_id="BAA82952.1"
                     /db_xref="GI:5689328"
                     /translation="MTMHCRPQVQRCANYDSTSDAPTQTGFPMWLTPRELSPTNVYGI
                     VARPVLLTHAGGPINSVLTGGWKGRMVTATSSICERILLWVADTQRSSPSTGSFDHAW
                     FLAVGTPWFLGRNILPKELLWFLTDRCRKEVSIVLTDMPMTLKTVFRQFHSNHTSEIK
                     PALLMNPRRFTEIGTRRKTIYLCESAMRENFSTHGMLISCVCALAWRAPVLIIHKNTR
                     ELVQ"
     gene            105486..105989
                     /gene="ORF 65"
     CDS             105486..105989
                     /gene="ORF 65"
                     /codon_start=1
                     /product="UL55 product homolog"
                     /protein_id="BAA82953.1"
                     /db_xref="GI:5689329"
                     /translation="MAESTAEPSASPVRIPYVWQVIAPLAIDVPSASTQLATGEHVSC
                     AASVIPRSYVIRAACKSSTTFHAFFFGLATDPSENMSQCGASYIAYRMNKKLRTGRLT
                     GDQCESPFSHATIIDSLDENYSMAIEGLCFHCHCENKFSLECWRSAFSAAEKIASQCR
                     AIREYGH"
     gene            complement(join(106238..108886,109013..109264))
                     /gene="ORF 66/67"
     CDS             complement(join(106238..108886,109013..109264))
                     /gene="ORF 66/67"
                     /codon_start=1
                     /product="MDV2 ORF966 protein"
                     /protein_id="BAA82954.1"
                     /db_xref="GI:5689330"
                     /translation="MNISNYNWGTVNATLHICLRMKPQMDHLLPTTLLRRLMRLALRK
                     LMMKRIGCLMPDRIAAAIIILTVVFVTVFSAALISLLTTANAIERSIVKMFCFTPSRK
                     KSRIVHASHCTPELDPERSLLSSNAVLFPNQLRELHVQPKYVVSIGSAPAERSTIAPL
                     AHFDDQELTRFSMYEQMEWTKRQKFHPPIPSKEWFPEFRCAPTGTSSVIQALCNSNCG
                     PPWALLGKIRTEATILRCIRTTETTATVGLIRFERRDEPITVTPLPEETYATDLSVLR
                     SMHQSKLYTIILFEDNSEASSINDFNTLAYSITLRNLCMGRGRWNPEIEFVRRTTDAD
                     FAAYGEYLTTFWKLDVEDDSCTRIGIGAVYAGADERIDSMLAEILMHDSATMVDRPHS
                     PYNNDTEFSQIDFCLASPGPLPGNFEAAGQTEDTYGWICASESKELGSSPDVYLTSVA
                     SKRMLTVRAGASPCYRYTRETVSRLSRRVDICAPTLANERHDCDCDGDEEYAKKMSEA
                     LRSDLKWVVETYSQLRNDFSVAEAISGWTEKLNSSVRNTLPLKRDIPPIRFFAGLSVG
                     WLHRYHPFATVVPNVPARGVRHGRLDLLTERIVARSDMPALCVPKCGDVSILKPVNLR
                     KRWIDGDTRHRLLSAQHMSDNVDIDSGDGGPAQELCFMVFVGTDMHPIVRKFFSADWS
                     RSGKRARSTFMKNLSDTVCRIGVPLEHTKPELVFVLSLALVSCNTENGARTCIETLFS
                     FGGAVLETNILIHAINQLLPLCDVMAVSGISRLAIIESIPELGTVPYRCVLQATPHIT
                     ACLTPKVVRCMNYGILLSHWEECVVRDSKYIVNVPTQTQFVTSLTRCPHGPVANDWYL
                     GFFFPFKGFRVITVRTRRWLAAYTYRFRKWLQWEEGSPHYVALRRLVPLCDCYLMDAC
                     MTNNFFACGMLFHLHCVPIPAREKRIVAILARAIDDAQTYAGTSLHVDTSEQ"
     gene            complement(109473..110138)
                     /gene="ORF 68"
     CDS             complement(109473..110138)
                     /gene="ORF 68"
                     /codon_start=1
                     /product="homolog of MDV1 pp38"
                     /protein_id="BAA82955.1"
                     /db_xref="GI:5689331"
                     /translation="MRRGKRRRSDGRDRDPTADPRAPPDAERDAERESGAGDGGGDPD
                     AGENDAGGRGPGADPGDDPGDDPGADADEAHARLLRRAERAVQDARRLLRAESEIVQS
                     INLLMIAEKGAGKVQQNLVGQRLAPTVPRTVLSVESENATMRSLMVITLIRSARSLVM
                     GSCMAFFAGILIGRAVKVDSTGWQRAGLFMALCTGAIAGGIWGRAIDSKEENTDANDP
                     DAA"
ORIGIN      
        1 acgacgcggg cgacgacgcg ggcgacgacc cgggcgccga cccgggcgac gacccgggcg
       61 acgacccggg cgacgacccg ggcgcggacg cggacgaggc gcacgcgcgc ctgctccggc
      121 gcgccgagcg cgaaaacaag aaactccgaa ggggatgtaa tttagtgttt actataagca
      181 acaaaaccct agtagtcgga acatgtttta tgcttgcggc aggtgtacta gtcggtgcaa
      241 gtggtgctga tcacgagact gcatgcaaca aaactaattt gctgttggta tttgttactg
      301 ccctcttgac acgatttatt tgaaacggta acgaatgctc gtgtacttta taattgcatg
      361 cccgattaca atctgttctg taagaataat tatacgtagc gtgttttaca tagtcttcga
      421 tgtatagaag agacgcagtc aacttgccgg tgccgtgaaa ttgtctccac actatgatgt
      481 ttttactgtt acaaggtaat taaagacctt cgagtttttc actccacttg tgtgacgctc
      541 cttcgattat gagagtacaa tgtcgtctaa gggggatgtg gatcaccacg cgggttatgg
      601 ggtggcactc gcaattattg ctctattgct cgtacatgct actgcactga ttatggtgag
      661 tgtcttttta cctctgtccc atcagtaatt gctaaacaat gattgtttta atgccaaaaa
      721 tcttttttta gatcttttct gatgtcaaat tcagaccagt ttcacaggat cttagtacgc
      781 agtacccatc tcataagcat tatgatgatg cgtactcgcc acatatgtct ggggtagacc
      841 acggccattc ggatgtatgg actaacactg taaatgaccc atccggcgga ataaactcaa
      901 atttgcctgg tgcgaagagc gtggagaaga tctatcctag cgtagaacca agtacgtcgc
      961 atgacaaagt gtcgtatgga aatgcatggg gaggggacat aaacaccggc agtgtttcac
     1021 cttctgatga caaagcattg cccgccactg tcgaaccatc gacggacatc gtttccatcg
     1081 cgatcacggg gagcagttta aacggagaaa gtagttggcg gatttctaag gatggcccgc
     1141 gtcgggttta tacaccacac cagactaaaa gaagtcctcc tcagatcgat ggcacgcgtt
     1201 tatctactag aacggcatac ttgagtgtgt gggatgaaca ggaggggatt tttaaaacgt
     1261 tcccggccaa tgctgctgca ttcaatttat tggacgctaa tcagttagag aaagcgcgcc
     1321 gtgaagtttt tttcgttgtg tcggtgtggc atggaaatac gaacgaaacc cgtatatttt
     1381 tatccgccac gaggctactg acgcgaatga tgtccacatc gctcgtcgtt tatctttcct
     1441 gggactctcg aggggccctg gggacgacaa ctgatgcggc ttttctggca cggagcgtaa
     1501 atatatccca gttcctgacc gctgtaccac cacattcgca agttcgttgt atgggccatt
     1561 cattaggaat gtatacttgc ggttccatct gtagacaata taatagtgta ggtacgacca
     1621 gatgcaaaag cattttaagt attgatcctt acggcgcctc atcacccgac tctcatgtat
     1681 cctcggcaga cagctcaaat acaatacgct ttgatgccga ctatgttgcg attttcgcaa
     1741 caagtgagtg gcacttgaac acgtccgatt caaacgcaga cgaatatata atagtagatg
     1801 gcttgaatgc aaatgctgtg tgtgtcgatc cctacgagtg gagtgtctta ttgtgtgtta
     1861 gcaatcgcca acgaaatgcc gtttgtgagc gattcggtgc taacaacgta acgactaccg
     1921 gcgaccctgc ggaagacggt tcggaaacat gcatgcgaat actccctata ctatcggtgc
     1981 tgcagtcgct cgataagaat tctgcgtatc cgctgttacg tatggatccg ccgggagctt
     2041 ctgcagcggt accatcctta ccgtccacat ggaatatcta cgtgatggga aaggattaca
     2101 gatattctac ttatggaaaa aatgagagcc tgtggtattc tagcgccgtg catatgggag
     2161 gaccgggatt ctttcctgcg tcggtattta ctgtgtttct tccctcgggt atacccgctg
     2221 tggtatccaa tgtcgtgcaa cacagtagca tcagttacgg agatgtagcg gttcattccg
     2281 ctttcttaac tgataggtcc ctctactacc cccgagtgat ggtccaaaca tccgggccta
     2341 ttttatctgc ctattcttgg agagcgcgac tgcataatga cagcctctat ttattaccac
     2401 ttccagaaca ggagataatg caatacaaat gcgcagttgc acagggaagc tatgcatgta
     2461 gtcccacagg cccgatcttg acaactgtta tgtggcgttc actgttattc gcgggcagat
     2521 cttcgccggt gcccccaaac ggtagttgtt tgacttatat ccccgctaac acaatcatcc
     2581 ggagccggtc ccccattgaa ataggccctc gaagtattat aactgcatcg tttcagctaa
     2641 gcagacaatt aatggctatg acgctcgaaa atcatttcac gtccacgaac cggactctat
     2701 tgacatttca tgatgtgtgc cacgacactg ctatggagtc ggatatatac ttcgagtata
     2761 actggttagg cgcatcgatg aacattacca tactgaaccc cggcctctat acgtttagat
     2821 ggtttttccc atttgaggtt ttcgtaatgc cggtggtagt tacgcctccc aagtccagag
     2881 cggataccgt cacgatcgct cccgtaggac tataaccctg ttggacaaat aaagtataca
     2941 gactgttcaa actgtgtagt gagtccatct tagtcgtact ggatgcaaac gagcccaata
     3001 aagtgtaaca gttgggaaaa ctttaactgt cgtgggataa cccttataat gttatagtgc
     3061 agtgactgac ttgtaagcaa acattgactg gaagttagct tatactgtac ttcgtcgaga
     3121 ctgccgttgc cgactgtacg atggagcggc ctctcgatcg tgactatcaa agtgcgataa
     3181 cgtgcttgac gtgcgagaga gtactttttt gtcgcctctg acatgggcag gttcgtggcg
     3241 ataactccaa ctacatcaat gccaagaggt ttaagcgtta ggtcgccggt ttaaatactc
     3301 attcggaagc cgtgggtggc gcctcgcgta ccccagaccg ttgtgttata aaacccagac
     3361 tcgtcgccac acatgtaggc aaaaaaatga ctagcgaaag agctcttgcg ctagcacccg
     3421 gtcgggcggc cacggcagat ttctacgaag tggatccggt atatcggcga gacttcgcac
     3481 gccggctttt acaacgtaag ttccagcttg tcgtgttgta gaggtattta ctactctgat
     3541 cttcacctaa ttagcaccat gccgtttgta tttaggttta ttccccaaga cgcttgccgc
     3601 cgtcagggaa tcggagggag gccgaaacac gcgcccgccc aaaacagatc tgtgtacgct
     3661 tttgcgcata atcgcgcatc atgagacccc gcacattttc accccaggtc ccagactccc
     3721 gaaatcctca gcaattgtcg acgggctatg ggtagcgtgt cgaggacttg cggcagagtg
     3781 catgttcgat ggccgggcga caatagagtt agcagaacgc ctcgcaactt catggttgac
     3841 ggccataaga ttaattctag tttggcatcc cgtgtatgcc ctcggccagc aacacgaacc
     3901 actcgagcgg atatgtcgcc aaggtcgaga atatattgct atgctctcgg gaacgattca
     3961 aacatcgtat gcgacatggc cgttttggca aatgatgcaa cgatgcttag attggtgctg
     4021 ctcatttcac atccccgatg accgttcttg tgagcacgga tctccacgtc tggggatcca
     4081 actagagggc gaaaaccaga tattcgcgcc aagtttgggg ctctactccg ctgtaatggc
     4141 atggacccca attccatgtc acgtacaggt tcctgtattt ccgagacctg gcgaatcgga
     4201 cgatgtctcg accccgccta gtggggcaca gataggacgg gtgcgacctc acagtcttca
     4261 aaggctggca ctaaaacaca gacctattga tgccgatgta catagaccca tgccgttagg
     4321 ccggccactc ccttcaatgc atatggacga tccagacgat ccgcaacctg gaccctccgg
     4381 acaaggccgg gcgcccagaa ctccaactct ggaaggagtc cgggtcgcag aacaaccggt
     4441 aagtcttcgc cgcgcaagaa caccaccgcc gccgctcaat gtcgacgaag acgacaacga
     4501 tcttcctccc ggccaacccc cccgccctca tcttcgaact cccccatcat caccatcgtc
     4561 ctccgagact gaaatcgatg aggaacttaa cgcgcaaccc gatccttggg gtacaaaccg
     4621 tagctctacc cctacagata actcctctgc cagtgaggat gaagccagag ggagcgggtt
     4681 gccccgacca ttgcgcagcg cgactactga accgcgcgta acgcgtagaa gccgccgtga
     4741 ggctcgcagc cggagccgaa gtcggtctgg agaccggagg tggggaccgt cccgattaag
     4801 gtcaatgcct ggacgcagga gagcttctcg acaagataca gtacttgtag acagttctga
     4861 agaggaaccg tagccgtttg tagtcagggt tctagttaag taggcgccgc gcgatttacg
     4921 aattagtaca tttgggccct gccgcgcagc gagcgtctca cgactgcgat agtcatgcac
     4981 gtttcgctgg tatgggtgct gtgtttgctt ttcggaacta gtgggggtgt tttaaagtgg
     5041 tctgacgttg acttgtcgcg gggattcatt tcggtcccaa atgtaagttc gcttatgctt
     5101 ttagactgcg ctccaaattc gatactctca actgccagat tcgccgatct gacaacagat
     5161 gatgtcccta ccggtatatt tattaagatc aattgcagcg ttccggaatt cattttatgg
     5221 tatgggtcta aaagcgtggc ggcgcggctc aacccaatta ttgcaagcgc tttaatgatg
     5281 gacgatgttt taaagagcgg attggacgat tccgtgaagg cggaacttcg cgtgttttta
     5341 aaaagaatat ccgaacggct accttggagc tctctccgga aaagacacgg ttgtctgaac
     5401 ctggacgcac cttatgactt ctcctgttat ggctcggcac ggctcgacag atttgaacga
     5461 gacatcgagg acgatggccg cggaatgtca tgccgagcta aatcaacccg agctaaagcg
     5521 gcccgcacca acgccatcga gggatagttc ggccgcgatt aaaaagcgtc gccggccgat
     5581 cggacctccg cccggtttcg cgccactggg cgataatgcg ccatccccac agggtgaaac
     5641 tgacgcgtac ggacatcaac tgtcgatgac cgaaaacgtc cgcgctgaat tgtggcctgt
     5701 tatagccgag tcttacaaca tagactggag ttggaaagat tggctgctcc ccgaattatg
     5761 ctgtcctaac ggctccaagt tgttggcgga atacgaacgc cgtgctgcgg tagaagacgt
     5821 ctttcctccg cgagcagata ttttcgcgtg gactaagtac tgcgctccgc ccgacgtcaa
     5881 agttgtgatc gtcgggcaag acccgtacgt tcatccggga caagctcacg gcttggcatt
     5941 tagcgtcaag cgcggcatta caattcctcc tagtctgcag aatatatttt cggcagtcaa
     6001 ggcgtgctat ccctcgatcg aactcggagc ccacggatgt ctagaagact gggctaaacg
     6061 cggagtcctg ttactaaatt ccgttttgac agtaaagaag ggggagcccg gatctcatca
     6121 ctctctagga tggcaaactc tggtgcgaaa cgtgcttcga agactgtcgt tgtcgactcg
     6181 aggcatagtc ttcatgttat ggggagcgcg ggcacagact atatattttc aaacggatcg
     6241 cgacgatcga catttggtgc tgaaatacag tcacccgtct cctttatccc ggagaccgtt
     6301 tgcgtcctgc acgcacttta aagacgccaa cgagttcctc tgtaaaagcg gtaaaggggg
     6361 catagactgg agcattggcg cgtaagtgac ggaagggtta atcatcacat gcgtacaaaa
     6421 gtcgcagcgc tctaggactt gtcgctttct gcgcgcgcaa tgaacgatac cgcaccttct
     6481 gttttggcag tattatccaa ctggggttgg aagagcacac ccttgggcac cgtaggcccc
     6541 gtcccgattc gcgacgagac tgagtgcgcg cgcgaagacc ttccggcaca tgattgcgac
     6601 cactggtgta aaaccgccaa tgcagaaaac ggacctatgg caccctcccc ggggaatcga
     6661 gattttgcgg gaaaccaaga atacacacat ttcgacactc tgtttatggt ctcgtctctc
     6721 gacgaattgg gaagacgtca actgacagat actatacgga gagatctaag gcattctctg
     6781 gccaagttta caatagcttg tactaaaacc tcctcgtttt cttcctcgca cgccacgaaa
     6841 aaggttcgcg cgaaaatgtt tcaaagaggg cgtcagagca acaagagctt gcagatgttt
     6901 attttatgcc gcagggcaca cgctaaacat atccgggccc aactgcaagc ggtaattcaa
     6961 gctcgaaaac cccgcaagta ttacacccgc gccgtggacg gaactacgca tccggtggtg
     7021 cccgtctttg tatacgagtt tgccgccata gacgttgtca gtttgcatcg agacaacgtg
     7081 atagaggtag acactcccgg ctcgtgagct tctcgccgct catcatgttc gtcgtttcgg
     7141 cagctttagc atccgcatca gactacgccg cgtttttgcg ggacaacaag caagctgctc
     7201 gcaagctgca gtttccgttg tccccgatgc cgagccaacg gatcccgcat ctgtctaagg
     7261 atggcaggac tgcagtcgcc cgggaaacgg ggtcgagcga ggttatgtca gcgagcggac
     7321 agacacgcgt cgacccgacc ggtcgacgct cgtttcgcca acctagacac cgagaaatga
     7381 caagaagcat ctaaaacgcg cttgattgtc gagtggctga ataaaatctt tattgatcga
     7441 ctcgctttcc tatttctgat ttaataacca tagatggggc ggggaatcta taaaataggc
     7501 aaggtccgcg cggattcgag cacatcgacc gcgtccgcga cacagcatgc aagtggcgac
     7561 gaacggtcct caggcatgca cgactggtct atctgtatat ctgcctcgcg gatcgcttcc
     7621 gtgagaaggt cttcctcgta cccggttgag aaagcgtcca ctttcgaggg tccgtacccg
     7681 tgcacagcgc caatttcgtg cgcttcgatg cacttactaa tctcgggcgc gttttcgggc
     7741 agagatctta tcggatcgca gctctgtcga tgcgcatctt tattagggtc tgcgatcgct
     7801 tggcaataca atcgcgcgct ggattcgtga ccgacccgca ttgcattggc tgtttgtgtc
     7861 aaagagccgg gcttaccgta gatggtgatc gttatgtaca gtgacgttcc catccacata
     7921 acggttaaaa ttcctccgga actgctgtat aagtaggcat ccggccccgt cacggtacac
     7981 gtagcaaagg gtatgacgca cagggattcg ggcagaaagg agagcggcgc ggcatggtat
     8041 tcggcgccgc actcgccgac gcgtagaaga taagagcaaa tgtccgcgcc gctgtcgaca
     8101 atgatcaggg tacctaccgg tcctcgctgt atgataaagt tcgacgatgg gatatgatcg
     8161 catctggtca tcttaccaac ggcaatcgag cgcgtaccgc ctgcacatga gcaaaccatc
     8221 tgctcataag gaggcattgt ccacgcgggc tgagcagtga cgttctcaag cgtatacgcg
     8281 atgaacgtgg accccatcat atccacgtct catgtgacgg ccctatgctt catggcccta
     8341 gttagtatac aatgtggact ttcggatccc ggaggcggct aataagtgcg cgctgatatt
     8401 gttatcatcc ctagtatgcg tttcccgaag tgggttaatg ttcatcctca gaaacttaga
     8461 ggaggtcact cgagacatgg ccacgtagac gctgctgagt ttgatgcccg attgggcaaa
     8521 acatatagca accctctcaa ggctaagccc ttgcgatctg gcgatagtca tcgccagttt
     8581 ggagcttatt ccgtagtcgg cggttacggc catccggagt tcctgatcgt ctaccgtttc
     8641 gacaaaatca ttgacgttgg tgttaattgc tgccatgaaa ccgtgttgat ctttcaaaac
     8701 cagggtcggc atgtgaagtt ccccgagcgc ttccgcgacc tggggatgta tcttacgtct
     8761 aataggctcg tctgcaaatg tgttaattct agcgtatgtg taacccatga gagtgtagct
     8821 gtccgtctgc aaagcgagcg atagcattcc tccgcgcatg ctatttataa atatttcgca
     8881 ccctttaaag ctcacgttgt cgacataact atcgaatctg gacgctgcaa acttttgccc
     8941 gaatagctcc gtcaggatag aatacctgcc cataaacatg ctcttaagca tgctgaactg
     9001 ggtatatatc tccgcagaag tttctgcgcg tccaaattcg taattgcaat aaagcatgtc
     9061 tatcatctgg tcgtcgaaat ccataaatag ggcatcgtct gtatcctcca catgactgat
     9121 ttggtcatta gctatacaat ctaattcctt ctcactgcca tagcggtgtc ctggaatcgc
     9181 gaacgactcc ctctgctccg ctctatccgg aggttgccgt cccggataga gcagcgcaga
     9241 ggtaagcatc gccaatctat cgtacgcgct tttaacagaa ttgtctggaa gaccctgccg
     9301 ttgcagatag ttgtagaact gtatcatgcc gttgaaaagc agttgagata agaaacggta
     9361 cacgtattct acagacccat ctccgtgcgt ctttatgaag gaatcgtctt tcaatacgga
     9421 tagaaatgtc tcgaacgtcc cgcaaaagcc gaaaacccac ttccgaagtc gggtagtaac
     9481 agccacttgg ctgtttaaga cataggcaat atctacacac gataccgcga gcccctgttg
     9541 gctgcgaatt tcacatttgg cctgtgtggc atcttggtcg cgactttgcg accagttgct
     9601 caagcgtccc gcattggcag caagccattt ttccaacgta acgtgcggtt ggttggcagc
     9661 agtacgatat cgttcgaaac tatccaaact gacgaaggta taagccggca gggtaaacac
     9721 tacaaatttc gtatttccgg acgttttcag gtagtcgtgt aatctgctca tgtacgcgct
     9781 gacttcttta tgggacgaat acagacgcgt ccatcccgga aggttcgcgg gattgttgat
     9841 gtatgcttct gggacgacga aactatctac gatccgagcg tgctcctcgg ttatgggaag
     9901 accatactct aaggtcttga ggaggtcccc gaactcgggt tcggtgcacc gtttgttatt
     9961 aatgaatatc gcccagttct tggacagttc taagtacgag cgcaacgtct ggttgcatat
    10021 aatatacgta agaatatttt cgctcgtacg cacattacac ttcagcttgc tatgctcaaa
    10081 tgtggactcc aaagaattcg tttgcgtggg cgacccgacg catatcaata ccggcctcct
    10141 tcttctacag tactgcggcg tgcggtaaac ggcgtttgtg agccaccaac tgtatacgat
    10201 agccgtaagc aaatacttcc ccagaagtcc agcctcgtct atgacgatta tgttactgcg
    10261 agtgaacgag ggcatcgaac catgtatgcc gaagattgtc cacgccatac taccgcgagg
    10321 cttgcttagc agatcctcta acgcgcgaat catttcaaac cgccctggcc cgacctcgtt
    10381 agacaccgcc ttcaaggcgc attttgtaat gtcggataaa acgtcccaat aatacactat
    10441 atcctttttc tgcaattctt tcatcgtcgg tgggctggtc ggacatacgt actgatattt
    10501 tcccaaattc gcttgaatgt gattaccttt aaacccgaat tcctgaaata tcgtgtttat
    10561 gtgctgcgat gtgtatgaat tgctaagctt gcaataaata ttctgcgctg cgacctttgt
    10621 cgtgccggtg ataatacagt ccaagatttc ggatagcatc tgtatgcacg tgctttttcc
    10681 tgagcccgca tttccgctta ttaagtaaac ggcgaaaggt agctcgcgga gttctagatc
    10741 caacgggctt tctagttttg acgcgttcat aaaatacgat agcgggggga ctatatcatc
    10801 gctcaccgat gcgtccgcca ggctccttac acgcgcaatg atagtctgta tcccgtgcat
    10861 cgcagtgaaa tttagatacg ttgcctcact gaagaaatcg ttctcccgcg acatcgtcgg
    10921 tcttggggaa gacgggagtg acgaatctac gtatctttta gggtcggggc tggcgtgttg
    10981 tttatttccg atggagagct cagacgttcg ggccgcacgc agtcccgccc taaaacaaat
    11041 tcgacggccg cagttgcaat ctgtcacgcg ccaatggaaa ctttcaagcg acggcgattc
    11101 gcaacagtcc ctggaacagg actggataat aattcaccct actcgccaaa cacgtatgtt
    11161 caaagaggtc ctcaccgggc aattgggata tacagatgga cagggcatat ataactcggt
    11221 acgatctaca gaagccgcga ttcggcagat tcaaagtacc attctcaccc tttctttaga
    11281 tgcggtcaga tatgacgact tgaaagagga ttggtcgaag catatggata ggcgtgggat
    11341 gtcggccaag gaaatcgcaa aaaagtatgg cgttcatagt gaagccgaag ctgttagaat
    11401 ggcaaagggg gtgttttcaa cttggcgtaa aactcttcaa atgaccttaa tagaattggt
    11461 tcggcacgca acagattgct tcgccgcggc cgagaaaacc acgtcctgct tctctaaata
    11521 catagactgg atctgctgtt taggtatcgt tccggtcgtc agaagcgagc gctctatgca
    11581 ggcgtcgcgg ccggatagca actgcagaga tcgcgctacc attcgcccga attgggtatt
    11641 cagcgatgcc accgctaagc tactagttgc ggatagcgtt atggcccgcg cacaacaaat
    11701 cgcggattac ttaactgcat ccatgcaagc actgactgtg atagaatacg atagggccca
    11761 gatagaatat aatttcttaa aacgtgaact tcgcgttaag gacgtgttga gcggcgaacg
    11821 tggcgagtgt atcgttattt ggagaccggt aatgaacgac ggaggggtaa tttttgattc
    11881 gcccatgcag agaatctaca aggagatgat tgaatgtcac gatttgcgga tgcatgcggc
    11941 gctgtgtcgg ctagtaaaca cggcccctat aaaggtcctc atcgggaaac gcgatgagga
    12001 tagtaaaagc atggccgggg ctcaaagagc aatcgataaa gttctgggag accaaactga
    12061 aacggcggcg agctctgccg cctctaggtt ggtcaagctt ataattggcc tcaaaggtat
    12121 gcgtcatgtc ggcgatatca cagatagagt gcgggattac ttggaggaaa ccggcggaca
    12181 tttattggat gcctcgcccg tggatacatc tcagcctggc ttcgggcgcg ctaatcgacc
    12241 acagagttct acgatatccg atggaacttg ctccaatacc gctagactac gtgatgcgtt
    12301 ccacgcgtcc gtcgtgacga gtataaacga aatgttagag ggctatataa ataaactttt
    12361 ccataccgtg gaagggttaa aggcggccaa taaagactta tctgcaaaat taagctctaa
    12421 agaaatagag ctcgacagaa tacgcacgga agccctgatc tcagaacggg cgcgagctga
    12481 cgcctcgtgc gatcctcact gcaatccaac catggaaact ttggtgcgcg agctaaaaca
    12541 tgacgtaatt gacgtaacca atgcaatgga ggatgagtcc tatatcgcga atagcttcca
    12601 gtctcaatac ataccatcat acgatggcga tttgaaacgg ctctctaaca tttgggaaca
    12661 ggaaatgttg aggtgcttta agatgactcg tatcaccagt aatcaaggtc gagaggtttc
    12721 gatctcctac tcaaatagcg ctataacttt attactcgcc ccctatttct tctccgtgtt
    12781 gcagatctat gatattggtg cgatggtcac gagccaagac gtttacaagt cggaggagga
    12841 gttatgtaat tccgtgcttg aaaaaacccg actttgtaca tatctggatg atttggctct
    12901 cgtctttgag gccgatgtga aaagagctgt cgcgaagtat tcgctccgtg cgggtaacgc
    12961 cgaaatagac ttagcgcccg aggagttttc gtacggctct catggaagca aatgcgagac
    13021 acggttttca tccgctagac acgagcgaca cgttggacgc tctagtttta agcacgctaa
    13081 atggagaagt cggccaaaac gagaccgtag aagaactaat ttggcaaccg acggcgcgga
    13141 tgatgatgga gatccgagag attcaaggcg gtcctactca attcacgggc gtctccgtga
    13201 gtaaacttcg cgtggcaaga tgtgatacgc gctttcatct gactttaacc ggagccgact
    13261 tggatgatga aatggcaagt gacgtatacc acagtcagtg catagttaat tcggcgttca
    13321 aaggtttcgt ctttatggtt ctcacggtta cggaagatat agtgcggacg ataggggttc
    13381 caccccctct gctaaaatac aggctcgtgt tctataaccc atctgaacat ttggacttcg
    13441 cattatgttt gctcgtagcc tatttggaga atctccatgc aagcgcctgc gacgtaactt
    13501 ttttcgtaca ggttcaatct tttctgagat acgcatggac acgggtgacg ccaatgacca
    13561 aaatgcgcag atttttatgc gccacgaacg tttggttact aaacactttg atgtcgatgg
    13621 ggtcctgtag cccattcgac ggagatcgag tactccccca ttatgcgata tacagacatt
    13681 tgtgttctac cagtggcgtc tgcgacgtgt tactaacctt gtttgaaccc gatacacggc
    13741 aggtacgtga ccgcacgcac ggcaagggac ttgtcatgct caacagagga attatgaata
    13801 aggcttttcg gcagacatgg attagtgata cggtctacga ttggtggacc ggcgaacgcg
    13861 agaagttgat cggagaagaa tctctgttca acacgtataa tatatgaata aagtatgaca
    13921 ggcactgcta taaatagacc gtggtttctt agcgttttca tttatttatt gcggacgaac
    13981 agaaacctgt acggctctac gtcgaatgtg aatttgctga gatcgacgtt aggccatttc
    14041 gatgttagag caccgatcag taatctcgaa aaaatggaca ttattggttt catatgatcg
    14101 atgcacgcga tggcagggag aattacttgt cccccttcga aaagtgaaca cgtgagaggt
    14161 gctatgctgc cgtccacagt cacggtgtgg acggcgtcgt tactgaaggc gctcgtatcg
    14221 aatctagctg ccgcccgtag tcccaaagcc gtgatatagt gagtgtggtc gcgcgattct
    14281 gcgggacagc tccaaaagca ggcgtctccg cgggcttcga aagccgcggt cacgagctct
    14341 tcgaacactg cacgcgatcg ttcttggatt gtccgtaggg actcgtcgga atcgttgcat
    14401 gcggaaattt cttctaaaag ggcagacaag gctttcttaa cttggcccgc aaacgcaggt
    14461 cgggccggaa accccacgaa atctgtttcc cgcttagttt cgttccacag ccagtaacaa
    14521 ttggcattcc acgatactgc atgagtgtat accccttcca ttcgaaactc taatctgata
    14581 tcttcgggaa accgtagccc gactgacgtg gctaatttgt tagcgctctt accgcaagcg
    14641 actcgtagtg tttctaaagc ggtttctgtt cctttagagg aatgcagaac gttgttggcc
    14701 ccgtccgtga atgtccccca cagtccatct ttgacgtagg tacacggggc gaatccgaga
    14761 gccgacgcgg tagcttctac ctcgagacta atatgattcc cgatacagat aatagctcta
    14821 taaacatctt cacgcactct tttcaatagg cctccgaact ctatgatggg ctgcttcaac
    14881 cagtttttct cgcgctgcag tcgagctttt accgcggcgc gcaaccggga atgatcggga
    14941 aacagtccta gatatagagt cgcaaaaaag gcgctaaaat caaactttgc gatatacgct
    15001 tgctctatga aagtcggttc ccggaaaata caagttatcc gcccagccgt ccagtcgtcg
    15061 gctacctgac gccgcgtact gcttgtgcgc ccttttaaat tttcgagtac gtctatacca
    15121 ggggtcggat gggtttccgg atgccaagga gcaagcaggt ggaaggttct cggtccggcc
    15181 agtggccaca ggccatcggt ctccgaatag ctgccgacgg cctttctgat ggccgagggg
    15241 gccgccgtag atgttttcaa gagcggccaa aggggaaatc cgatagtgca ggcatagtca
    15301 acgtcctcgc cgcgcggact ggtttcgggg ccaatatata caaatatagg ggccagcctt
    15361 ttttccgagt catcggctag agagtatatt tttttgtgcc actgcgcata gatggccaat
    15421 aatgccgtga gagaaaattc ggcgggtgtc gtaaccaagc agtcaaaaga cgtcggaacc
    15481 ggagccgcgg tttttatggg tgcctgtgag tcgggtaatg atagaacgcg ttcgacgata
    15541 gtgaatattc tattcgtatt tccccatttg attttcttgg acctgcgacc cactgtttta
    15601 tattcgcgga tgaaccggtc ttcctttgtg taaatttcga tacgggagtc gaattccggg
    15661 atcgtgtcgt cgtgtttaag agccgacaat ttaatgtggg ctaggtgcgc gccctcagta
    15721 tactccatag ccgtggatac gaggcgtgat tcttctacgt gcacggcacc gtccgttttt
    15781 agtagccccg gacggggagc acatcgatcg cccggcagag gttcgcacga tataactaat
    15841 cccgttgttg tgtctacgta catatcgacg ggtgcgaagt atgcatgata accgagctta
    15901 attctcaatt ttgccagcgt cacggcgagc agcgctttcc atagagcgtg ctggtccggc
    15961 ctgcaagacg gccaaactcc cgtcacagat ccggcactgg ccataatcgc cagtgccgcg
    16021 tcggttactg aatccggatt caatccccaa gctctcgcga tagaccgtcc cgatacgttt
    16081 accgtagagt aatgtgcaga atacgtaccg cactcatttc taaaaagcaa gtaacacagt
    16141 gcggtaagac catcggtgcg gtctctacta gtccatactc tatacaaagt ggtatagcaa
    16201 atacaccccc ggattttctg taccgccaca gtattagcct cagccattgt tgacataact
    16261 aggttcgctg cgtacgcctt acaaactgtg aaaatctata gcgccctcta cacgaggcca
    16321 gcacgccggg ggaacttctg ccaaaaccgt ctccaggtcc aaaatgtcgt ggtatatgcc
    16381 caattccgcg tccaagcgag atttcactag cgcgtaccac ttagggcgtc gaatctcgta
    16441 gcgcgttttg cggaacgacg ctttgttttt cataaggagt gtgtaaagcg cgcggtgcgt
    16501 tttgatcgac gttctatcta tccccgcccc atccaacaaa gcttctatct ccgcctttcg
    16561 gagattctta actttggtgc cacccggaaa cgtcgtcgcg ctctttacaa ggcgtaaccc
    16621 atacagtatt tcccatgtga ctttaaaaac agaaaaggcg tggttctcct ccgtctgccg
    16681 gcccaaggga tacctcgcga gaccacttaa cgcgcttttc gttgttttga ctgatcgttt
    16741 agaggcagta cgggcatcca gcagataaca tcgcgtgact tccaataccg aacgaataaa
    16801 agtatcgtac tcattttgca tcacacgcag catcgataat ggatctaaat ttttagctgt
    16861 tccctctaaa gggttaatac ccaacgaggt cgcccatctg cagcataacc gatataagtg
    16921 ccaccttcca gacacgttga aatcggccgt tattgcgacg gtacccagcc ctccatcggg
    16981 cccgattatt ggtaagctgc ctgatgcgta atactgataa atacgacaga acacctcttc
    17041 actataaaga gcggccggcg ttgcgcgaca cgcttccaac atcgtaatat ttataaattg
    17101 ttctctagta agcggttctg ccagtttagt taataattgc gcaagatcgc tcggcgatcc
    17161 gtcatgtctt agatatttat gaataaacgg ctccaccatc tcattgtcga tcagatcagc
    17221 ctggatttga ccgcaggcaa ttttacggag gtgtttcaaa tctcgttgag cgataagggc
    17281 gtctgccgtt aaatccgcta agaaggcgca gaaggtttca gcgtccaatt gagagtcaga
    17341 tccgtcaaat ctgacgctta ttagattcgc gtcaagtaag gcgtggagaa tattgatgct
    17401 gtcgctaaga ttgttgaggg tgcaccgttc aaacaaatgc ttgtacttaa atcgtgggaa
    17461 aatgtataac gcgtcggcgg acttgaaagt cggaacgcaa tctcttctga aattgttaca
    17521 caacatattg gtcgcgcata cgaattgcgc cggccatcct cccccactgg cgatgacgtg
    17581 gtttagtagc atgggtgtga aaactggctc cgaacgagct cccgatgcat ctatgtaaac
    17641 caagacttcg ttacggcgta acgatcggat tctacctaaa gattgataga ccgaaaccat
    17701 atcgggcccg tttcgcgtcg gcttaatata cgcgaacatg ctgtggaagt gggagctgat
    17761 aaaacttagg cctactgtta ctacggtagt gtagatgaca actcggtaac gagtccatga
    17821 atttatatca attggtatat cacgggtgga atttaagacc aggacagaat cggtaaatat
    17881 gaggcagaag cgtgccgccg cttccgagaa tgaaattgtc gaggaaaata agcaaatgtt
    17941 caacccgccc gcgagtcttc tgctgagttc agaaaaaaac gtcgtctcag tcacgcttct
    18001 atgccgagag tgggtaccgt cagccccgtg tttaggtgtg ggtcgtacat gaaaacaatc
    18061 tgattggtcg ctattcatga cggagagaag tgtatctgtt cccagattgc ggaggatggt
    18121 acatgatctc ttagaaaacc caggggctgc gtattcgccc acgatgacat gtatgttatc
    18181 ttctcctctc atgcttgcca acatatctac cagttgtgta tttattgtag cgtccattgc
    18241 tatgatcctc gggcaattac gtaacagagt cgttagtatc gaatcgactc tggacagatg
    18301 cctcatggtt ggagagtaaa gttgactaat ggtcgacatg acttcgtcca gtatgatgat
    18361 ttcataccgt ccgagcaagt cagggtctat gcgatgcaaa gattcgattt ggatcaacag
    18421 tctgtaaaac tctctgcctc gtatgctgta gtcactagcc gtcaaatagt tgccgaaccc
    18481 cgacagcccg gcattgctca gtttgtcgaa tacgatttgg atcaacagtc tgtaaaactc
    18541 tctgcctcgt atgctgtagt cactagccgt caaatagttg ccgaaccccg acagcccggc
    18601 attgctcagt ttgtcgaata atgtgttcgt aaaacttcgc ctacaggaca caaccaaaac
    18661 gctcgtgtcc ggattatata aaatacgctg caaccagtct atgagagcag ttgtcttgcc
    18721 ggatcccata ggcgcgcgca ctacaagtac attgcgcgct ctcgaggaca gtggcggcgg
    18781 aaaagtaacg ggcccgtcgg attggcgctc ggtcgttact ccgggtctgt tcttagctat
    18841 ccaatctatg agaccttctc cgtataatat cctcgacaaa gaggcgctac agacatagtc
    18901 tatcattttc tgtgcggtcg atgctctaac gtcgccgaga ccggtgctcc gggtgaggat
    18961 tacgttctga cgaccagaga accgtctacg atcgtcgcta tgtcaaaagg accgcgatcg
    19021 gaaggagccc ggagaggagc agatcatata gactacattc acaaaaagat gtgggttgtc
    19081 caggcggcgt gtttttctgt cgccgtcttg gttttcctag gaaccctgat agctgcatct
    19141 ataaacatga ccgaaggttt cccatgcttt tttgcggccg tcgtggacta cgggatgacg
    19201 aacgtgacgc ttgtgcatac gggcatgacc aatccgaggc tgggaggcgt agttcctgtg
    19261 ctgtttttcc aaaccaaagc cgtggcgttt ctcttctatt cggcgagcgt cgtttttgta
    19321 tgcatcacgt gttatatcgc cgtaggcgcc atcataacta gcaagaaacg agtgggtgct
    19381 gcgtataccg gaaggggcgc gttcgtcctt tcacttatgg catcgccctc gacaattttg
    19441 ttgggtactg tgtcgatttg gcttcttcaa gcggtagtta tagtcctagc ccacaaactt
    19501 attgtactag ccgcggcggt ttatttagtg cacttctcga ctataacgtt tttttatggg
    19561 tatttctgtg gaaggggcgt tgacagtaaa gtatatgcgg aagacatcgc tgctgcgaaa
    19621 aacgtagacg ccggtctgca cagattaatt ggaaacgggc gggcggtcat gatcaacttg
    19681 gtttcgatcg tatacagtat gcttctgata atggcgtctc taatgttagg catgttacta
    19741 gcaaacagct ttaccttaaa gttttggcat gtcatcgtta ccgtcctcat aacttcctca
    19801 gtcttaaccc taatgtatct tttagtactc gagttcctag tggcgcggta cgtgcacatg
    19861 attttgggtg cgtacatagg ccttctgatc gcctatggga tgctctggac cacctcatgt
    19921 gattatgtca accggttcta cttcgcgatg ggcgtaggag ccggcaactt acgcactgcc
    19981 tgtcacagcg tgctggcgtt tttcaccgta ctgattgtag cgggcatgat tgttcgccta
    20041 atccgggccg ggttgtatca ccgtaggcga tctactcgtg catacgccaa agccaggcag
    20101 ttacaaagaa atgtaaagga gagattgaga cgaatgagtc ggggacgcga tcgtcccgat
    20161 agccgagctg aggacgagcg ggcgcttacg caaacccaat atagcgaaac atcagacgac
    20221 gagactatat atgatcgcgt ttattcgggg tctgatagtg aatgggatga ataggaacgc
    20281 ccgaaacata ataaaacgct aaatctacaa gtgattgtcg cgcgacttat ttatcactat
    20341 aacgtatcgt tacattgttc ccgaccgtcc ttaaatctga aaagcgtctt tcctctcgcg
    20401 caagtacttc cagctaagac agtatcggaa tggataagag ggtcggagga cctaagaccg
    20461 tccaaatcga cggtatcgta ttgctcgtcg tcgagctcaa ttacatgtcc cgttttggtc
    20521 agaacggtgt ttcgtttccg acagcgtcgg aacagttccg ttacggatat tgcttggccc
    20581 atacttgctg cacgagttca ccgaacgcac ggtatccggc ctcttctact tcaccgtaga
    20641 atgtaacgtc cacgaccacg ggagtgatga ggaggagaac gggaatcgct tgttcggggt
    20701 ctattttgac gcttggagtg ggttctccag tgtttccttc ggagatcgtc aggcgtctac
    20761 ctaattcgcc aggtcgtctg cggcggccta taaacgtggc gaggtgtggg atgaccgggt
    20821 tgctttcaaa gtaattagaa gctacgtagt tctgaacgaa aatctgcttg aaatttggat
    20881 gtcgtgggtt ggcaaatatg ggcacaagga cagattgttc tccggtactc cagcatagcg
    20941 ggtgtatcgc gttcgtttgc agatcaggtt cgccaaacag ccatacgcga gaactgcagt
    21001 tcttattgga ggccaagtga cgcgaatcaa agtcgttccg tttaatgttt gatgaaatgg
    21061 cgcggaagcg tgatagcccc actttccagt cgtcgtcaca tgtgattagc gcctcctttg
    21121 ccttaggaaa atcgtcaggt ttaaaatagt ccacgcaagg atgattgatg gcgtataaga
    21181 atcttcggag cgctgcgacg gttcttgttt gtaataggcg ttcgtaacat tgagatagct
    21241 cgcttcgaca ttccgggtaa aacgcgtatt tggccctaca ctttatttcg tacgtttcta
    21301 tggagtggtc ggggagggca ggcgtaagga ttccgcgtgc gctgcgaggg cataccgcca
    21361 tatcgaggga tgctccgagc atcccggttc tggcgtctat catcagaccg cacgcgtatt
    21421 tgtcagaggc ggatgagacg gtgattgtct cgtccggtac gcgtgcattt tcgagcaccc
    21481 gagaaggttc gcgaggcctg tacctggggt tctccagaca ataggtctct atgagcgctc
    21541 tcgcgagcgg ctcgttacgc gttccgaaga ctacgctttc gggcattcct tgcgccgtga
    21601 tttcggcagg tcttatgcca acggtgttta tccgtccatc ggcggtccac ttcaatgtcg
    21661 atgcggtcaa cagccattgt ctaagtacgt gccatagctc gcagtccgct tgcggtctgg
    21721 tgagagtttc tacaatttta caccagaaaa gcgcatgatt agacggcgac gttgcatttg
    21781 cgcccgattc atacaggagc ttgtcttccg cctctaggag agaagaatat gaagatgccg
    21841 gccaacgtcc ctctgaaatg cctcgtttga taacgtccgt tatgtacaat aagcggtgat
    21901 acagcgggtg tggcgagggc cccgattgct tcgggtcgac attccgtaat atatagtcgc
    21961 tgaaggtata atcgaccaca acactgtagc atacggtatc gtaaggtttg gactgcactg
    22021 cttctgcgtg ctcggcgcaa gcgaagacct ttggacacga tttaaattcg gactcctttt
    22081 tacgtttccg tggcccgttc tcgccgagac ggaacattgc ggtggagtct atttccataa
    22141 cagccgtgta gcggccctcg cttctgagtt cgagtgacag taaagtgcaa cgagctcgaa
    22201 aagattgctt aaatatggcg ggactctcaa tgaatcaaat agcttcctgt gcgtcacttc
    22261 atatccttct aaatatttct caaacgcgac cctgtggtga gagccgtgta gctgcgaacg
    22321 aatcttttcg gctcgttccc acgggatacc gattttggca gttaacgggg tagctggaaa
    22381 taagtactgg tacagcatac accgatacgc taacatgtct aaaagatagt cggccggcat
    22441 cattttatgg taataaaaat gcaccgggtt tccggggatg gcaaagtccc gcgtaaaatt
    22501 catcccggcg gctagaagca cttccatcag tgattggccc agtgcgtaca tatctatagc
    22561 gacaccttca tcactggaca gttgacttga accccgctcc aagcccgtcc cgtttaaggc
    22621 tttaaccagc aattcgcagg gctgcgtttg cccatgcccc agcactaaat caaatacagg
    22681 tctaatgttt gctctagaca cttttactga atatactcga tcggagtcta cagttatgtc
    22741 gaatcgggct ttcgtaatgg tggagtttgt gttaagtaac gccaagctaa aatcgccgat
    22801 tacggcctcc actataatag ggttagaccc ttccctgacg ttgacgaaaa tgttcccgca
    22861 cttaatatcc aaatgagtca gtccgcagga cacgttcaag tacacaacgg ctctgccgag
    22921 gcccatgaac gctttttcta tggccctcca atggcgtgca gttttatcca tcttcctcag
    22981 tcgatggcag tacgagtcca tgtccatgtc atacgctgga aataccagtt ccctggatgg
    23041 tatcgaaaag gccagtaatg aaatcacgct attgagcgct agagttgacc ttgcccgaca
    23101 agcgcattcg ccggctatca gtgtcataag caattcggtc ttgaaacact cgaacacctt
    23161 tttgacggct acatttgcac ccttaaatac tttaacttct ccatagctcc cgcttcccgc
    23221 atatattggc gtttcttgca ggtcgatggt gctgtaatgt aagcccgggg agatatcgaa
    23281 aatgagcgat gttatattct ttatgcgaga tagagtgaaa atatgatccg gcaaagatgg
    23341 tcttgatagc aaaatgtcag atgttttcct agatatatgt ttgcgtctcc tatagaattg
    23401 ttttaggcat ctcctaatgt tgacggagat gtgttgtttg tggtcctttt ttctacacga
    23461 atctcttcgg ggggcactga atgttccctg cagatcgtct gttgtgcttg agtatccctt
    23521 aggcccgctg aagtcttctt ggtcgctgat gtcggaaagc catttaacgt gaggacactc
    23581 gtcgttttcg cggccgcgcc ccggctttct ggctttgagg tcaagatcca ttttgacagc
    23641 agcgcctcgc actctgcgtc caattctatg tctggaaggc gatcgctgat gtcgtcgctg
    23701 atttgcgtta agatgtcttc gtttgctaga atgtcctctt cggcacgatc caactgtgac
    23761 tggagcctag ggtttaaaaa ccttcggttc gcatctaaga cgatgcggcg gtccacctgt
    23821 tcgtctatgt ggcgttggat aattctcgac tttctatgag cttcttcgat ccgcatgttc
    23881 gagtgcaact gggttttgta gtcactgtgg gcgtttctgg ctgacgttaa cgcttcgatg
    23941 agttctgggt cgtccgcttc tacaccttgg gacaaaagtg tcaaggtgcg ttccttataa
    24001 attttctccc gcgttcgaca ctcggccaat atttgacgcc tgcgtctgcg tattgtgtta
    24061 acggcgaaca tcgctcgacg agattcgtag tctggcgatt accgactccg taaagatgtt
    24121 cggaggcgcg ctcggagaat cggcgaagaa gcactttgaa cgcctgctga gagataggaa
    24181 cgagcgttta ggtgcgagcc gtaaaaatga atgcctcgcg cgcggcggga gtttagtcga
    24241 cgcccccttt ctaaattttg cgatttcggt cccaaggcga catcagacag tgatgcccgc
    24301 tgtcggtaca ttgcatgact gctgcgacgg tactggtatt tactccgcga tcgctacacg
    24361 cctgctgtat gctggtatcg taagcagcga atttggtgaa gtgcgacgcg agtcgttatc
    24421 taacggtcac atatcgaaaa ggaatcggga ggcgttgctt gcgccgactc tgacacgcgt
    24481 cgccaattcc ataacatttc acgagtacga cgatgcacaa tgcgcggcgc atcgcaacgc
    24541 gtattacagt acgatgaaca ctttcgggtc tatgaggaca tctgacgcgt ttcaacagct
    24601 ggcgtccttt atcgatcgat tttcaaaatt attagctgcc tcgtttaaag acgtgaatat
    24661 tttggacaga aataacgctc ccaaacgagc acgaataacc gctccctcgt acgataagcc
    24721 tcatggcacg ctggagctgt ttcagaaaat gatactgatg cacgccactt atttcttaac
    24781 gtccgtttta cttgaagacc acgcggaacg tgctgaacgt ttgctccgtg tcatatttga
    24841 tatcccagac ttttcggacg cggccactag acatttccga caaagggcga ctgtttttct
    24901 agttcctagg agacatggga aaacttggtt tttggtgccc ttgatagcac tggccatgtc
    24961 gtcttttgaa ggtatccgta ttggatacac gtcacatatt cggaaagcga tagaacccgt
    25021 ttttgaagaa attggggatc gtctcagacg ctggtttggt actcagtgtg tggatcacgt
    25081 taaaggagaa accataacgt tttcgtttcc tagcggatcg agaagtacgg taacgtttgc
    25141 ctccagccat aatacaaacg tgagtattgc attcaaaacc gttgtgtcgg atggtccccc
    25201 ccccctatac acacacccgt gatagtctaa tacacccttg aaccagtatc gaactccaca
    25261 tctccggcag gtagaccaaa tgccatccgc atgaatttac gggaatcttc ctactgtcta
    25321 cctcggcttc gattaactct tcgagccgtt ctgtaatgca cgccttcgtg ccgctattac
    25381 cgaccactcg gacggcattt accgtgtcca tgaataaaac gcaacagagg cttttttccc
    25441 ctttgacttg tatatctgtc tgtcgggctt tcatccacat acacggacct ctgcaaacac
    25501 aagcctgccc gagcgatccg cactcccatc tcacgttaca aacatccacg tgaaggtcga
    25561 aatgcccacg gcattccgca cagccgctcc ggtggttaag aaattttgct agagtagcgc
    25621 ccagagaacg ttgctgccaa ccggcgggac atatagatag caaactctct tccatcctga
    25681 ggtaataaaa cctgcgtttg gaaagggacc accaagctcc aatagatatc gctatacagt
    25741 tgtgtggatc gtctggcggc tgcgtgcgtt ggactaggga atttatgtcc ggtgcgatac
    25801 aagagatagt tgacaaaggt tctatggcga cgtccggaag accgatacag gtcctactag
    25861 gagcgacgtc agaaaagaaa ataagatctg cggaagatcc gtcgcgcaga atgggggtta
    25921 tgcgtaaagc ggcagtcacg gaataggcgc gcgtcccgtt gactaagaac aagagttgaa
    25981 aagtgtttct gtccaagtac atctcctttg gtcgcgtaag gtacatgaat atctccaccc
    26041 atttcgtctt ttgcggccga gcgcccagcg gtacgtacgt acataacgta aagtctaacg
    26101 tggttaatgc gaccaacaca gctagacgcg attcggcccg aagcgtgcgc catacgcaaa
    26161 tgcggtcatt taacttatta acgaactcaa ctgccgccgt atcgcaagtc cgttctgaac
    26221 gacgcggcga tccgggcgtc cttcgtcttc gcgtagtcat cgtcccacat ctgtatgacg
    26281 ctaccgctaa ttgaatattc gagtcttggc agggcgctca tggaaaagat aatgtagtgt
    26341 tgctgctgca gaggcgcgat aaaaccgcgt ccgcccgcgc cagaggccaa ttgaactcgg
    26401 cgccggcatg cgctgctaac atgaaccccg cgggcaacac gattgcaacg cgcatacgtt
    26461 catcataacc tacgcaaata tacgcataac tttctccagg aagaaatctt tcacacgttg
    26521 cgcgcgatac gaaccattcg gggaatgcgc aggttctaat agattcgtcg cccggcccgc
    26581 cgggcgacaa atgcgctgcg tcacgcaaaa taactgggat aggcctctta tttaacatca
    26641 tacattctcc gcccgcgcta taataatcaa ataggaaaag attcggcgtc ctagtagcga
    26701 cgggttggta gtcgcctccc aggacttcgg cattgtttcc agtcgtatgt atgtaatatg
    26761 tttttcctcc agtgcgctta acatgcctgg ccagaaacga gatgctcgcg gacctaagag
    26821 cgcctactga aaacttctca ggcgaagaac tcgcgattgc ctgtagaact gcgcgtactg
    26881 aatggggtgt gcggcttgcg atttctgcca cgcactgaac gtctcgcgca tacacgtcgt
    26941 agctgatcag ctgatataga ttgggccctg ttttcaacgc ttccccaact gcccttatga
    27001 cacacgcaga gacatacgac ttgaaattaa tcattaattc ggtttcggag cccggagaaa
    27061 acgcacgcag ttggttttcc tctgctttta ataagggagc agccaaaata ggagcttccg
    27121 ttgcgatttc ggtctttctt ctttgtggta gacgagaggg gtgatcgaca ccttcttcca
    27181 tacaagcggt agcgagtaaa ttgctcaacg aagatggaat tgtggcagaa tcggaggaac
    27241 ggccccctaa ggcaatcgac cgctcatacg atataagata aagtgttttt ttggtcatgg
    27301 agtgggtacg tggaacgatg gatatgcccc cgcacctcca ccggttcgca attgtgagcc
    27361 cgtccgccaa aatgccgacc gcagaagata ggaggtcttt ggggcttaac gaattttgcg
    27421 atggttcatc gaacatgaga atgtcttcca aattcaatgc agtccctgta gattgctggt
    27481 ccttattacg gccctccaag cccctccgag tgtcgtggtt tctggcaaac cttcctttgc
    27541 ccacgggctc gagaccatct atgacggctt tctgtgacac gctgctactg ggtgtgcaca
    27601 aattattttc caaacaagct atcgcccctt ggcgcaatcc ggacactacg ctggcgtgta
    27661 tattctccgc cggccgtttt gcgcttaccg gcgctcgcct ggtgatagcc tcggctgcct
    27721 tcttaatgag atttgcgatc tctatattgt ctgtctctag tcgcgtgtcg agagtaggag
    27781 tgtcgaagac gttcggagaa tctgttactt gccgcataat gtcaaactga ccgggcagtt
    27841 cgacggcgga taaacacgcc tctaatttag cccccaattc tataacagcc gacggtaatt
    27901 cgacctcgta tctcttagta tatcgtatga attgacggaa gagcgtcttt aagcggttcg
    27961 catcgatatc gtatcgagta cctggaggaa ctaattcctc ttgactaaac agtaaatcca
    28021 tgtacgcttc gtactctccg gtttccctat cctgtacgtt aaagcgaata gccacggatg
    28081 taaacggatc aaagcggttc ttagaatcat attgtatggg aagactcatg aacaatccac
    28141 cttgatcgtt tcgattgagc gtcgcgaaaa gtttggcgtg gcccgggaca tgaggtatca
    28201 agagtatgtg tagtgcgcca gagggaacgt aggctgccgg tgattcgcgc caaccggaac
    28261 atttaccggt ggcattatag cgcatctgaa cacttaccgg aatcggcagc gattggtaag
    28321 cactgctggg tactctctgt gccgcatcct taaaacgggc gatatctatc cccgctgccg
    28381 acaaacactc atccggtaag aggacatgcg tcagtacgtg ccgattgggg ccgtgtttgg
    28441 gagtagatag cgaatacgcg gtctcgctct ctatatgcgc ctccatcctg caccggaatg
    28501 gcgagtcggg tcctgcggtc tagatagcgt cgcgtcgccg ttaatgcgag gggctatgcc
    28561 tttacggacc ctctcgactc agcattgctt gtttttgttt ctgcagagca ttcgcggcca
    28621 agatttcaac ttgctctttg tcgacgaggc gaatttcata cgtccggatg ccgtgcagac
    28681 aataataggg tttctgaatc aagcgaattg caaaataatt ttcgtgtcgt ctacgaacag
    28741 cggtaaggcg agcacgagtt tcttatacgg tctgaaggga tcggccgacg atctcctaaa
    28801 cgtggtgacg tatatatgcg acgaacacat gaaacatgtg acgaattata ctaacgctac
    28861 gtcatgttcg tgctatgttc tgaacaagcc cgtgttcatt acgatggatg gggccatgcg
    28921 tcgcacggct gaaatgtttc tccccgactc ttttatgaag gaaataatag ggggtatcac
    28981 catggataga aacacgtgcc agggagaccg gggggttttt actgcttctg ctgttgagcg
    29041 gcttcttcta tataggccgt cgactgtacg gaatcaggat atcctctcgc gagacttata
    29101 cgtgtatgtc gatccggcgt ttactgccaa caccagagcc tccggaacgg ggatagccgt
    29161 aatcggtagg tatggagcag attacatcat tttcggcctt gagcactttt tcttgcgggc
    29221 cctgacggga gagtccgcgg atgccatagg agagtgtgcc gcgcagtgta tcgcgcaaat
    29281 ctgcgcgata cactgcgagc gtttcggaac gataagagtg gccgtggaag ggaatagcaa
    29341 ccaagattca gcggtagcaa tagctactag aatttcgatc gacctggcct cgtacgtgca
    29401 gtccggagtg gcaccggcgc cacacgacgt ttgtttttac cacagcaagc ctgccggcag
    29461 caacgtcgaa tatccctttt tcctcttaca gcgccagaaa actgcggcgt ttgatttttt
    29521 tatcgcccgc ttcaactcgg gtcgagtact agcttctcaa gatttggttt ctaccacgat
    29581 tagcctgtcc accgatccgg tcgagtattt gaccaaacaa ttgacgaacc tctcggaggt
    29641 ggtcaccggc gcgacaggca caagaacgtt ctctggcaaa aaagggggct acgacgatac
    29701 cgttgtggcc ttggtaatgg cggtatatat atctgcccac gcgtcggacg cgacgttcgc
    29761 tcctataaga ggagtcgagg ccacgtgtcg cggcccaaca gaagcgtgac cggccccgaa
    29821 gcgtgaaata tatctgccgc gtcgcaggaa aagctaacca ataagcagac tcgcataagc
    29881 acaaaccgtt tattagaagg ctacccgatg aataaagtta ttttaattcc agttagaaat
    29941 aacgggacat aggtctccga cttttatact cgcgggcccg tcgaacgtgc acactttcaa
    30001 tagcgggcgc agcgctagca tgtcccctag atgcagagcc atggtaatcc acgaagacag
    30061 ggcttcgtaa atgggatatc tgcgccacgc gtcttgcaaa ggcgggggtc tcggaattct
    30121 gatgagctga cctactgctc tcgtggccgt ctggagaccc accagggcgt tgacgtaacc
    30181 gtcagacgct cccaaagtaa gcaacgtcgg tatcagagca tataggagca tgttaccttc
    30241 gtcgatagcg aaaatcatgt ttagcaataa ggttctcact gcagactccg acgcatccag
    30301 actatggagc gttggactaa tggtataggt tttcccgtta tatgtaatgg attccgcttc
    30361 acggctcgta gggggaggcg ctagccctcc gccgatcgct atcccttccg tggctcgaga
    30421 tagcgtctta gcaataattt cacgtgcgag tctcgccgga acggttgatg gaaataaaag
    30481 ttcggtatcg atcgattcca accggatacg ggagcaaacg ttagggaaaa gcggaggtat
    30541 caggcataca gcatccccgt tacataggtc gaacgggccg gtgttttgaa gtgccaggcc
    30601 tgaaggaatg gtccccattc ccaaaactac agcactcatt cgaccgggta gcgcgcgggt
    30661 gacgacggcc gcaaatcgtc gtttgtaggt cgatagcaga ctcagcgtat caggttcggc
    30721 cccagcgatg tagtatgact tataatctac ttctttgagc agcactctgg ctctgacgga
    30781 cggtaaaaaa agaactcgcc cctcacatcg ttgaagtagg ttcgcgtcgc acgtagaaag
    30841 cccgcagggg agctcgatct ctactgtcgt accattagaa gcggccataa cggtaccgct
    30901 ggcggtttat tttcggtacc gacggcggca gcggataagt gtataggaac caggccgagc
    30961 cgctgtcagg tcaagcacgt agaccgcgga aggttagcga tcggcgagct ggcagttcag
    31021 catgcaggca agcatccacc gatcggcgaa gcgtctttga ttaagtattg agccaagtgc
    31081 gtttctgggt tatccgcacc ccctgcgaaa tacgtgcgga gcaaagcttt gtcggtagcg
    31141 caaagtagcg gataggcttc ctgaaatagg gaacaaggat cttcgattaa ttccgtagat
    31201 ccgactggtc gtttgaactg tacttctccg tccgacgcga atgctgccac ggcagaaccg
    31261 gcttcgctga ttagtttatc caagcaccgg cttttgcagc acacttctgc cggggtaaaa
    31321 aatttatagg tgggactgaa gaggggagac gccccgctca aattgtaagt tccgttatag
    31381 agcttgtccg cgtaagagaa tttttgcgaa gcccacggat tgttggttgc gcggaacgga
    31441 taagcgggat ccccctgccg gtgatcgtac atgagtttct cgatatcgga tacttcctcg
    31501 tccgaatgta tcgccccggc cgccctccct ctcgggttac acggggttcg aaagtactcc
    31561 aggtctgcgg aaacgggtgt agggatgaac tcgcatatgg acatttggcc atgttccagc
    31621 ccgtcgggga gcatgggcat cagtgtacct agaaagggga cagttctttg cggagctgtt
    31681 ctctgtccgc gcgttgctgc tttccgtaga aagtcatcgg cttcggggtt tataaggggg
    31741 ggcgagcccc gtgtcaaatg caggctttgg acagtgttcc ccatatccgt cgtagcgttt
    31801 cgtaagagta aaggggtaca agtggccgta taccccacgc ccaaatcaac gttagctcgt
    31861 ggttgtgtca gagaaaactg caccccccct gcgtgcgggc gcttcgagac agacacctgt
    31921 ccgagaaaaa acgattcgga cgcccgttcg gcaaacaggc ccatatctgc taggaaccta
    31981 tcttgtcgta cgacggtaaa tgcaattccc ggatggaacc ccgttctcaa ctgatgatac
    32041 aggcctatag gagtgagttt gaaatatcct gccatcagcg cgtacgacat ttcgttgggc
    32101 ccgcatctac tttcgcatat gtactgtgcc acgggctggc ggaacgtaga ataataattg
    32161 gcgcccaaaa actgtggaac gggaggagct ctgccgagca gcgtacgcgc gttcccggcc
    32221 aactccccga ctgccgttag atggtcctga caggcgaaca aagcgttaac tggaacggga
    32281 tagaagtacg tgccggcagc gatcgtctca tcattgcatg ggtaggccat cattaaaagc
    32341 ccatggtgta acgcgccatc gaacgttcgc atatgccttg tcgccgatga cgtgccgcct
    32401 acatccgggg tggttccgta gagaatcgcc gttgtccgct ccgccatatt gttcaccgtt
    32461 tcctgcagag ttagaagcgc gtccgcatcc accaatattc tggcgttgtg tagcagcacg
    32521 ttaaacgtgt tggggacaag atttttagcg ttcaacgggt gcctcgggtc ttctgcgccc
    32581 aggggaggct cctcgtcggg ttggatgtcg ggaatgatca cagattgaga cgtagcgtag
    32641 atgttgtcga aacggatgcc catggtgcaa cactgacccc tggaaaatgc cgggaccatc
    32701 acgtaataat aaattttcga taggattgac cattcatggg tatgatgagg cgcgaacgtt
    32761 tgtcgatcgg cgtctcctac aggcctgtta tggactaaaa cgttgccggt gcgttcaaaa
    32821 tccgcatcct gcaattccag ccacggccgc acagcgtaat tttcgtcgct tcccacgttc
    32881 aaatacaagt ttctatcgcg cacgccgtgc gcttgataca tcagggggtc acagccccac
    32941 agtagggggg gtaggatcgc tctatcgatt aaggcgtggt ttaattcctc attactctgc
    33001 ccggtcagtg agtctgtctg aacggtataa tcctttacaa tcgaccgcag cgcgcgaacg
    33061 tgccgcatca gctctttgta gatattcgta cagtcctcag ggagttcacc gctgcataaa
    33121 taggtatcga tgaatgcgac catgtgaaag ttattgacga atgctactcg tttgcagttg
    33181 tcccagtaac tccgtataca ttgaatgatc agtcgcatca gtataccgaa attacgttcg
    33241 ctgccgtgaa ttacggcttc gattacataa aacgcagtgg ggtagctaac gtctgagaac
    33301 gttgcacata cggcattgat tgtggaagcg ctcattttgt ggcgactgga tgcgagctct
    33361 tggccgagcg catctctaaa gtcgctactg cagagaggta gcggagtatt acagttgcaa
    33421 acccgccagg aggcggcgat cgacgccatc acttgcggaa cgttatgcgg ccccgggagc
    33481 tctacatctc ccgggaccac aaaaaaatca aacgcgggat gcaactccat agatagatgt
    33541 ggatttccgg ccgataggaa ttgctcttga ctcatatggc attcatctac ccaccggggc
    33601 gacccgcaga gcacgtctcc gatgttctcg aaaaaccgac ggctagcttc ccgtagaggc
    33661 aaggccggcg ggttcgtcac atacgccccg aaaacacacg ttaaatcgcg tctgtcgcga
    33721 cgtaaatgac taaccgtcgc ttcgatatcc aaaaaggatg agtggcacac ggttccaata
    33781 gcatccgata aacatacgct aattatctgg ttgtctttgt tatggaaata tagctcccgt
    33841 ggcgggaacc cgcgcacatc tccttgacat ccaggcccgg gcgcatagtc cccaatatgc
    33901 cgcgcataac ggtccgcccg tttctgatat agtcccaaag gcatcacgaa cgttaaatct
    33961 atgtgtccga ttaaagggta ctggacttgc gttgcttgat aaacgcgccg ttccatggct
    34021 tctagaaaaa ttaacttatc cccaatggtc accaattccg caggcacttc tgccgtttgg
    34081 gggacatcgt cgtctccccg tacgacttca tctgtacgat cgatgatgtc gttttcgtcg
    34141 agattgagaa tatagcgtgc gatgtcgtcc atgttgcgta tggctttgcc catcactacg
    34201 gcggttacca ggtttgttcc cgatattatc atttctccat atgtaacggg caccctagca
    34261 gacgtatccg ccatgtctag aattcctgat agcagttttt gcctcaccat gctcgttgtt
    34321 actagtacgc catctacgag gcgccctttc gaatcggaat gggtcagcct cggcattgca
    34381 attgtctgat gagtagagtt aaccatcttg gcgaggaatg agactatact gtctttgctc
    34441 gcaccggctt tgctcatgat gaaggtatcg ttacacactc tgcgtttgag ctctgatacc
    34501 aaattcgctc gcattacctg cccgtttacc cttccttctg tcgtgctgcg cgaaaggggt
    34561 atcagtagcg gagtcggcgg agccttttcc atcagtattc taagcatctg atcgaccgtg
    34621 ccccgctcaa acgaatccaa tatcgttctc acgtttcgag ctaattgctg tatggctctc
    34681 agtctcaggt ggttagatat tgccgttcca tctaaagata cttcagataa taatgcgagt
    34741 gcttccgccg caacgacaaa ggccgcgctt aacgatcgct tgcatacgcg ctttaccatg
    34801 taagtgtaaa gcggttgatc ggcaggatgg ggcccctcgc gcgcaatcat gggttgctgt
    34861 atttcaaatt gcacggttcc ttcgcgcatg tatagcagat cgggagcacg cgtgcagacg
    34921 catgcgactg agagccccgt ttcgagaaat ctgatcaaag acaatgtatt gcagtaggtt
    34981 ccgagaagaa tatcgaactg ggccgaatag cgtccgttgt catcggaact gaattgtttg
    35041 aaatagtcga acatgcatcg atgggatgtc atttctatag cagtcaggag tctacctgta
    35101 ggcgctaacg ttgctcctac gttgaatggt gtcgaaattg cacacggtgc gattggcgga
    35161 cagtcggtcg ccggaggaca gcggcatccg gccatggtcg tcaacgggcc gcgtccgatg
    35221 taaggactaa ttgccaccgt gactatccga tgctatgcgt gatccagggc atctagtaac
    35281 gtttggtcgc gtcgaaggtc acgttaccgg ctgttcgaat gcgacgcaaa tgatagccga
    35341 tattgtagga gagacgtgac gtggagaatg cgcgagttct agcaacacga acgaaattgc
    35401 atattagact ttaacgatgc aggtttttat ctacacaatg aagtcgcgag tgcgcgtgcc
    35461 cttatatgtg caagtttccg cccctaatca gaacggaacg cacgtcttta tcagtgctcg
    35521 tgtccacaaa cgagggagga gaaatcccag tgcgtccgac acagctactg tagcgtaggt
    35581 gatggtagct cccattaaca ggtataccac agctccgtct gtcttatcgt tttcctctaa
    35641 ttgtaaaact ttctccatga atctcggatc ttgaaacacc atgcggtaag aaaatactcc
    35701 gaatatcacc gcccccaacg tagacagaat accaacgaag atttgctggc agttatccat
    35761 aggcatgaca tcattcttta tgtttctgta catgtaataa gtttcgagga gtaaggtacc
    35821 atagaacact gcggtaatgg tcgcgcccag gatcagaaaa cgattgtcgt gcccgtccat
    35881 cgcgtacacc agaaatataa tacaacacga gggtcggaga acaaatgcag atagccaaga
    35941 gagcacaaca taccgagtaa atttggggtt catgtcacag cttttcgaaa tagtgaaaat
    36001 tgaacctgat aagtaagagg acatcgtggc atactcggcc gcatcttcgc aatcgatatc
    36061 gtccgaaacg cgtgtaacta ttgactccgt gtcttgcata ttcgtctcta actgttcatc
    36121 gccaatatag tcgaggagaa tatcgcaatc ggtcggtttt gttgtatggt atccacgcct
    36181 gtaccaaggc atagtgccac tcgagaagga ccgtttctgg ccacacgtaa cgactttgtc
    36241 ttctactaaa gaccacccgg actcggtaca gacccaagct agagctcgag accgcggaaa
    36301 atggatatca aatacgaaca gaagatcttg tatagaaacg tccactttta tatctcggaa
    36361 tgcggccgca tagcttattt cttctgcggt ggttgtctca tggcggtcgg gcgaccgcct
    36421 accgatgact cgcaggcaga gtttgcaaaa tttgggctgg ctcttcgagg cgatggagag
    36481 tctaaaccct tggcagctta tgtacggcgg gaattgcttc gtagaggaat gaaatgggcg
    36541 ctgcctcccg gcgacgatga attattcatc gactgtatgg cctttttgaa tctagacggg
    36601 gcgtgcagtg aacgtgagat ttgcgatctt gtttgcctgg aaacgtatga tccggagatc
    36661 acaaaacaca tggtatccac gaacgtcatt tctggattgt tgatccagac ggcgcatgag
    36721 tcgccgcggg actgcgtgat ccacctgccc ggggccccac aagttacaga cgcacattcc
    36781 aatgctgtgt acgaatgtaa ttctggtgca ttcgtgctaa cttgcgcaac tttggtggaa
    36841 ctgcccacgt ctctgaacga tctcgtcgaa gggttgtttg acggtgtccc catccccaga
    36901 gatgcgctct cgtcgaggtc gcttagtaga cgaacgaacg tgattatcac gtctaccaaa
    36961 gccgcggaaa cgacgactat acagcggatg catgtcccgc gacataaaca gaggggcaac
    37021 ttaaacacca tcgcagctac tttgcgaccg gtgaaaaaac acgcgcggtt tagcccgttc
    37081 gtgcaagtaa agtatatacc tcgcgtactc aaaatatgga gttgtgattc agatagccat
    37141 tcgccgtccc taaaggagtt gcgggaattg ttttgtaaag tggacatggt ccgtagagaa
    37201 aacatgtacg cagaatcgca attggaacca gagtccgtca caagtgaact ggttctgata
    37261 gtcgatactg tatttgggag accgctcgca ccatttattg gcgtcgggtc ggaaaacata
    37321 cgcgtctcac atttccaaaa gttcttactg ctccagggcg tccttatatt aaatcgtttg
    37381 ccgaattgct acggaccgct tcgggagctg tgcattcagc atgcacctgc cggtgaagag
    37441 tcgcctcctc tggtatccga ctctgttatc gcagacatgg cgaaccatat gtttagggtc
    37501 gccgtattta ttggcatggt tgtggaaata gttgcgggat gtgtatcttt tgcatcagaa
    37561 gaactcgaaa cgcgatttcc cagtgcgacc gcgtttacgg atgctggcat tctactgaac
    37621 ggcatagaag cctcgccgaa gccaaattgc ttgtcggaac ttaaaacacg caaactcgct
    37681 cttatcctgg acggtattta tagagacatg gatcctatag acgttgctct acaggaatcg
    37741 gtggggctaa atacagcaga gttattatcc gcagcaatag atatctcggt tatgtctgca
    37801 tttgagcatt cgggatggtg tagcggctac atggaacact ttgtttcatt gctagatgcc
    37861 cgtctgagag agggagggtg cttggcaata ttccggtagc tttgtagcac agcggcgaga
    37921 cgcgcatagg cgtgccgggc atatacagaa cgtaagccaa gctggagttt gtgtaagtat
    37981 gtgctctaca gcgtgcggga agggcggttc gcgaataaac acaacagtac aggttcgacg
    38041 gttagaaagt ttccagagtt tattaattag attggcccct caagatcgtc tttgcgtctt
    38101 aatttctcat atccatggta cctaaagttg ctgacaagca ttttggcggt gacaatcgct
    38161 atagctgcgg ctattagtac acccgctgca gtagttgcga tgtaggtcgc cgagaggatg
    38221 gcaatgcgct gcgactcaaa cgctaggatc ctcacgactg tgccatttgg atacagcaat
    38281 agtgacgtgc catacaggtt actggtggtg gggttgaaat agcgcacgga cgaattgcct
    38341 gctgctagca attcccgctg caaatcgcgc gatgagatat aaatcgcatg tcgaacgtgg
    38401 ccgcttgcgg aatatcgcag cagcacgcag ccgcaatacg gacattcttt tcccagaggc
    38461 ctaggtaaaa ccgcaggact gattatacct gatgtcgacg tgcacggcag cctggcatat
    38521 gttatgtaaa gttggttgtt tacatcaacg ccgtctacgg tatacacgat ccctctgacc
    38581 ccggcccgcc ttgttacaat gtagctacct ataccggaga tgggtaacac cagaagagtg
    38641 tcggattcta acctatcagt gcccgaacat tccaaaacct ccgacgcgta tgtagcaact
    38701 gttctcccta ttgatgttcg cagctttgca attactgatt ccgccttggc ctgcagatct
    38761 tcttcgattc tgaccccctg agaagtattc tctaaatact cctctattac tggacggtaa
    38821 accacattgg ccatcgcgta taccctgtga cgccgctcgg aaatgtcgat cctcaatgat
    38881 gtcatgcacg gcgtatacgc gtccaaaata tgtacgggct cagtgctgcg agtgagtctg
    38941 atatacatgt cttgcaccgt taattcagcg gccgcgatgt gttcttcagt acacatcgat
    39001 gatgcaaata acagagattt gcgtgcgtta tgcgatgcgc gccattccat cggcgaccgc
    39061 tgaaaaacgc tgtcgaatgc ataatacagg gcgtgtctcg tggaagcatt ccacgagatc
    39121 gcgtccctga cggattcttc gtggagagac gtgataaaat ttagtgcgag gtcggaaatt
    39181 cgcgcccccc attcgccctt ctcccgaggt atgtcgaacg cgtacacgga ccggaatagg
    39241 tacaactgtc gcgcaatacc taaagaatgc gtccccctcg atacatcgct aatttttttt
    39301 ttcaatacgg atgttagtat agcagctttt tcattccata catgtgtccg cgataataag
    39361 aagcacgtgc cggggtccgt gctcggggca aaattgcaaa gtgccgcggc gattactttc
    39421 agatctgcct cccttttaat taattcatcg agggagacgt agccagactt aaaagcggcg
    39481 tgtacggacg caacaagcgc cagaaacaaa cgcgtcgtta cgatcctaaa gccgtggata
    39541 taattactag tagatgcggg catagaggca gaaataaaaa gccgggagtg cgcttgagtg
    39601 atatgaagat tataatctaa taggtcatct acactcgaaa ccatatctgc gtgggccttt
    39661 aattccatat ccgaggcgtt ctgatatgtt cccagtaggt atgtcgaaag gagatgtcga
    39721 gaggatccgt tcatcgggtc atactgcttc atcggtggcc acagcaaagt catgttggta
    39781 gtccccgacg ataatattag ttccacaggc gatgcggctt ccatagagat cgtaacggag
    39841 gcgaattgca ctcctacctt cattaagacc tccgcggtat ttgaaccgaa tatcgtcgtc
    39901 cgcacgtggg cataatctgt cgggactagt gtgtccatgg ggtccacgaa gcatgcacgc
    39961 tttgcaaaag ctcccgataa ttcgctgttg agaataaaac ggttctccgg agtgaagaag
    40021 tcattcggct ttatattttc taacactgtt ggcgggtttg cgccagtagg ttgtgacttg
    40081 gcaccaccgt gagcttttgg accgggtttg tccggtgtct ttttttcgtc tcgtcgatgg
    40141 gataatacgg ctgccgtcaa cgagtaatcg aggtccggct tcgcgttcaa aactttgatc
    40201 aggttattag acgttagcag cctagatatc ggtcgtttga agaaaaccat ttgcttcact
    40261 tcacttattg gtaaatgaaa gagaatgccg ctcgccggcg tagatgctcc tatatataca
    40321 aatgtcgcat tgtcgcgtac ccaggacgtc gggctagtag cattttcatc ggccgatgaa
    40381 aagtccaatt ttacggacgg cggtctccgg atgtctagca gcgaccatac ggaggggata
    40441 ttatccgagg tgggggctcc cggggaagat gcgagcgcta gcagtaataa ggtgcatacc
    40501 gccattccga ttacgcggcg tcggtcgttg cctctgcgta tcgctagttc gagctcgggt
    40561 ttccgaagca acgtaacaca catatcctat agtgtacaat gtttcgatgc aactgaaagc
    40621 aacgagctaa agcgaagatg ttttgcaggc gacaagggca tgcattaatg cacactcgtc
    40681 cgaaatgtcg tagtctcaaa tgtccatctc cttattgaat gcctgaacgt ccgcctcgat
    40741 ctcaaataca tcattccagc tcatatgcgt tattaatctt tccgccattg aatccataag
    40801 atactctgca catttctgga ccgacatgtc gctgacatca agccgctcga cattgatgtt
    40861 cctcagtttc atcaacatcc cccacaatat ccacccgtat accgttaaca ggctaccatc
    40921 ttcactgcat aattctttcc gcttaaaaat tggcaaaagc gtgtgctgca atgacacccg
    40981 gctaccatgg taacctgaac ggggaccatc tataaatgta gaggccatcg atgcatcaaa
    41041 ccacgggagc tgcatccact ctgtttccca ttcgtcttta ctgtaaggac aaatgcaatt
    41101 cgcatacgcg acggtatctg ctaaagccga atatgccgca ttgagcgccc tgagcatgcg
    41161 cacgtctgta gtttcccccg ctctgttcct ggccgatagg cgcttcaggt gctcggtttc
    41221 gtcgggcaaa tgtgctatta ccaagttgca gccgggcggt tcgtggggca accgtgtaat
    41281 cgcactaatc aacatttcca gagaacaatc gccaatcaga tgtcgggcga tgggaaagca
    41341 gacggtagct gaaacaggat ggcgatcaac tattaatata agagatgggt tgccccgtgt
    41401 tccggctaat tgatgacatt tagatgatat tcgttcgtgt agtacaatga agggatcggc
    41461 aaatttggcc tgcaaagcca ttacgatcat gctagactga aatagagata attctccccg
    41521 acgccggcgt tcggaagcgt cattcacagc tgcaactaaa tcggtaaaat agcgacgcca
    41581 atatttcaga ggctcaaaaa ctttcagcac gggtactccc gtcgcagagt ggctcggcac
    41641 ttcgtttaac atcgacgttt tacctatagc caatggcccg tcgaggtaga cgcggatcag
    41701 ctgcgcggat gtcatctgag agggcattac cgaccacggc cgcacgtccg acatgtccgg
    41761 cgcgcaagaa aactgctcgt agacgatata accggcggag aagcacttct ggacgctcaa
    41821 gttaccgtgc ggctgttaac ctcaagagaa ctctagcggc cggcgttcga tgtcacgcac
    41881 gtttttacca aaagctctac gcagaatcta tgcaccttcg aactcaggcc gatgattgga
    41941 cggggcgggc cctatctaag attttaggaa aaattatggg gtttgatgta tttaaagcgg
    42001 caactgattt ccgattggtc tttgaagtaa atctggggcg gcgaaaaccg gactgcattt
    42061 gcatgattag gtgcccccgc ggtctatggg aggcaagttg tgatggcgct tgcgtcatca
    42121 ttgagttgaa gacttgtagg ttctccaata atctaggaac ggccagcaaa aaggaacagc
    42181 gcctcactgg aacaaaacag ctcttggatt caaaattgct gattgactat ttagcgcccg
    42241 taggttcgga gcgtattttc atctgcccgt tactagtatt cgtgtccagg agaaaattaa
    42301 acgtgttgcg tgtaacctgc ctcagaagaa acgtcgtaag taccgatttc catcgtctcg
    42361 caactttaat aacgcttgca tcggaatata agattaaaca ggtcgacagg cgcagaacgg
    42421 ctgttcggaa accggctcag tgtgcaagaa atttcgcaag tcttgagaac gcgcggcgag
    42481 acgatcgatc ggaagaggtc gagatacaca cttttcctaa ctgtagtatt gtcctaccac
    42541 ctcgtaccat tctacccgga gccgcgaata cgacaatgca ccgtttggca agtattgtta
    42601 gctgcttggt acggaagcag taaccgaaat caacggcacc ctacgaccag ctatgttaca
    42661 cggtgcaatc cgcggccctt ctcccgttac tttcttgtcc gcagcccttg tccaacgtca
    42721 gttgtccgta ggcactgcag caaagcatgg cgagctttgc ctgggatgca agaattttga
    42781 cagacccggg cccggaatct cacccggctg atgtaaagaa tttcatagca cctccctggc
    42841 ctctgcactt ctggagggaa cctatattta gcggcaatct tggggatgcg gaacggcaac
    42901 tggcaatcgt taaggcgcga aacagtgccg cgattgcagc gttaactagt ttggacgacc
    42961 gtactgattt aattgcggta gaagtggagc gtcggcttcg accactagaa gataaaatgg
    43021 aacagatcgc aacgactttg gcggatttgg aacgagctgc ttctgcggct gaacttgccg
    43081 acgccgcagc cgatgaggct caaaatgtcg tcgattcgaa cgaatgccaa aaaaacattg
    43141 gtagcgctgc gagtcgcgag gtccaaatag tcaggaacga tccgtcgcta agatacgact
    43201 ctaacctgtc ggtggatctg ctgaatatta tctatgccag caggggcgct gcgaattcgg
    43261 gagtggcgtt cggtacatgg taccgtactt tacaaaactc ccttattgcg gaaaatccca
    43321 gcgctgcgcg gaagatagat tatcgcgatg gaagaatgtc gcggaccttc attgcaacgg
    43381 cgataacgtc cttacagtca tgtgggcgct tatatgtggg gacgcgtaac tattcttctt
    43441 tagaatctgc agttctatgt ctgtatgcgt tttatacaaa aacgggagct aatgtgtccc
    43501 atccaagttc ttttaagagt gcattagaat ctgttcccat ttatctggat cacatgtcag
    43561 cgagcctcgc tagcactgat accaggcaaa tctacgggtt cgataccggg aaattgccga
    43621 aggatagttt cgccgccccg tccggaaaat acgaacgggg cgcgctaagt gatcatagcg
    43681 tattgagagc tctagcaaat tctcgcgtgt tgcctcctag tgcggggtcg atcccccgtg
    43741 gagacgtagc cccagagcta gatgccgacc agagcgttcg taacgacgaa gtcaacgctg
    43801 ccgccgcagc gctactggga cgagcccaac ccctcttcct tatggaggat cagacgttgc
    43861 tgagagccac tttggacaca atcgtggcat tgcttttact tcgccgtcta ctttggaata
    43921 cgaatatata ttcagctaga gttaaaaacc agttccaact gggggcgttc gttccaggcg
    43981 tgcctccaga tttaaccgta ggagcctcag tagacacgcc gggggatgta attaagagtg
    44041 acgggagaaa cttaaccttt ttatttcaga gatacgtagt tcccgtatat agtgttgtca
    44101 aagggataga gctcacacaa ctctttccgg ggctggtagc gttgtgtttg gacgtcccgt
    44161 tttccgatcg agggttatat agcaccagga cgccgccatc gcgtatcatt gacgtttcgc
    44221 tgagtaaata tcaggcctcc ctcgtgaaat tgatttcctt agagcttcaa aatcgttccc
    44281 gcgctaatgt tgtatctgtt tgcgaggtga tcgcgactca cgatttggtg actctgcagt
    44341 atgagcgagg cttggaatcg ctgatgcaag tccagcgtcc ccgcacccgc ttttttgaaa
    44401 ccaagaaggc tttggcgttc aatgtggaaa cggattacga tctgctttat ttcgtgtgtt
    44461 tagggtatat tccgaggtcc gtatctgcat ccgtgaaata tacgcaaaat attggcacgt
    44521 gtccagctta aacaacagtt tagtagaaat gaatccgacg gagaaatatt cctcggtata
    44581 tgtcgccgga tatttgtttt tgtacggtgc agatgatggc agcgaactgc acatcgaccg
    44641 cgaggatatt cgagctgcaa ttccgacacc tgctcctttg cccataaaca tagatcatat
    44701 acggaactgt accgtcggag ccgttctggc actaacggac gacgaacacg ggctgttctt
    44761 tttaggaaaa ataaattgcc cggtgatgat acgcacgctc gagacggccg ctagtcagga
    44821 aatattcagc gaattcgata atctcaaaac agaggagagg gtattgtatt tgataacgaa
    44881 ctatctacca tcggtgtcgt tatcttccaa acgtcttgaa cccggggaaa aggccgacaa
    44941 aagttttctg gcacacgtag ctttgtgttt attggggaaa cgaatcggga ctatcgttac
    45001 atacgatctt actccggaaa atgccattga accgttcagg aagctttccc ctactaccaa
    45061 gacggcccta ctatccgagg ggcaagaaac agagcggctc ttaggcgata aggtatggca
    45121 tcctagtaaa gaggcgatgt caaccgcgtt gttgggcacc gctctgaaca atatgttatt
    45181 aagagataga tggcgcacta tttccagccg aagacgcatg gctggtatat ccggccagaa
    45241 gtacttgcag gcgtcagctt ggaccgcact ggccgagtcg atgacgtcca ataacgcatc
    45301 aacgatccat ccaatcggcg aaaccgcaaa ctcggacggc atacaaaagg atgatcgaat
    45361 tgaagtgtgc gccacttcgc cgcaaacgaa caaaacctta gagtccagag cattttcggg
    45421 agggagtggg ttcgccggga ctcatgcgat ctctccaccg ccccagatga gcgcacaatc
    45481 gccaaccgag atgtctatga atactaaatc tcatttcccc cccggcgacg atttcatttg
    45541 ggttcctatg aaaagctaca acgaactggt gtcgagacag gccacgcacg caattaatgc
    45601 ccccgaagct gcagtgggga gccaggcacc gtatagttcc tctccgttaa tgattccggc
    45661 gcacttggga cagcatgctc acattggggg atatggacat gcctccaacc cgcaatttgc
    45721 atcgggggcc ataaattaca tgggcgggtt tccatatgct ctgcctatcc accccgttcc
    45781 aaccggccaa tcgtctttgg aaaccaagct gtcggctcta ctggattgta tgacgaggga
    45841 gaaaaaatca gtcgatgggg atcgcggacg tgacgacatg ttctctggcc aagaagaacg
    45901 aggccggcgc gggcgcaagc gcccgtacaa ctgtgacaaa tctcccgagc aggaacctta
    45961 ttatccaggc gaattccagc agtccgagca tcgtaactta agatgcgaag acggcatcga
    46021 atacgggcga gacgcgactc aaacgaggcc cgccctggcg ggcctcgtga acgctgttac
    46081 gtctttgcag aaagaagttg aacggttaaa cggaagggcg caagcccatt cgataccggc
    46141 cgtacagcat atgcaaggaa tgggaaccgg attccaggcc cccgtatact acgcataccc
    46201 tcctctccca ataccacatg tattttcgcg gccgccagaa gacggccgcc caatttcttc
    46261 cggggaggga agggcctcgc taggtagcgc cacgggcact cctccgtctg gatcggtacc
    46321 tccgaacgct tctcaagaac gtgtcgatgc agctcctaaa agcgacaccg ttcagtcgca
    46381 agatactgtg aacgccagta cgatcgccaa tgtacatcgc gccgacgatg caggcgcgga
    46441 tattttcatt aaacaaatga tggcttaaat gatggcaggg gatccgctat gtcgacgtat
    46501 aagtttatac attttgcgac cgcaatagca aataaaagta aaataatcgt atgcgcacgt
    46561 gagaatttat ttatcgagaa acagcatcgc gctaaacggc atcgtcctcc gaatcagagt
    46621 acacaggcga taatctatcg tagtgctggc cactactttt tagcctcagc tttgttaggt
    46681 gattagaaag aatagcagtg gtgcctcttg tttttttgcg caaatcattt tcgtggcgtt
    46741 cctctgcgga caccaacgcc atatatttta tcatttctcg agccttttgt aatttttttt
    46801 tatcgattgg tgccttttcc gagtccggtt cttctccgtg caactcgcgc gttgcctggg
    46861 actttagctc ttccgtcgtc actggatata gggctttcat cgggttgcct ctaagcttgt
    46921 ttacgtacca gtaagctaga aacgcagcca cgagtcctgc tataattatc aatcctaccg
    46981 ctaaagctcc gaacgggtta gacataaaag cggacactcc agatacggta gccaccacgg
    47041 caccggcggc acccacaacg accttcccta tggcctgacc gacttgcccc ataccgttga
    47101 acaattccgc caggccgttc ataaaagcgt aatttgtatc tacttctatt actttattta
    47161 tgtcataaaa ttttagttcg tgcaactggt tgcggcgagc cacctcggca tagtccaata
    47221 ccccgacatc tcgcaactcc tctttcgtgt agaccgacag aggaagaatt tctctgtctt
    47281 ctaacagtgt taagttcagg tctacaaacg tgctggctgt ctgtatatca gcaacctcta
    47341 ccatcttaac aaagttatag tcttcgaaca gagcgtatgc ggatccaaac aggaagtatc
    47401 tccgctggtt agccgtacac ggttctacgg cctccagtgt tgggagtagc tcgttatttt
    47461 cgccgagctg gccttgtatc ctcccctggt tctcgccata cgaaaacaag accagcgggc
    47521 ggctgtagca catattagta gacgtggcga ccctcatgga attctgcaat gttaccgatt
    47581 ccgcgtcgat cccagtacaa gtagacacgg cggtcacatc ccctaacatt ttagccgcta
    47641 cgcgtctccc taaggtagcg ctcgcgatgg cgctcgggtt aattttcatc ccttcctgcc
    47701 ataaagccag ttctttattt tgtaattcgc accaggccgt ggcgattcgg ctgaacatgt
    47761 cgttgatatg agtctgtata tggtcgtaga gaaattggag catggcgaat tggacggacg
    47821 aagtagatct tatcgtagcg ccttcgttca gcgccagttt ttccttcggc gcattacgga
    47881 gctctcgccg caaacgggac aaggagacat ttgttttatt ggaaagagca tgcttattat
    47941 gtactaggtc tagcagctcg tctgtcctgt tgtccctcat cagttctctt agatacatgt
    48001 gagccagaga tttcgacata acgggctgat acgccacaag aaatccaccg agggccaaaa
    48061 aatattggac cttcccgacc ttgacgtggc tgtcgttata tttttgcgcg aatatgcgct
    48121 tgattgttgt ttcagcgtcg cgctttacgc actgacctag cctgatacga tccggatcga
    48181 attcagtggt attgctgata aatgttgacg atagctcgcg ggccatgaat ctatacttgc
    48241 cgttaaccgt tgcgcgcaac atttcagtaa catctttcca tttaaccatc gagcatacac
    48301 gagcggtctt tgctgcccag tcccacccaa ccgtaaaatg tggagtgacg aggaagttac
    48361 gcttgacggg tatgctcgcc ttctgacgct tgctcagatc cattgggaaa tagccgtcta
    48421 tctgcctaaa ttgttctagc ggatagccca tgggttcggc ggcggcctcg ggcggggcga
    48481 cgccataaaa cggggacata tttgcgatat ctccgttcgc cattgcaaaa tacgagtatg
    48541 ggaatgcagc cctggcatcc atttcttcca ctatgcagtt gacagacgtc cccgtccgat
    48601 atacccacgg agacccccat acggtataag tgtcgttggt cgtatgccac gccttggact
    48661 cgggggtgtt gaattttgac ggttgtagaa gtacctgttt ttctccggcg tcgccgtcgt
    48721 atgcctcgac gtatacattg tttctcaggt atcgcgcttt ggaggaacat ctccctttcg
    48781 cgtcgattac atccgtaatt tcttcgatgg aaacgggagt cctatctgta aacctgttgg
    48841 tgatttgtct gtacgtcgtc ccggtccagg tcgtcgtttg tataacgttc ttataataaa
    48901 gcgtgacttt gaatttgtat gggtttatat tctctttgaa gagtatagca attccttctc
    48961 cccattcggt ggcctttagc ggttcggggc attttcgcgg cggttctaac cggaccacgg
    49021 tcgtaccgac cgccggtggg cagagaaaaa atgaggactc gtcttcagac agctgtacgc
    49081 tcgagactgc ttcccgcgac gttacgtttt gggccctcgc gactcggccg aagaagtaga
    49141 aaaccacaga tatgaaaagt ggaacgcaga tcccactgaa atggttcatt acgggttgat
    49201 cttaacgagt ctcatcgata gtgtggaaag gcgcgccgcg gtacgaaaga tatcgcactg
    49261 gtcaagtggg ggtgtggtca tggtttgttc gttccgcacg tatctgatcg cagccgcggg
    49321 agccatgtac tgcagaatgg aatagagcag cgagaaaaca tccgcatcaa ggattacggt
    49381 cacgttgtct gattccgcac cgaggaccgt tatgagaggg cattctgttt catatgtgac
    49441 gtatattcca tcctcccata tgtattccac gttaacattg agcggcaagc aatctgcacg
    49501 acgcaggtgc aattcaccgc agctgaacgc ggaagaaaat aaagttgtcg ccaaaatcac
    49561 ctcttttata tatttccaag ccattctatg ggccgcggtt atactatcta tgccgtcgaa
    49621 gtcgtaaaac cctctgaatt tactgacgat ccagtcagac gaactgcaac tatgaatcat
    49681 aaatcgcgct atttcctcct tcaaatgcgg caatagacca acgttctcta cactgaaata
    49741 tagcgctgta ttcgaaggtt gggcgaacct atgtacatcg tgattaaaca tcgggccgtt
    49801 taacaaccga aaaaatttgt gagttaggct ggggagcatc gcgggatcta ttctgtgctt
    49861 aagtaatgac gtttgcatga aacggtgggc gtcgaacgca tcagcggtga tgcgattatc
    49921 gatgatattc gtacatcgtt tcctaatggc ttccaataac ctattcctgg agcggaaccc
    49981 attgaataat gtcgtgtatg agtctatcaa tatttcaccg tatacgttaa cccgcagcat
    50041 tttttccagc tcctttcttt gctctgtaat acatttatcc aaacttgcga gggatctttt
    50101 acttaggcgc tctgcgtaca ttttgcgtct ccgagcaacg tcagccgatg ccgatcgtac
    50161 caactctaac cagtcgtagt gctcgcggac atcgggtaac ggggtaaccc cttcgcgaat
    50221 ccgtagatgc tcggagttac taaaatcgtc ctcgggcgcg ccgtcgccgt cctggcatag
    50281 gggaccattt ctcgtgctat gcgaagtcac ttgttctaaa gtagtcttca gcgcgtcttg
    50341 cgccgcctcc tccgggtaca ataaacgttt tagcagagga gtcgacatat gatgatcgta
    50401 acatgctctt atcagcgctt ctatgatgtc gtctggcgct accgccctac cccccagaag
    50461 caatctgtcg gccgcattca tattctcgat ttcttgtgca aacacccgtt cgaaatgatc
    50521 catgcgccgc ccgaataccg tcatttccac gacggatgtt ctcagatcga aaagacgctc
    50581 tttgaatgct aaatcttcga ggttgtccgc aaacgagtca atcgtgtttg ctctcggttg
    50641 gttaggtttg cgttcggacg aggcaatcca gaattgcagc tcgctaatgg catacagatt
    50701 ccccgatgcc ggcaaaaaaa cgttatgcgc gtccaggacg gcggttgccg catcggcgac
    50761 agacactgta tcgccgctac ctccgggatc cttgtctccc cttgtcggtc taatgagcga
    50821 aagtgccgct tgtacaaccg aacgcttttc gtcggacaga caagcggcat gtgggatgtg
    50881 cgctaccatg tcatctgggt ggacgcggag aacgatctgc ttagttacat gattacatat
    50941 ttttccgatt atgcgcttat gtgccgagtc tccactgttt gccgtcacgc atagttcttc
    51001 aaaacaaacg gagcatggtt gtgacgggtc gcacaactcc ggcgaaacga ccgatcccgc
    51061 gcccagagtt tcgattagat atcgatccag ggccaacata aagttttctg cggttcccgc
    51121 ttttacgatt aggtgacagt aattgagttg cttcaatatg ttttctacgt cgtgtaggaa
    51181 tttaatctcg gtccgcaccg aaccgccgta agtatccaat tcgacgactt cgtgatacgg
    51241 acagtccccg gatatggtca tcgacttaat aaaaaagccg tgtacatctc cggtgtctgt
    51301 aaactcgcac agcgcacgca gcagcacttc tccgtctagt cgagctctac gcagagctaa
    51361 ccacaaaccg tagctaaggg gactaatatt cctctcgagt tgctccgtca gcccaggagc
    51421 cattaggttt tccaaatagc gtaccatgag cacatttaat ttcagcggct tgatcattcg
    51481 cacacctact ctcggatcgc atctcttcag cagctctact tgaaacaagt acgattgcaa
    51541 ctgaccccat acagcgagca gtttctgact agcgaatata ctgtctcgct caacgtctag
    51601 cgcttgtgcg tttccgtgag gcatatccaa cgtctcggtt cgcctcgtct acgctgaatt
    51661 ggacctgagt cggagggaga gcatgatgat atttataggg gttagccgat aacgccccat
    51721 ccggaataag acccacaaag cgatataaga aagagtatgc tgtatatttc atatttccgt
    51781 atacaggttg aaaagccgac aatgacgtag tatctatctt gataaggcta tgcgagcagg
    51841 ccccatccgg gatatgagct aggtagttcg atacaaaagt aaacgcgttt agacccaaac
    51901 acagatttta aaagcccgca acccacgtac tgggacaaca atacacgcgg ttatagcata
    51961 tccaccgata gtcctggagc ccgcttttcg ggaacgggct ccaagtcaaa aacgtccgaa
    52021 cacggacgtt tcaaagttgg ctctaatatg gacgggccgt ccgcgcgtct ttccgtattc
    52081 tcatcaagag catcgtaatt aaacgtaggt ccgtccagcg ggagagcctt cgacatatcg
    52141 accatctctt tcgctaatat cgcggcagca tcgacactcc aaccgccctc gcatccctct
    52201 acctgcttgt taagttcatc tatcaaagat gagatgtacg catcgttagt tatttccatc
    52261 cagtcatcca gttccatttg ccgtacacga tctccaacca ttttcaacgc gatcatatat
    52321 acggcggcat gaggcgctcc gcactcctca gataaaaccg cccgggctct atccacgagc
    52381 gtggtttcct tcaagcccga ggaaaatcca gtctgttccg atacaaagcc gaccctagga
    52441 catgccatga cgaaacggtg ggttctatta aaagacatta tggagcagac gtttctccca
    52501 cccattatgt tgccccagtt gccggattgg aatacttttg tgctaccggc cattccgtga
    52561 tatttactga tgctgacggc tatcacaaca aagggtttag aggccatgat aggaccgacg
    52621 agattagtag atgaaaaggc agcacaccat gcttccttat gatcacagat attttttagc
    52681 agttgctggg cggctggtgc cacatctgac ccttgtgtga ggatatgttc gatccagggc
    52741 aggaccatag ccggatccct aggtcgcttg gaggttgcaa ccaaagccga aatcgtgttg
    52801 ataaagaaat gcttatgtga acagtacctc aggatggtat tcgctagata aaattgagcc
    52861 agctccccga agcatgtagg actgatgtta atgtaattca tatcggcgta gctattggta
    52921 aaccttttaa tgaatgacgt gttctcctcg gcatctttgg agagtatacc ggccggcaac
    52981 tgattgcgtt gtaagaggat ccaaaaccag agagcattgg gagtcgtgcc attaggcatc
    53041 ttaacattcg gaaaaagttg cgtgtgatac cgtttgagcg caaagccgag agggccattg
    53101 agcacatgca tcgcttttgc cggccgttga tacgcttcta tcatgcccgc cagccgggat
    53161 tttgtagcgt cggagacggt actggaaacg cctccgacga acataacttt attcttcact
    53221 ttaaattccc ggaatatctc aaatgtaact ttcactagat ctccttccat gtgcaccgcc
    53281 agcggatcat gctgagattt gctaggatcg ggaacggaga tttgttgatc ctctaaggtc
    53341 accgttatgt ttttagatgt gatgaacccg gcgttttgca agtccagtac gcgccgcctg
    53401 agtaccgctt ggaactgagt cctaaaattt ctagcctcta cttgttgccc gtgcattatc
    53461 atagagcact ggcttaacgc catatcttga acgacggcaa ttatcgtgcg cctggataaa
    53521 aatgagagca cgggacatat gcctgacgaa tacggctcta ttgccagcga aagggtatgg
    53581 gttgcatcac ctagcccttc gcgtatgtta tattctctga tttctgtcaa atttcgcatc
    53641 agctggccag cttcgctctc gattatatta gccattgtcg atagagcacg cataaacgat
    53701 ttgccatccc ggatgatggc atctgcgggt gtcatgtctg ctgggtcctc gcatgtcagc
    53761 aaaccttctt tttctaacgc tttcattact ctttcgaccg tcagcttgta cgtgtcctgc
    53821 attacactgc ggctcgtctc tccctccgat cgtttgagag tcgagaatgg ggcgtagctt
    53881 cccagcgcgt tcacgtcgca gtagttattc gtcatagatc caaagagccc catagcccca
    53941 cgcatctgat acccgaattt cggcaatcga tattctaagc gcttaattgt ggtatgggcg
    54001 caataaatac gcgacgcttt gtcgcacaaa tcgcatggta cgtccgcgtc catggcagat
    54061 gaaacaaatt tcacggtatc taaatcgtga tggcaagctt gagatccgcc gtcacacctc
    54121 tccaggtaga acaagaatct tgccagcaat tgcggacaaa acccacacgc caaaattagg
    54181 taatctaacg agtattccga cgggctggcc gatgtggctt tggacaaatc ttcgcccgga
    54241 atcggcttgc cgtctctatc gattaacggg tttgaggcca aatgcggcgc ggctatttgg
    54301 aaaaaccgat aaaacgaggc tgcggtcgta cttgtgtctt ttccgtctgc gctactcgct
    54361 tctcccacct cggtcatgta tataaccgaa ttcgaactaa acaccattgc cccgaccagt
    54421 cctgccacgc gggccatata cgcagacagc gcttccactc tatctgtata tccgatcgga
    54481 ctgcaataga ggggccattt ctttacatcg ggtatagact cctcgtagac cgatgtcgcg
    54541 attacgtttt ctatggacag agtagcgtcg gatgccatta gagaagccgt cctacgttca
    54601 taccccccgc cagatagctc catgccttcc tttttccccg ctttatactg cgatttcgaa
    54661 gcagattcga tgggagtgaa tgcgttaaaa gctgtatctg cgggtaacaa tgttccctcg
    54721 tgattttcgt caaagcttaa atgggcggca cagcgcgcaa tcgcgtctac attgcgaacg
    54781 cgaaggccta cggccgcggt actgagcaca taaccgtgta atagacgaca taaggaatca
    54841 ttatagaaag cctttggcat aagagctccc tcgcctagtg ctctaggctt cgtactaaat
    54901 ggatcgctgg caacgcggtt gaagtccggg aaaaccaagt gcaggggata taacggcatt
    54961 ctacgaacat cgacgccatt aatgctcacg actccagtac caccgtaatg taaatatgag
    55021 ttgcagaggt acacggcctc tttaaataat tcggtcacta ctaagtagag catagtttct
    55081 tgaggattca ttccgagatt atcgcatatt tgctcgccgg ttgtttcgaa cgacgtggct
    55141 accgggggcg aataggtgct gtagccgaat cttcctcgtg ccaaatcaca tgctttagtc
    55201 agattcggag ccttcgtgca cggttttata cattctccgc cgtgaaacac aaacacgcac
    55261 ggatggtaat gcgtcggaac gagcttgaga gtagttgatc cgctacccag acccgttgtc
    55321 ttcgttcctg caacagctgc cacgttccac atgaaatccg cttcaactgt aagacctgaa
    55381 acgagaggca atatcgcatc ctcgcagtca ttgctcttgg ccgcgaagat cgagagatct
    55441 tcagctggca tgctgctcgt gggtgcagca tatacatatc ctatcggccc cccggtgatc
    55501 ttaacgcttt tccctacatc catggttaag gtgtcagcgt ttatccggta gactgtacaa
    55561 cggaatggca aggggcgatg tgccttccaa agctgcgaac gccggcttcg ccaggagatg
    55621 gcactttgac tttctcgtgc cggatgtttt aaagccagag gacctccaaa ggatatgacg
    55681 caacacttcc taaagtgcgc cacgaaacac gtcgcgcata ttgtatgttt tataagtcct
    55741 cgacttcaaa cttgccttct ctgtaagccg atatgtcagt agatggggct agaacttttt
    55801 tcaacccgta cctcggtgca cgaaagaggg gacgggatga agatagtacc ataccgccgc
    55861 taagtagacc gcgggacggg gagagatacc ttcggcaaca tcgcaatgcg attacctata
    55921 tagcgactat agacgaattt aaatatatcg cccccaaatg cttagacgcg gcggaaataa
    55981 agcagcgggg cactcatatc ggcaaattga aacgctcgcc tatactgtac aaaaacggag
    56041 aggaacgtga gttcttgaat ttcgaggctt tgggggacgc gtggccacgg agatgtttta
    56101 gctggaataa cgtatcattc ttacccacgg aattcgaccc gcgtttttct aggtttcatg
    56161 tgtacgatat gattgaaacg gtagagtttg caaatggggc aacaggcaga gataaaaacc
    56221 gttttctgga gctattgcgg cctatgggca cgattattac catgatggga atgactgaat
    56281 gcggcaggcg cgtggctgtg catgtctacg gcgtcaaacc atacttctat atgcgtaaga
    56341 tcgatgtaga caccgcctgc gggagtcgat ccacccgcgg actcgctgag cagatggcga
    56401 gcgtggtacg ctcgtctgtg aacgaaagcg caagaaaacg attttacggc tcaagcactg
    56461 tgacggccga ctgtttcgaa gtggacgtgg tacgtcgtaa ggatatttat ttctacggga
    56521 cagattgcga agagtattac cggattaggt gtcagagcgg caaattcgtt gcgctcatat
    56581 gtgataactt tcacccctcc ataattaaat acgaaggcag tgtcgataca attactcgaa
    56641 tggtgctgga caacgccgga tttagtacat ttggatggta ttccctaaaa attgggaatt
    56701 gcggtgagaa agtacaagtt cgagcgcccc agcaccatgt tacttcatgc gacatcgaaa
    56761 ttaattgtac ggtggacaat ttgattggtc atccagagga cgatcactgg cccgattaca
    56821 agctcctatg ctttgatatc gaatgcaaat ccgggggagc gaacgaatgc gcatttccgg
    56881 tggccacgaa cgaggaggat gtagtcattc agatctcgtg tctgatgtat tcggttcgac
    56941 aaaagcaatt agaacatgcg ctgttgtttg ccctcggttc atgtgatctt cccgaaacct
    57001 tccaagagac gtttcgtgat acctatggcg ttttgcccga agtcctcgaa ttcgtaacgg
    57061 ggtataatat agtcaatttc gattgggcgt tcatagtgaa taagttgacc accgtttacg
    57121 gtattagatt ggacggatac ggggttatta accaaagagg gacgttcaaa gtatgggatg
    57181 ccggggcaaa cgcatttcaa aaaaaaggga aatttaaggc caccggaata atcgctttag
    57241 atatgtattg catagccacc gagaagttga agctgcaaag ttacaagtta gacgtggtgg
    57301 cggaagccgc gttgggggag cggaaaaagg agctgtcgta taaagaaata ccaacgcact
    57361 ttgcggcagg tcccagccaa cgtggaatta taggagaata ctgttttcag gattcgttgt
    57421 tggtagggaa attatttttc aaatacgttc ctcatttgga actgtcagcg atagcaaaat
    57481 tagccgggat attgctatcg cgagcggtat tcgatggcca gcaaatacgc gtgtacacgt
    57541 gcttactacg gttggcgggc tcgcgaaatt tcattctgcc gaataagccg caggtgcgtg
    57601 cgggaaccga gttcgaaaac agcatcgcca gtacggatga atttgaaggc gaaccttccc
    57661 cttcgaatcc aaaggcatcc tcatcatttc atggaaatgg cggcagagtc gtcggttacc
    57721 aaggagcgaa agtgttagat cccatttcgg gattccacgt cgaccccgtg gtagtctttg
    57781 attttgccag cttgtatcct agcataattc aggcacataa cctgtgtttc accaccctaa
    57841 taaacgacga cagaaaactc gccgatctac gtccacgcga tgattatatg gaaatcgacg
    57901 tacaaggaaa atcgctgcat tttgccaaac cccatattcg agaaagttta ctgggtatcc
    57961 tattaaagga ctggttggcc atgagaaaag cgatccgagc taaaatcccc gctagctctg
    58021 atgatacagc tgttcttttg gataagcagc aggcagccat caaagtggtc tgcaattccg
    58081 tgtacgggtt ttgcggtgtg gcaaacgggc tattaccttg cattgatgtg gccgcgaccg
    58141 tgaccacaat tggtcgtgac atgttgctta cagtacgtga ctacgttaag gttaagtggg
    58201 gaaccagaga tgccctcctc cgcgaatttc ccgcgctgac gaattatatg ttgggcgacg
    58261 attactccgt gagcgtgatt tacggtgata ccgattcggt gttcattaag ttcaaagggg
    58321 tagcgataca gggcctcgtc gcaaatggag acgatatggc aaaacgcata tcgtccgatt
    58381 tatttcccaa acctatcaag ttggagtgtg aaaagacatt cgacaagctg ttgcttataa
    58441 cgaaaaagaa atacatgggg acgattcacg gtgggaggat gttaatgaag ggagtggaca
    58501 ttgttcgaaa gaataattgc cgcttcatta acacatacgc aaaaaagtta agtgatttgc
    58561 tatttcagga cgatgcggtg gcaaaagcag ccgccctcgt cgcggaaagg ccttcgtcat
    58621 tttgggcaac ggctccccta ccagaaggct tgaagccctt cggggacata ttggctgagg
    58681 catacggtca aatgacggca agcacgttgt ccgacgtggg agatttcgtc atgtcggccg
    58741 aactaagtcg gccaccgcag gcctacgcta acaaaagaat agctcatctc accgtgtatc
    58801 acaaattggc catgcggtcc gaacagttgc ccatggtaaa agaccggatt tcctatgtca
    58861 tagctgccgc aacgccggag gtactgcgcg atgccgagcg ggtagcagaa gccagagggg
    58921 aaaggaaatt ccgctttagc gaggtctctg tcccggaggt tccagggacg tttagcaaca
    58981 gcgccaagac gcgggccgtc caaaaaccca aggtattgat ctctgacatg gcggaagacc
    59041 cgacatatct aatcgaaaac aatattcccc tcaacacaga ttattatcta tcacatctat
    59101 taggaactct atgtgtaatt ttcaaggctt tattcggcaa tgacaccaaa acaacggata
    59161 ctgtattaaa gcgatttatt cccgaaactt atacagagga tcgcgcctac gcgacgcgag
    59221 ttgcgcgcgc cgtctttgcg gagatacgca gcggggccgg tctaagttct agcgaggagg
    59281 aagaaactct tcaaagactg aatagagctt tccgtattct aacagaagtt cgccgtcgat
    59341 attaatgtcg catagcttac agtacacgtc gtcggcgttg acggctggga catcactcga
    59401 atctgtttga cgatcgtatt cttttctaat gactaataaa aagttaccgc gccacacgtg
    59461 agcgattatg ctgtaattct tacaggccgt ttttaaacaa tcaatcaatt tgtagtggag
    59521 gtggagagct ttcccgggga acacgacata catcatgtat tcaagggagc ctgcttcctg
    59581 atccaagtaa aacaacacct tcacattttt cattccagaa tcgagtagca catagtatgc
    59641 gaaaaaaagt tccgggattg ccaaaatacg agaaagggca atttcgctat ctttcccccg
    59701 ctcctctccg caccccattc tgccgcccaa ggccacgata gaagccatga aattcctata
    59761 atgataaatg ttgtttatct gttggacata tgccaatatc aaagaggcac gatcgtttcg
    59821 ccccaatcgc gggtctccgc tagccgtgca cgtagggcaa cagccaccaa ctccgagata
    59881 ataccccatt cccgacaaag acaaacagtt atctgcgaca gcttccgaca tattgaacgg
    59941 caacgagact ggcgttgtct tgatgatcgg cacagccaaa tccttgacta ccattagttc
    60001 ctccgatggg gactcttcaa cgaaatcgaa gtaagcgcga tacaaatcga catctggttt
    60061 tcgagacccg cgtttcgtac cgcatgccgg cgcttgtaga tctcgccatt gccgccgcga
    60121 ccgtcttgct atccctccgc tacgccctac agatctgcgt cgtatgaaaa tgcaaccggt
    60181 catgccggga attacgatgt cacacgtagg tttgtagcgt gtgctcgaga gatatcaggg
    60241 atatagagtg tctttgaaga aatgcgccag cgtctttgac gaacgcggat aaagtagtcg
    60301 gccggggagg gaaaacctga tatgtcttga acgtgtacgc caaggcccaa aacccggcgc
    60361 atacgcgacc ttcgaaacgg ttatggcttg cgagccgagc tttatggagt gccaattctt
    60421 cccggctcgc taggtccggg tggtcgaaca atgaccgtgg attggtctgc gctatccgcg
    60481 cacagcacat cgggtcgcaa aagaagtgtt tgtagattgc ttccgttccc gtgcctttga
    60541 gcagcgccac gaagtatccg tcatcttcaa aatcggcatt tctctcctgc gtcccccacg
    60601 cctccaacac cggttctatg ctatggaaaa tgccgatgtt gttagctgaa taggcaatga
    60661 tatcgcgctt aaattgccgc attgcaagcc agtacgtgcg gattagtagg aagttgcaca
    60721 ataagcattc cgcggacgtt ccccctttgg ttatcgcgtg ctttaattgt gttaccatta
    60781 agggtcctaa ctccaaatca ggttctgagt catcttcgta acagtgacta tatgcccgag
    60841 tcgcccctct agcaagatct attctgttgt ctttccaaaa cttgctgacc gtctccttcc
    60901 taaatttcgc tgccataaga gcgagttcgc tcgccccatc tggtgcagat cccgtgcccg
    60961 aaagcaataa taggacgaga ttcgtataac ccatagtaga gtcctcgccg ctcgaccgtt
    61021 ccgtatactg agaccgatta gtgcacggtg ctagtgcacc aagatcgttc tccccgtcag
    61081 gcagtgcttt gctcaaacga agctgcaatt cgcgctcgta aatatcgtcg tccgacaatg
    61141 cgcgtataat gcaactttcc gtttgagaaa aattacattc tacgcttctc gcgcagtcct
    61201 tccagcctgc caaagcgacg gaaagcgagg tgggaattga gccgaccgtt tgacccgttt
    61261 gtgggacttt ccttttactt tcgtgtccag ctgccgtgtc gcattggccc tcgtacgacg
    61321 agtgacccat gtcggacacc gtcgtcaaca tggcccgcgt agcgctttgg gccaaatacg
    61381 aatagttact gtacaacact ttagcgtcac ccgcgcacag cgaccgtcct cttttccccg
    61441 ccgaacggcc ttgatttgca cggggcacga taacctcgtt atgccgtctt cccggtaccc
    61501 ccccgtcagt tcgaaaacaa ccatgcagaa agaagtgtct ctggatatcc tcaaaagtta
    61561 aatgctttct cccaaacgag cctaccaacg tgcaaccgtg atcgaccaga aaatgcttat
    61621 ccattatata cacgaattcg aacgctgcta taaacattgt tgtagcgcat ggtggagaac
    61681 caagacattt ggaacacaaa aatgcgtaat cggccatcca tatagccgat aatccgaatt
    61741 tgtgcttata tatatctaaa acacggcaaa cgagacattg tctatctaga gcaaaaacct
    61801 cggctgccgt cccgataaac gtcgccagct cttgatgctc gattccgtct tcgcaatctt
    61861 ctgcgctttc gctaccactg caactctgac cagcctgaag actgttggtc ttaatagcgt
    61921 gggcggagag tagcaattcg ttaaagagcg tatcgttgta cgtcaatatt tcaggatcga
    61981 acgctatgta agggcatttt aaggactcct cgacccatcc ttccgacgcg gatgctcccg
    62041 gagatcgaat aaacggtagt tcgacagtac gatgggccat ggccgctgag acaaacactc
    62101 ggcaagtaga tacgcctcgg ttagccgacg cgatcccaga cgtagagttg ctgtcggacg
    62161 atgtcgataa attagctgaa cgctatattt gcgacgggat cgtatatcgc gtatggttcg
    62221 aatacctaat acccgatgaa ttagatttga ttttcccgac aaccgacggg aagtttaatt
    62281 atctatcatt cactagaaga cttgcttctg ccatccgaca tggtcgtgcc ggagctggca
    62341 gtgcgacccc tacgtcgttt atcagtgccg agcgtgtctg tgaccatggg gccgttttga
    62401 gagggcggag cgagagattt gcatccgtaa ttaataggtt ccttgacttg catcaaattc
    62461 tgaaggattg ttagaaacta gcaagccgaa cataattgct ccgccgtata tctttttttc
    62521 ttttacgaag gcatacagcg aatgatgagc gcgcctcaga gtaagccctg tcgtcgtgca
    62581 ggactaatag cacggatcag gctcatcgtc ggcggagatt taactatggg caattccgat
    62641 cccggactcg cggagtcttt ttccggtcgc gttccggcac gttgcgtatt tcaattcagt
    62701 ggggcagacg gcgtggagag cgcgtttccc gttgaatacg taatgagaat gatgaacgat
    62761 tgggcggggg gtgagtgcga tccctacatt aaaatacaga ataccggcgt ctccgttcta
    62821 atcgaagggt ttttcgctcc tccgacaaac gccgctagag cgccgctgtg cgccgacaaa
    62881 gtgaacgtcc tgttaaacac taccgattct acgggcgtcg ttttatctga tatcaaaagg
    62941 tttaaaaaat cagtgggtgt ggattgcagg cctttccagg cttgcctaaa cgttcattgc
    63001 tttgtaaggc taccaaatgt tcagctggcc ttcagattcg tcggcccgac cgatccggcc
    63061 agaacatcaa aactgctcga ctcggccgta gcgtcttaca attcgaaagc gaaacagcgg
    63121 ttcaaaaaca gttcgagggc tatcgataac gaatcgagac cctgcgcact tcatgagtgt
    63181 gttccgatcc cggtaagaga tgaaacgcag aaactgacta gccaatctga tataaggacc
    63241 cctaggcgcg tgctgaccat actcaagaaa atttcgagcg gtgagtacgt aacgaccgta
    63301 cgcgtctcga tccgcaaaat tatactgtgc ctggtcagtg tattcgtagt tataaccgcc
    63361 tggtggtgct acccgctcta aaacctcgcg acgcggcgtc acgtttccag tcggaacacc
    63421 gcaccacaga gtcatcatcg gcgccactac atcgcgcgag actgcaatgt ctcgcacgcc
    63481 ctctccccag ctttcgcctg tttcacaagc gttcgatccc tccgacttga gcacttacaa
    63541 gttggatgtg ctggttaact accccctctc ggatttggtg catcacctta atgccatacc
    63601 gcgaaacctg caagtttccg acaggcattc cgacctgaac gcagctaaaa tcaacgtttt
    63661 acgggctctt tgtgtgggat tttctgacgt gcggcgcaaa aatgatactc gcactttaca
    63721 acgcacgccc atgttcgcaa tcggcgacgc cgcatcgcgc ttgagaccgt ccattggatt
    63781 gaaacggaca ttccccacgg gcatattctc aacaactatc ataaactctc ccgcagacga
    63841 tgatgcatag cttttgtgag tcgacatgct ttaataaaaa attatccaaa tcgaacgagt
    63901 ctacttccct atgtcagtta tccggtcagg agcattttga ttttaaatat ctctatcgtt
    63961 aatgtatcga ttctggctct caattgttgt cgtgcgtgtg cgatttgcct ggccatcttt
    64021 tcgcatgccc tagtgagtgc gtaaagcgcg ctgcgtccca cctgcctaaa atcgcgcctt
    64081 gtcaataatc tatcggcaga gattactcgg gacgcgctcg attcgtccgt gctggagcga
    64141 tcgctatcag gaacactaga ttgcgactcg ccatccgtgt tagaatccac ggacgataga
    64201 gactccagcg caaacagata tcgctctggg tcgatattgg agtcctgttg cttattttgc
    64261 cctgcttctg cttccgtgac cacgaaccct ctgtacatgt tgtgatggtc gtgctttgcc
    64321 gttgtcgcct tgcatggcga acgtcggcac gtattaatgg gtttcgactg cgaactagac
    64381 gtgcgcgggt ctcgacagaa tgtttcccag aaccgcacta ctcggcgacg aaggtccgct
    64441 aatataacgt ccgggggcgc aaatgcgaag tggtcgtaca gtccgtcgtg cgccggactc
    64501 ccgaccgccg cctgcttttt gccaccaggt gccgtcgaga tatcgacgga gcggtcaacc
    64561 ggttccaggt taagatccgc ggtaataacg gctggcgacg ctcgttgtaa caagggagac
    64621 gagtcgcggc gcacggaagc gagtccccct aaagtatcgc atcttggcct tgacgcattg
    64681 ttaggacgaa ccacggcggc gcccttgtcc gagatccgtc cgattgaatc aatcctcgtt
    64741 ccggcacgcg acggcttcag cgctcttatc cctattcctc cgtcttcgtc gtcgggaatc
    64801 agggattttg tcgaagacgc gacaacaaat ggtgttgagg tcgaatcgga gtcagatcga
    64861 tgtggaatgt ttggagttcc atgctttttc ctatcatcgc gtaccgagtt atccgaaata
    64921 actacggcag gggacttttg gtcgagagcg cagccgggtg cgttacacgc ggctgccgta
    64981 tcggtaaatt ttagcctccc acgatagaca ggctttggca tatcgtgcga ccgttcgctg
    65041 acatcgatat gttttacggg gcgccccttc tgcctctcct cgatcccgac tgctgcgtag
    65101 gtagattgct cgttatgtgt ttttttagtt acgacgagtt tttgagtggc tggagataac
    65161 agggacgggc tcaatgtttc attatttggg ggggcgagct tatagtgaaa ggcgagtttg
    65221 gaagaggcgc catcggaagc atcggtgcta accgtagaag gacactcgac attctcggga
    65281 actacccggt cgctacgatc gttcaactct ttatgaaaca aaaaacccgt ttcagcattg
    65341 tcgtagacgt ccttctctgc agccatccca tcccacatgc tctctctatc ccgactaaag
    65401 tcattccctg gtaattcttc atcttccgac gccgttccaa tagatagtac atcctcgaca
    65461 tcgccgtctc ggctcttgtt gtacacgggg atcggatatt gtctagattc gtcggaaaaa
    65521 aaattagccg cgtcctgtcg gtcgagcacg gcgatgtcat catatgacgc gcccgtttcc
    65581 acgcgaatgc ccgcatctat gtatggcagt tccgagagaa cagcgtcatc gctggaagtt
    65641 agccgtatta cggggatagg gtcgaatacc gtcttaggcc atagaacttt cacgggaacc
    65701 attcccgtgt ccactatcac taaacacgga ggagcggaag aaaggggctt ggaggctatg
    65761 agatgggaca agtgttccag ctgttggccg aggcatgcat tttcgattgg attgctgtcg
    65821 tctgccaaca atttcccccc ccaggaagtc gtgtcggatg aaacggcggc aggttcgaga
    65881 aagcagccct cggagccgct tctcgagtcg aaaagacgga cacacagatt cagtccagag
    65941 ccggaggaat acgcttctgg acattctgcg gcgatcacga tccgtgcccc gaataatgta
    66001 gctgcggctg ccagatccat agcgtttact tttaagactc cgctaggggg tgtggacgtg
    66061 acggtaaatg tcatcgccac tcctgtgggt tcatataaat tgggaccgtc tgaacctttc
    66121 gggatagttt tgtcggcggg acgtaacacg gacgatgtgg tcacgtctaa agtcgaagca
    66181 gcgtccccgc gggctgtgac gacgtcatcg tagcttctac agctttgctc tatctccgcg
    66241 ggtagaagcg aggaccacat caccgccaat gcggttggcg gaatgcacat acgagccagc
    66301 actgttgtcg ttgtcaaaag attcgacggc acgaccgcac gaattttggc aaggcccgta
    66361 ctcgtagccc cacctacacc ttcccagggt ttaagggggt ctgtttcgga aaggctgcct
    66421 tgtttccaat cagaataccg caaagcaaaa agggatccgc ctgacgggtc ccacgctccg
    66481 cccgttaaac tcatcggtcg gcaattcgag tccgacgggg catctttgga tagctgcgta
    66541 gataaacagt tgataaacgc cgtagtggac agcgactcat tgatagcgcc atagagcgtc
    66601 ttatccataa aatcgtactg gctaataaga tcgagctggg aaaaggtcaa gacgtgcccc
    66661 ggcatgcacg tcataatagc aaccatcacg tcggccaact ccagccgaac gggtcgtcca
    66721 tttgcagcta tttttttaag cccctttttg tcggcggcag gggcgacttg ccccggaaga
    66781 aaaaaaatat cagacaagct agcacccgtt ttacgcgtga gcgtaatggc cattaatgcg
    66841 caataaatgg acccgatcgc ttttactgtg ccatccgcca gccaatcgta gttttgcgta
    66901 cgtacatact tggtgaaggc gcggaaatta tccgccgcgg cttgaacgaa acccagcctc
    66961 aaggccatga tgtcgcctag catgcccgcg gcaactacca tatctctagt tgacataact
    67021 tttgaaggga tcgcgggcct caggcttagg ccggagggct cgcacaaaca cgcggccatt
    67081 ttttcaccaa cagttcgata gcagacagaa tatctcaggg gcgcgtcgga ggcgtctaaa
    67141 tatgtatgga tgcctgggat atctatttca gaaaacgcct cctgcagcgt gacaacaact
    67201 gatggtctga tccaagcagc tactcggtgt ttaagatatc gatccacgaa ccccgcggcc
    67261 ggtctgttgt tcgcgtcagc attcaatcct gtatcagagg ggaggagcga tggacacccg
    67321 gcaactcccg gcaaaatggc ggaatatgca gcatacagcg ccaatctcag ctttacaagc
    67381 cgcgagtatc gagttacgtg ccgaacgtac cacttgggga gccgtttaga gagaatatcg
    67441 aattgcgagg ctattgtact gagatcgttt aagacaaagg ttggcgggat ctttgcacac
    67501 agagtgtcca tctgtttttg aatcgattcc gtttctttga gggccgccag aaaagcatcc
    67561 atgactccgg ctctgtctct gtatttcgca tcgataagtc cgatgatttt agccggcagc
    67621 ctagcatact ctgcgttatc gcgcaaagcg ttgatcgtat tggaagagac tttagcgcga
    67681 gcagcactat ctcgggcggc ggcaaacccc tctgagctct tgtccatcct gtccttatcg
    67741 tgcataaacg tggaccatgt gtcatcccaa gcgacttcgg caagcgctag ttcggatttt
    67801 aactcgtcca atcggctcgc taagtccgcg agagcatcga tccgctccgc gtatatagtc
    67861 atcggaccgc tttcgtcgat ccgggaagtt agctcgtgcg aatctatgac agatcgggcg
    67921 tgttttagcc actctaccgt ttgggtatcc aattctttag tttcttcgac tttactcaaa
    67981 agtattgccg cttgagtgac tatgtcgttc gcagtttcag ccttttcaat agctttcgct
    68041 atatgcggag gcatcgcgac cagccgcagc aggtttttta aattggccaa ttgctccgcc
    68101 gtctctctgt ctgcggcata agaaacttcg gccaaactct tcagaataac ttcagctctc
    68161 gatttcgcgc cctcaatagc tgtcgttacc cgcagcttta ttgaggagac ggcttctata
    68221 tcgcgttgga gagtatgagc gctatactct gcataggctg tcccgttgaa cgccgtaatg
    68281 tcttcctttt ccaaatcgtt ggttattgtc agtatggcgt tcgccgaagg aatcacgata
    68341 gagaccccat attcaagagc gcgacgcgcc ccctcagggc tatacattct agccagattc
    68401 tccaatgcct ctctaatttc tatatctacc ctccccgctg cgtgaagagc ctctaccctc
    68461 atttgttcat gccgagctaa aaagcccgta aattcctcat gcccgttacg ataaaaatcc
    68521 acgtatttgg ccaacgttgg gaccgctctt acgtctggtt caatttcgcc caataacgtg
    68581 taatagtcca agttcccgcc gcgggcatcc gcgtgcctta atatagcgag tactatcttg
    68641 attaactgta gcaaggcgtc gcagctaact ccgaaaagtt ttgtgtaata aggagccgcc
    68701 gctataaacg cgtctagcca ggtcatattt ttcaaaaatg ctataggagg cagaattcta
    68761 ttcggggtgg aaaacgggtt gaacttcaat acagtttcta tcgcatcgtg aatcgcacga
    68821 ccatgcgaca taacaatttt ctcggctctg gctctgaaac ggatagtgtc gtagccggcc
    68881 accacggccc ttttctccaa atcactcatc tccatagcat caaattcgga tttcagctcg
    68941 gcattggata gtagggaatg aatcgaggaa acccaaacgt cttcgctatg cgatctctgg
    69001 gcacttatca gatttctctc gtaggttgta acggccgcct ccaattctac ggtccgctga
    69061 tttacaagcc ctaccgattt tgccaggtcg gcaattttac gttggatgtg ggggtccgta
    69121 acatgcgcgt gactctcgag agctgcgatg gctgtattgg cgtctctcgc gctctgcagc
    69181 gcgtgagcta tttcagttct ggcgctcatt ataacactgg cgtcgctatc agcggctgct
    69241 gttttgggat ctgaagtttt gaccttggtt attgacgcga tcacgctatt gagtgccgcg
    69301 cgcactgccc gatgtagacc atctaaacgg tccccgtgct gcgccacgcc cgcggccacc
    69361 tcagcgtcgg ataacagcac cgttaagaac gaaaacgcgt catcctggcc tgcgggtaga
    69421 tcggccatta ttcccgtaga gggagtgtct gcagtcgccc tgtttacatc ggatacggcg
    69481 ttctgcagcg ccgtaacagc cgccgtagtt ttttcgaccg acatcggttc gaggcgcgca
    69541 gcggcgactg ctgcagaaag cgtatcggca tgtttcccga aaaaaaccga cgcggccgga
    69601 taacccccaa ttggacccaa tattacgcgt atggccagag agaaaggaat gccgaggcca
    69661 gataactctg cggcagtgct cgtactgggg tgtgacaaaa ttgtcctata ctgagagaac
    69721 aacagccaca aatccgttcg caaagtccca ataacatcgg gtggtgcgag agctagaaag
    69781 gtctctagcg gccccgtatc tccagggatg gattgcgtta tggttttgac tgtcgagtcc
    69841 aatgcgcgca acccagcaaa cctttgtaga ggacgcagca tcagcttaat cgaagaatat
    69901 aaagttctga tctcctcgta acgatattga agtgccgcaa ttaaggtttc ggcatccagc
    69961 cgcctacggg cgatagccgc gcggtcatcc gaacttagca aatttgcaaa tttgtcgccc
    70021 cctaaagcat ttgacaattt tactaactca accacatcct tcataacttc ctccagtttt
    70081 tgaagatcgg ccgttgtctc caaatcagtg tatgacgcaa ctctagcttc caactcatgt
    70141 aagcggtcca aatccgccag ggctgtttca cggcgggcgg cgttgttgtt aacggcatcg
    70201 acttctttga tcagtgtttc aaactcttgt cgactaatcc acccgcccgc ttgaacggct
    70261 gccattgccg ttttccatac cgccagattt tctggatttt ctaaattaga gtcattttcc
    70321 agcagatccc cgagcaattt agattccggt gcagttgtta cgggcggcgg ggcctgcgcg
    70381 ccactacgcg ccgctactag ggcaataaca tcatcgagca cagataatga tgcgaacagc
    70441 ctggccattt tttcatgttg ctcgacaacg accattttaa atctagatgt gctagccacg
    70501 ttggctcgaa gcgcattcgc gctatagaga gcccccttca agtaatattc gtgtagtgcg
    70561 ttgccgactg catcaacggc tgccctctca atagcagtca agcgctgtgt aacgacagat
    70621 ggggagactt tagctatgct ctcgtcgtcg cgcgatccag aagtaccccc agatcctccc
    70681 attataaatg catcaaatga ggcgtgcatc aatcgaacgc cggcgtcgag ggcctccaat
    70741 tcagctagta tgagttccgc cttcctcctg gcaacagttt ccctatcacg tatgaacctg
    70801 cacagcgatg cgactctgtc ggtcaagctc tgttcggcat gcaaagacgt attctctgag
    70861 tatatctttc ctggattact attaaacgcg cttactaacg atgtcgccat cctttcgtag
    70921 attctatctg catccgcagt gctcgcctct ctctctatag agtccaaagt tttgtgaagg
    70981 gcatctgtga gctcctccac ttccagagcc actaatacca gcttgcttag ggccaatttg
    71041 cctatcttgg aattttcaga aagtacagat tctatgaggt ctgcagattc tccggctcgc
    71101 gaaaccgcca ttcccgtaga atcaatgaac gcgctaaagt gggcgggcct cgtaaatgct
    71161 ttaaataatg atgccatctc ggcttctacg acagatccta tttccgttgt ggttcgagcg
    71221 ccgttttcga taacgtagtt gaacaatctg gtaaaagtat ccagcccaca tatatccaga
    71281 agtccgtcat agtcacccga ccgtgacaag tggatggtca ttcccatact taaagctata
    71341 gattgctcta aatcatcgat gttagcattg atgtcgctca gaatagagct agggacgtgt
    71401 tcgcttgtcc atagcccgtc tcgtagcgac tcgtcccctt cccccgctac cgtgtgagga
    71461 ttaaaaggtg gccggtctcg caacgattgg ccgtgcacga agtgctcagc acgcgcctga
    71521 gaacttataa actcattgaa ggagacattg tccggccggg tagcttcttc ttgaccaggt
    71581 atattatgtg tcgtgctcga tccactatct gcttgttcag acaaacttat cgatggagcc
    71641 accggattgt ccgtataggt caaacatcgt ttagttttcc gggacggttt tctgctcgaa
    71701 gattgacctt ggccatcgac ggataagttc tctgaacttg acggaggagt ccatacaggg
    71761 cgcctcctct tatgtctctc aaaagactgt ttgggcgggg agctagattt cgtgtcagtt
    71821 tcaagccgaa ctacattttc ccgcgttttg ggcaaatcag gccttgttag caccgacaga
    71881 tcatcgccga tgtccgggaa tgcagtggtc cacgcattta cgatggactc atgattggtt
    71941 atatcacata tggcatcaac tggagcctcc tcgggaggca ggacgtatgc gtcctcctcc
    72001 gcatagccca tttcccgcct aacatccaca tcccctgcag cgacgggaga acgatcactt
    72061 ctggaatcga cagcgacttt gatgtcctcg ctacgtgacg tggaggttcc aatgatgatc
    72121 ctagttgttg taggctgtgg cctgtaaggg ggatcgagat tggccagcac tactttaatg
    72181 ttctcttcct cgttaaccct gcctagatcc aaaacgatgt ccgctgtacc gtacagccgt
    72241 gatacggctg atattatttc ttcctttggc ggtgtactgg agatcataga tacaaagtaa
    72301 acaaaggtcg cggaccactc tggcgccgtc gagggatccg cataggacgt gagatattga
    72361 taaaaataac cctcgcttac tcgaacgata cacgcttggc ctatgtggcc atgaccgtgt
    72421 ggatcgaaaa tgtagattcc gttatcggat ctgtacaccc ctattcctat gacgccgatg
    72481 acgatcaggc aataaatatc acctcgtttc tgcttccata ctttttctat gaatgtccgc
    72541 gcagatattt gggtttctaa gatagtggag gtgttttcat ctacgtagaa gtccaattct
    72601 ccataggagc tcgaaaacgc aacacacaag ttgccgtcgg gctcatttga taagatcctg
    72661 tttggtaaat cgtgagggac gcaagtcgta taccttccat cgcgagaggt ttctattgtc
    72721 cattcctttc cctgcaataa cagtctatct atggcctcgg tcgacaatac cgcatccaac
    72781 ccatacgcaa aaactacgcg cagaaacgcc aatgacgacc gcaagcatga aaccgatgac
    72841 cccggactca agtccggggc aaattgattc ctgttgccaa cggcaactag tgtaaagtcg
    72901 gtggcatcaa ccaccattct tgcccattca tctaggatta cctccgaatc catgtttgtt
    72961 cccgaacgca tggcgcggtt ttgcatgttc gagacggagc tgtccctcga attatccgat
    73021 gtttccaagc gccgcgtcga gggactcggt tgtaaccgcg tagatttctt ggatgggcgt
    73081 gtagtgctcc ctctactctc actagcagcc atatagacga tggggcggaa tggcgcgtct
    73141 tttcagattg cgctttgtca ttgagcgagt tagacattaa aagttgatta actccaaaat
    73201 tgtgatcaat cagttgcggc cgcgtaagtg gcgtggctgc aacatccaag tcggcacgaa
    73261 cgaacgatac gccaggccgt aaaacgatag acgtgtgcgt cacgcattgc gatctctcgc
    73321 ctgcctttcg ttattaaaca ccgtatcgac aatgtcgacc aaaccgtcta cagttactct
    73381 cggttttatg aggaagtcct tcgcaaaatt ggcaaggtcc acatcatcgt gtgccaccgt
    73441 atccaaatcc aatgtatcaa aattgagttc gtcacgatga gttaaattgt gcctcgatgt
    73501 cagttcgact actagggcgg ggctatcgtc ggttactacg ggcagacggc ccagcagggt
    73561 cgctacagct gcgtcgattt cgtcgttcgt gacacggtct tccatatcac gcggaacctc
    73621 gatccgatca gctatttttt gccatactac tcccacattc tctatagcac tggccaagtc
    73681 ctgcgaactt ctgtcacgaa acgtagaatt tatttccgac aacgtttgcc atttgtccag
    73741 cagccacacg atatcgccgg tcccgggcgg cgtggaacac gatgtcaagg ctctgacgtg
    73801 caggtccagc gaattctgca ggcgagccaa tctggcatag tcggttccga gggtagaaaa
    73861 atagcttgct gcctttacgc taaataaaat tgcgcgctcc attaaattat cgcatgtatg
    73921 aacttgtttc ccagtttctt ctattaaagt ccgcaacacc attgatttga gtcttacatt
    73981 cgccattaca tcacccgagg agtcgtagaa ttccctgaga gccgacagca catcaacgat
    74041 tttccatgtg ccaaaattgg cacgcggctc gccacggcgg taaaccgtta cagtacctcc
    74101 tgctgtacca gctgcgaatt tacacgcaaa gaaatgctta aatatgtacg caaatttaac
    74161 caactgcctg gaatcgtccg ctaaatatgc cgcacacttc aacgttctat ccgctaagta
    74221 attgaattga agtcctaggg ccgttccatg catactaatc aaaagcaaac tattcgatat
    74281 ctctggacgg gggggcataa tcggtctggt ctctggcggt accatctgca cggccgcata
    74341 gaccacgtcg tacaattcgc ccatcagcat ttccagatta tacgcatcgt ccgtggtagg
    74401 cttggccgtc agatctctag caaacggagc gagtgaggaa attagagcat tgagcttgtt
    74461 tctatgattc acgaaactgc caatgtacgg cgcgccgtaa tccctggccc aagtcaaaat
    74521 ttcgataaca gtgtttatcg ggcgttcaga aaagacagat gtcgtgatag ccgacaatgc
    74581 gtccacgcaa acggtagcta gaatatatct tagaaaatgg ggagttgtgc tttcaggtgt
    74641 gatgggcatg gattcaggat agcgaattgt catggccaga cgaatcatac ggctctccag
    74701 gtctgggtcc actgcatttg gtccagagat actctctaaa tccgaatggt ccacactagc
    74761 tagatgttcc gacggttcac ctccaattaa ctcttccggt ggcacgattc cccatatatg
    74821 ctcggctctg gagtcgaacc atagcatgag tgactccttt gcaaattgta ttgctcgatt
    74881 ggcagtcccg gccccgctct ggcggattgc gctatccatt tccgcggcga ggatcgctcg
    74941 tgcagacttt acatagtcct cgtggggatt tggcggtata catcgcccta atatctgagc
    75001 tatgattgcg ctatctaacc caagtacttt tatgaaatct gaatcggcgt ccggaggaag
    75061 gccattgtcc atataattgg ttaagtaagt catgccggga ccataacttt ccatgagtcc
    75121 gaaaacgatg tttccgataa cctgttgtac gtcgtcaaat gtgtcgagtt cattaacagt
    75181 accacgagtt tttcccaaat ttgcctttag cgccgattca taaacccggc atgcctgtct
    75241 cacaaaacct ctttctataa gcgcttccaa taactgtctc ggcgacgaac tgtgttgtac
    75301 agccccccat gcccgcctag ccgattcgga gagtttcgct ttagcagcat cgagagcgcc
    75361 cccgccgtca tttaagtcgc catcggtaat aagccggacc acggcagaca tatggatcgc
    75421 taaggcatct tctgttaatg cgtgatcagc taatataatg tctggtccgt tccgcaactt
    75481 ttccgctacc atacccggct gaactgcata tacatacggg tctccgtatg ctatggcggc
    75541 agatgctcta acatcatatg ctgttctttt catattgttt gcctctacgg ccgagataag
    75601 ttcgcgcgag cccaatgcgc tggcatcttc tgcgaataga tcctttaact gagaaggatg
    75661 gggcgatcgc ggacttttaa aatattgatc gacaagggcc agcgtaaata gtattcgagt
    75721 gagtggcgta aaggccctat ttgttgtaca tcgagacata ataacaaacg gggtgatcca
    75781 cccgacggct atagaaatta atcgaattcc ttcctgaaca aacgggaaat cgtaaataag
    75841 tttaaagcgc gtctgcgtca aggaagctgg tagttccaaa gcattaggag caggttgacg
    75901 tccggataac aacccttcgg aagtataatc aaacgcgtcc gtggcgatct cttcaaaaat
    75961 tgtcagccac tcacttatta ggggccacaa aacactcggt ccaaaaggac atgatctgcg
    76021 cagaccgttt cgggtaagcc acgcaatggc ttcttctccc gtcatttcgg ccgccaatct
    76081 acgcaaccta cgagaatcgt ctttccagga cattttatcc caccttacgg aggtacgcca
    76141 caagatgaat ccgacaaaat tttgggccag cattgccgct tctgggcttc ctgtttgttt
    76201 gtagacctcg agcacagccg cgaatgcatc gcgccacgtc gattccactt gctgaatact
    76261 cattgtttct agagcctgga aaaatgatcc gatagcagtt cttgcttccg cagctgtagc
    76321 atttccccac ggttccagtg gcgccgttcc agccgataaa gaccttagtg tatccagtaa
    76381 agttttcaac gggaatctcg cttcgccctg ggtttcagac atggcgcgcc aataggtagg
    76441 gatggatcta cgtatgtcaa tggaggccgt ataaagcttc aataatacgt tccctaaaat
    76501 gctgtgctcc gcccgcagaa aaatatcgtg tgatccgcag ttacaccata ccgtacttta
    76561 tcatctccat gacgcatcga gatcccgtat aggccggccc acgtaagagg cacacgcgct
    76621 acataacttt gttgcgttta actacaccgc cagtcctgta ttgcagtata ctaggtgaca
    76681 tacagcgatt tttatgtgca gtagtgcaca cgcagttgtc gcaaaacggg cttgcaaacg
    76741 atcatcgcca atacaggatc tctttataac tggttgttga tagtggacgt catgaaaacc
    76801 acttttcgaa caagcgacgt gcaggcatcc aacacgcagt caaatgcctc ggacaggctg
    76861 catgacatct tacggagcat caataactca atgcactccg gcattgttcg gcgcatcaac
    76921 ataggctatc cgcatgcggg caacaggcgc gggacgttga ccgccggatt ggaactgttg
    76981 agcaatacga tcacaacgac ccctcccggg gcaaacatac accgctccat tgcaaattcg
    77041 gcaggcgaac gtacggcaac gatcatacaa tctttacgaa catattccgg aagtggagat
    77101 ctgaacacga atggtgataa taacgtcctt tcccgacaga tcagcctgac agatttctgt
    77161 ttccccgatg cggagatgcc aggactaatt gtcttatcta tgcgacatcc actggatata
    77221 aacagcgaac atttatacag cacacctgcc ggacgggacc cacgggcatt ggagtcagcg
    77281 tggtatgaat tatctgaact ggccgcggta tcggtaaaca gattagacgg aagtggtgtc
    77341 cggccgtccc tattatcgct ctcatttctt attgcttccc gcgcgggaga ctatgcggat
    77401 aaatgtggtg ctgaggctgt aagagctcac gtgattagca attacggccg ccggcggata
    77461 gaggacaggc tcgacaggtt cggaagctgc caagcagcaa tgttgagatg tcacgtgttc
    77521 ccacaccgac atatgcaagt attaggggga atggtgtcgt ggatcgcaca gcgcgaaatc
    77581 gccagtataa ccgccgtggt caagggctct caagagagcg ccaggacaga acagaccaac
    77641 aatccaagat cgtcggtata cgttcccgca tgcgcctatc tcgatttaga taaagagatt
    77701 cacatgctcc atgatgacag agcttcttcg ctactatacc tcgttttcgt ttatgcacaa
    77761 cacctcggac gcgagagcat ccgtgtatat ctcatgcgga gtcgtttagg ggaatcggtg
    77821 ttcagagaag gcctcggtta cctgtactcc gggctaagag ccggtaacgc tattaacggt
    77881 ctggccggta taatagcgcc acatggagta gacgcgaata cggaatttcc attatcaaaa
    77941 gctttcgagg tacacaaaca cgcctgtcga aacaccggaa tcggacctcg agactccgag
    78001 aaagtggact ggcgtttaga tctccgaggc cgccctacaa agaattcctg catgtacgca
    78061 gcatactgtc gcgtagggca cttgaacgag tattcgatgc cggcgaagaa gtctgaacgt
    78121 tgtggcgggt ctgtggaggt ccctgttgta tgggtgccgg gagtagtgtg ggatatcgga
    78181 gaatggaccg agtgttatca gtagagagtt ggctacaccg agatccggca tcatacctta
    78241 cgtgaactgc ttacgtttgg ggatgttttt gcgtcggtgt ttggggagga gtcaatctta
    78301 taaaaagcct atttgtggta cgcttcggtc tcgcgctcac tgagcaaccc gtattttatc
    78361 cagtctgaaa tcagaatcta aaatgcagcg atccgatgaa aacgaatccc tcgaagcgaa
    78421 tagaaatttg gacaccgcct cgcgtaactg tactgatgtg caggtagcct tgataatggc
    78481 aacgaaattg catcgcatcc agcagcaact tgcgagcatg ggatatttat ctggctacga
    78541 ttccgtgccc gatattacta cacccgtgaa agttctgcgc gagcgcatta cccatctagt
    78601 aaatacattg aaacccgttt gccgtttcga tgagcgcgtg tactacgcct gcggggagct
    78661 ggtgcattta cggatcaaat cacaggaagc tacttttgat gcgtggttga tgtcgaaaaa
    78721 attaagcctg aaaggcgaga tcgtagataa catacagcgc cacagaggtc acgtagagac
    78781 ggatatgctg cgcttttacg gagtaaccta tccctggctg aaacgactgg gtttacagtc
    78841 ggcgttgaaa tacgaagaat atctgactga gttggaagac ggcaaaaaag aatctctttg
    78901 ccagtttttt gttcggctgg ccgcggcggc agcaaccgaa gcgtcaaaca aaaaagcttt
    78961 catgtcggct ttgggtaccg aagtgtcgac ctgggaaacg gctttcacgg cttttttttt
    79021 cgctctcgct cgtcagatat ttgtcccatc gactccctgt atgctttttt tggggcgcga
    79081 aggaacctca accgcgagct gttatctcat ggaccccaga actataaata cacacgatac
    79141 ccttaaagcg atcgccgacg atatagttcc ccatctccta gcgagaggag ggatagggat
    79201 atcgttgcag catttaaacc aaaaaacagg ccttatgcct gtgatgaaag tattggattc
    79261 cttagtgatg gccgcgaatg cgggggagcg tcgacccacg ggggtatgcg tttatctcga
    79321 accgtggcac gcggacatca tgtctgcatt aaatatgcgc ggcatgatgg cgacggaaga
    79381 gtcccgtagg tgcgataacg tatttatcgc cctttggact tgcgatttac tgtttaagcg
    79441 ctacgagaga cacgcaaacg gggagaaaaa tgtgacgtgg accttattcg attcccgcgc
    79501 gtcgatattg gccacgcttc acggatcgga attcgaaaag gagtataacc gtttagaagc
    79561 ggaaggttta ggcgtagcta gcctccctgt aagggatttg atgttcgcaa taatcaaaag
    79621 tgcggcgtcc accggtagcc cctttattct ctttaaagac gcgtgcaaca agcactacat
    79681 tacagatact caaggagacg ccattgcagg ctctaatctg tgtaccgaaa tcattcaaaa
    79741 aaccgacgga aatacaaacg gggtgtgcag cttagtaagc gtcaacctcg cccgatgtgt
    79801 tttcgacgag aacggagaga aaaaatttga tttttccgcc cttagacgcg ccgtgcggct
    79861 ggctacggtg ttcgttaact cgataatgtc tagcagcgat gttccgactg cgaaatctcg
    79921 ttccggtaaa gatcgacaca gatccatggg cataggcgtt caggggcttc atacagctct
    79981 gttgtcaatg ggtctcgatt tgagcgatga acgcgtcaag cccctcaaca agcagatttt
    80041 tgaattgatg ttgttagagg ccatgacggt cagttgtgaa ttttgcgaag gcgggttgcc
    80101 cgccttcgcc gacttctcca acagctatta ctcacggggg cgcctgcatt ttgatggctg
    80161 ggcaaacgta ggcttaagta tgcccgaaga gtggaatgcg ctgcgggaga gaatacaggc
    80221 gtccgggtta tacaatgccc agttcgtagc gttgatgccg acagccgcat ccgcacaagt
    80281 aaccgaagtg agtgagagtt ttttgcccgt gttcagcaac atgtttaaca aagtgacgac
    80341 ggcgggggaa ctactgcggc ccaataatca attaatggga gagttgaggg agatctatgc
    80401 ggataatgag gatcggcgat tgaaagccat agcagcgttg gagtgcgcga actggtgcgt
    80461 ggagaccgct ctgggaaata agcccgaatg ctctcaatta cttaaataca aaacggcgtt
    80521 cgagtacgac caatccctcc taatagattt gtgtgccgat agggcgcctt ttgtggatca
    80581 aagccagtcg atgactctgt ttgtgacgga agcggctgac ggaacgctgc tggcgtctca
    80641 cgtcatgaac ctactcttac gcgcctataa agccggcctg aaaacaggaa tgtattactg
    80701 caagatacgc aaggcgacta atgccggagt attcagcggt aacggcgaat tgacctgctc
    80761 gtcctgcata ctataatctc caagcatccc ggcattttga ccatggccac gcaagcacgc
    80821 gggaacgaat ttgtcagcgg ccaaaccgca cctctgcaca aaaacccgtg tcccgaaaac
    80881 gcggcggccg tcctaaagat ggaaggtatc gagatcgaac cttcgactag ttccgctaga
    80941 gataattaca aagtgtcacg gtacttctac gtccccgaat gcccagatat agggcacctc
    81001 cgagctttga gtattatgaa ccgatggacg gagaccgaat ttgtcgtcgc cgaggatctc
    81061 ggggacgtcg ccaagcttag cgaagaagaa aaaaatttct accgattcct ctttacgttt
    81121 ctctctgctg cagacgattt ggttaacctt aatatagaca atctgttagg tttattcgaa
    81181 caaaaggata ttcaccacta ttacttcgag caggaatgta tagaagctgt ccactctcgg
    81241 gcctatagca ttattcagct gatgttattc gacaacgact cctcggcgcg cgcaaaatat
    81301 gttcagtctg cgttagagtc ccccgtcatc caatctaaat tggaatggtt agaccgacgt
    81361 atactagagt gcacgtctat accagaaaaa tatatcctta tgattttaac agaaggcatt
    81421 ttcttttcag catccttcgc gcgtatcgct tatttgcgca cgaataacct ctttgtcgtt
    81481 acatgccaga ttaacaacct gatcagcaga gacgaagcga tacacgtaga ggcgtcgtgc
    81541 tgcattttca agaattatat cgctggcaac aagccatcca ccgctcgcat ccaagcctta
    81601 tttagcgaag ccgtcgactt ggaatgtgca tttctccgcg cagccgcacc acgcgactct
    81661 cgcttattgg atattggctc aatctgtagc tatgttcgtt acagcgccga cagattattg
    81721 agaatgttgg acgtgccacc gatttacggc gaacccagcc ccgctgccga ctttccgcta
    81781 tctctaatgt ccgcttcaaa taatacaaat ttcttcgaaa gaagaagcac cgcgtactcc
    81841 gggagtgtat cgaacgatct ttaattagcc tgtgtgcaac tgtactttct acccctaccc
    81901 acaagaatta ataaatgaat tcaaattatc gcttttcgca ccgtgtagtt tgtgatgcat
    81961 cccttcccca gtaccttatc agcacggagt cgaaaggccg tacctccggg atacacctta
    82021 gaaatgcggt tgaaataact gaagcttcgg cctcattggg tatactgcga aacaccaatt
    82081 cttcaaccgc tacatcgtca cgtatatcct gcattatggg gaatcgtttt aaaatactaa
    82141 ttctgggcgt tctgcgctcg ggcattatag tcgcaatgac gtgctttatg aacttgtatt
    82201 cgagaacttc gcatctcgtt tttggggggt gcaaagatct taacaagctg taattggacg
    82261 cgagatccct gttcgcatcg ggcatatcag ccggtctctc gtaatgatgg ccgcccgtga
    82321 tctcaggatt gcaacaattc atcaacgacg accggccacg ctcgttatcg ctcgctttac
    82381 cgcagatagt gcccgaaccc tgcttcaatg tccctagatc tattatctct tgcatggatt
    82441 tcagtgtgtg ttcgcaatgg aggtctgttt gacaccgaac gaagttagac aaaaacgtga
    82501 aatagtccat ttttaacgcc gccaaaacat ctctgcagta gatagtcggc ggaaatattc
    82561 tagtaaggtc gatgattata tcacatccca tcaatagcat gtctgtatct gaagataaca
    82621 catacgcaac cgttttggtg tgaaagaggt tagcacagat atcgtccgct tccatcatgg
    82681 ccacatcgac ataagggtat cccatatagc gaatggtatc catgcagagc ctatgtagaa
    82741 ttttgggcgt atcagactta tcgctccatc tgcgtggtct tttgggcttc cgcgttcttt
    82801 tgttccgcgc ttctccggta tccgcattct cgcattcgtc gcgcgaacgt acttgcagcc
    82861 tcccagaacc tcctcccctc gcgatgcgag tagctgctag cgcctttgct ccataaagcg
    82921 ttttcccata cttcgaaaac ccccggtccg atacaaacac cggataatac gaccgttggt
    82981 gtaacaaacg cagcagacag tataagcacc gcagcgtggc gaccgagttg tcgactccgt
    83041 cgaccttacc agggtaaatt ttttccagca gtccatacat aacattccat aaatccacgg
    83101 caatgggcgt catagccccg ccggatatcg aacccgaaat gtgacttctc actaatccgt
    83161 tcgcataggc gaagtgcatg caaccgtaca cgcccatggc aactttcgga gtcgcagtgt
    83221 aagagacacg gggtaatacg aattttgaat tttgggagta tctgtcaagt atattcaact
    83281 cttgaataac cacgaccagg cgtagctatc caaatgccga aacgttaagc cgctccataa
    83341 aaccttgatt ccactattca attgtgcaat agttggatta gggcaggtat tcggctctat
    83401 ctgttcaccg tatacacgct ataccgtcct ttaaattaga caaggtgcgc gtctctaaac
    83461 ctataattcc cggtagcggt ataagcgaca cttattacat gcctatccac cacgtgatgc
    83521 aacccacacg attcacgttg aagacatgtg acatttgctg taaatatacg caggtaacaa
    83581 tgtgtgcggc gaattagact tacagccaat agtaagcgcg acataacact aaatgggcgg
    83641 cgcgacattc gagtgcctat aggagaccga tatacgtaac cacgcgtggt gcgattgcga
    83701 cccaggctcc ttcgatataa gctttccccc tcacatccgg agccatccgt tagattgact
    83761 ctgcctcagc ctatacaacg cgccaaagaa cagtgtgcta cggacagaag tgacgccgac
    83821 ttgagttcac ggcatcgaga ccccagaacc ggtctcggcg atggcgcgaa taactatgag
    83881 cgatgaacac atcatagacg atgcaggggc cacttctaac gattcgccca attcctggaa
    83941 agtcgtcttg gccggagaga aatttagaac ggtatcggct gcagtacgcg caatagtaga
    84001 ttctgtgaag aatcccctaa tcatattcag cgacgacgga ttaatgatac agggcacgat
    84061 ttgcggtcag caaacattcg ttcctatcga gtgcgccgcc tttagtgaat ttgaatggcg
    84121 cgggtccgcg gccatattcc tggcgctaac agattcgagg cgtactttat tagacgcgtt
    84181 taaatgcgac aagaaaaaag caatcgaggt ctcctttacg ttccgagggg aaccgccgtc
    84241 gcgacatcta acccagacag tcacgtatgt aactgataac ggatcgttct cgagtgctat
    84301 catcaagtat gaactgtggt gcgcctcagt tttattcccg caaaaaattc ccgatgttac
    84361 gttctcagta aacaaacagc aattaaacaa gattttggct atagccgcca agagacggca
    84421 cgagcaacta acatttgcgt tgaaagcaga aggggggttt tatgccggaa ctgtgtgcga
    84481 tgttataagt ttcgatgtag acgggagcgc aatgactcag tatccgtata atgccacgac
    84541 tgcggtctcg tctgccctcg tcttagcatg cgggaagaaa agagccgccc gtaatgcacc
    84601 cgtgactgca tatgggagcg gaaaaccttt ctgcctcgca ctggaagaca cgaccgcgtt
    84661 ccgaaacgtc gtacagaaaa ttaaaaccgg ctcggcaggg gcagatttgg gattttatac
    84721 ggcgtgcaat ccaccgatgc tatgcgtgcg tccgcaggcg ttcggcagcc tgaccgcttt
    84781 tctattttgc aactcggatt gcatgtctat atacgaattg gaggaagcga gtgtagcggt
    84841 cggcgcagta acatcgaaac gcataaacga atattttccc agagtatcga ccatcgattc
    84901 ccggaaaagg cgcccgtctt cggtcctctc ggagggggat gggaaactcc ttaaacccga
    84961 cggccaatag gtctcgtgtc cgcgcgcgga ccacagtcat gacgcgggga ggtcaaactg
    85021 atataagatg tgataagact gcttagattt cattcgacct ggttattcgg acatacatgg
    85081 agcccgtcga caacgcgtct ccgttacctc cgactggcgc gggacactgt cttcatagga
    85141 ttgtttgcat cgaccctcca tgtacagcaa ccattggcag cgggaggagc ggcaataggt
    85201 gcataaaatg tattatggtt acgacgggct ccctgttatc gatggccgca cacttgaccg
    85261 tcaccgtatt ttgcgtttcc gtgattccgt gtatagatcg aaccgcagcc tatccacgct
    85321 gcactatggg cgccatcttc gcattcctat tcttttttaa catgcggctt actgcacgat
    85381 catcggaaat agtgctgctc attggcagac cgacacaatt tttatgcgct ctgacagcat
    85441 caatcgccga cacggtcgcc aaacatctag cggctaccca taaggattac ctgacgacat
    85501 tgcgagcaat agaagtaatg tctctgttga cttttgtcat gctcggagct ctgatcgcat
    85561 cttatcatta cgtctgcata gcaacgtctg gagacgtgac gtggaagacc gggtttttag
    85621 ttgtggcggc agggacgatt gccggcatca cggctccgta tggagacatt tctcctctag
    85681 ccggctttct ttcggcgtat acggcgttac tattcacgtg gtcagagacg ccagtcgggt
    85741 ctctaatgaa cacgtgctac taccgtgcac gtcgggaaat tactgtgaac ggtgcatatc
    85801 gcctcggtcg cgcgcgtctc ccgcccagca cggacgccga ggcgacgcgc gaagaagacg
    85861 tatccagtta cgatacgctg ggggggaata ttcctacgat aattctgagc ctcatagcgg
    85921 tcatctcgat tccagccata gccagctttc aaaagtacat gtcgaacgca actaagcacc
    85981 agtcaacatt gactgacacg ttacgcagta tatgcggttt cttggtgggt acaagtgtcg
    86041 cgatattcct tccgtcgcgc taccacgagg ttctgttccg tccaattctt gtattactgt
    86101 taatattcgg ggcaatggct actaccttag ccggcttcgg tttacttctc gggccgacat
    86161 tgttttccgc gacagccgcg gttctgtgct gctacacttg tataaatgta cgcaacgcga
    86221 atagcggaat aaagcaattg gcggccgccg cagctggtaa atgcatatta ggaactgcca
    86281 tctcgagcat gttggtttgc gtgttaatac aatattcctg atcgcggagc gattaatttt
    86341 tatatcatgt gatcatagcg ttctttcgaa ctgcgaataa aactttcgtg gctactaaag
    86401 gggcctatcg tgggtttatg cgctgtcgaa aacatgaaag ggccgattta aagctaagtt
    86461 gcgcaggcag aggccactcc atatacgctc tcggagacgc ggctcgcacg ccagctgaaa
    86521 tattttcccc atgcacgcgt cacgcgcgtt gcgagctttg gggtggacga gactcttatt
    86581 tgtcgtttta ttttcgggcc gcgtcctaag cgctagcatt aaccccgatc tagctacacc
    86641 cccggtcatt gctttcaacc cgtcaagtat tccggccgat gatgggcctt tggccaaagt
    86701 tcctgcatcc ccgccggcag gggagaaaga ggagagccac aagaatgcaa gcgacgcgcg
    86761 taggatgcct agtatagttt gcgataaaga agaagttttc gttttcctga acaagaccgg
    86821 gcgtttcgtg tgcactctta agatcgcccc tccctccgac aacgaatggt cgaactttgc
    86881 tctagacctt attttcaatc cgatcgaata ccatgctaat gagaagaacg tggaagcagc
    86941 gcgtattgct ggcctctatg gggtgcccgg atcagattac gcctacccgc gtccttctga
    87001 attaatctct tctattcggc gagaccccca agggaccttt tggacaagcc catcggcaca
    87061 tggagacaag tacttcatat ggctaaacaa aacgacgaat acgatgggcg tggaaattag
    87121 gaacgtcgac tacgcagaca acggttacat ccaagttgcc atgcgggatc ctttcaatcg
    87181 gcctttacta gataagcacg tgtacatccg cgtgtgtcaa cgacccgcct cggtcgacgt
    87241 tctagccccc cccgtcctca gtggcgatcc gtacaaggct tcatgcatcg ttaggcattt
    87301 ttatccaccg ggctccgtct atgtgttctg gaggcaagat gggaatatcg ttacaccacg
    87361 taaggacacg gacggaagtt tttggtggtt tgaatcagcc cggggagcca ccctggtatc
    87421 tacgataacg ctgggcaact cggccatcga ccctcctccc aagatttcat gtctggtagc
    87481 ctggaagcag ggaaatatga tgagtactac gaacgccact gcaatcccga ccgtatatca
    87541 tcatccccgg atatccctgg ctttcaaaga tgggtatgca atatgtacta cgcaatgtgt
    87601 gccgttcgga attaccatac gatggttagt acacgatgaa cccaaaccta atacaactta
    87661 tgatactgtg gttacaggtc tttgcaggac cctcaagcgg catagaaata tcatcagccg
    87721 aatattactc caagatgact ggcagaaaac aaagtataca tgtcgtctca tcggctatcc
    87781 tttcgacgaa gacaaatttc aagctttcga ttacttcgac gcgacgccat cgacgagggg
    87841 gtcccccatg gttctcgcga tagcggctgt tgtgggacta gctttgattt tgggaatggg
    87901 tacactcctg acggctctgt gtttctacgc ctccgggaaa aaatacatat tactttcgtc
    87961 cgtctagttt gcggtgacat tgatctggct cattatatgc cccgagctct tgtaacatcg
    88021 cggacgcgat ttccgtagta ggcacatctc aaatgcaaaa gcggcatgtc aaccgtatag
    88081 gtacatccgg ccctgcttac agtcggtagg gcatatatcc accggaaaac ttcagcttta
    88141 gactcctcag gtgatgagga atagtatgta accctctagc agtacggtat ttctaaaaaa
    88201 aggtagatcc ttttccacac ggcacagact aaataacgta cactacacag gttctctcga
    88261 acttcgtttg gaccggaatt attccctcgg cagcgcctaa aaagcaaacc tctagagtag
    88321 ataagtgtca gtgaacctag gccttctttg ttccacggct ggaaagctaa gggacgaggt
    88381 acacgcgacc ccagccacgc acgaacagag tttaacggaa gcgtcgtttg cgggataagg
    88441 ttgtcggacc ccgcgggtcc gttgaaaagt ggctgcgcgc ctaccgacga atacgtcggt
    88501 aacaatttta gaaatcgaat atgactgcga gtaccgtaca atcgcgaaat acggtctcta
    88561 tatagctact cggtccttaa atatgtaagt atgatgtccc ctactcccga agacgacccg
    88621 cgacttggtc cagtacgtgg gctgctccgg atgatggacg agaccacatc tgagcgacac
    88681 aaacgttcgc gttcaggatg cccccggttg ttatgcggtt gtacgatcgg gatcgctctt
    88741 actgtgttcg tcatcacagc tacggtcgtg ctagcttcgc tgtttgcatt ctcttacatg
    88801 tccctggagt ccggtacatg tcctcacgaa tggatcggtt taggctatag ttgtatgcgc
    88861 gcgatgggga gcaacgctac cgagctagaa gccctagata cgtgctcccg acataacagc
    88921 aagcttgtcg actttactca tgcgaaaatt ctaatcgaag ctatcgcgcc gttcgcctcc
    88981 acggacgcca atagcagcaa cgtcttccga ctacgcgata gtagaacaac gtgcgtacgc
    89041 cccactgccg caggaccggt ggccgtcgac tgcccgagga cctgtaccgc catatgccag
    89101 cggccgcgcc cattgagtat cgtcgcttcg ataatcaggg acgcccgtac ttctcttcgt
    89161 ctagaacgtc gcgaatatta cgaagtttat acggccattc tctcaaatgg cagcgtgaaa
    89221 taaacgcgag agaccgagca ttagagtagc acttatttat tctatcgcag agaaacaccg
    89281 cgcgcgttca aaaaaaacac aggcggggta cgataaattt acgcggccgc gctatgttta
    89341 ctttatacat cagaggtcat cgtcaacctg cgcaaaattt ccgttaccgt aaccgtgccg
    89401 ccacgatgct tgcgcacggc ttttgggcgt ggaccggtcg gtgcctccaa aaggcgttcg
    89461 gggggcgttt cggggaccgt actgggagat ccgacagcca cggcgttgca catatctgcc
    89521 ggaatcgcca atcccgtcgt agaagcacaa ccattccttt caatcgaaaa agtggcaggg
    89581 agggttgcgg ctcggtccga tgcgggcgaa ggctccgcat ctgtgcgggt cccatttgac
    89641 gtagatgccg tagtcggtgt cggggagcgg agataagtta gcgagcactg agcgggaggc
    89701 ggggagtctt gagtgaagtg catagtgaag atggactgtc cattagaggc aggcgcttca
    89761 ctggtctcgc ccccgtcctc tacccacgca cgcttcgatt gctggggcga gtcttgcaag
    89821 catctaacga ctgagtcacc tcccttagcc gcgggttggt aggtgaccgt cgacttaact
    89881 cgtgcgtgtt tgaaccagag cgccaccgtg gattccgtgt cagcccacgt gcacgagttc
    89941 atggtcggaa atagctcccc caggaagcac tggaaccgtt tctgttgccg gagagcacgt
    90001 ctcaatgttg agttagccat gccgccctgc agccataccg catacccgtt aaagaccatg
    90061 ttgaggatat attgacagcg gtaattcaaa agaccaacca acgccacaat agcgactaca
    90121 ggccgcgata cttcactttc tgggctgctt cgccacgcgc agcacgtcca caaagcgccc
    90181 atgtgaacaa gaggggctaa aacggttccg ataaaatggc ataacatcgt agtgtcggcc
    90241 cagctttccg atggtaggga actcacggct tcggcaaggg ccaaaaatac ggtatcaaag
    90301 tcgctcgggg cccgagggcc gaagacgtta gggcacgcgc gcagatctaa cacgtccatt
    90361 agccacaccg cccacgtata caacgtcctt acataactca gcaatagttg caagcgtatc
    90421 gacgtatcgg cactaggcgc cgttacatca tcgggtctca tgtagtaggc gtatttttga
    90481 ataagctctg tcccgtcccg aatctctcgc caacatctga gatacagtgc attatctttc
    90541 gcgagttgga acggtttctt gaccaaggcg ttacgattaa tgatagggta aaagagcaat
    90601 gctgcttcac gtctagtcgg atcgcaggtc tcgggcgaac cggcacggca tccatcgcgt
    90661 ctcatctcta aataattcat gtaagaggcc tgataacacc tcttgaccga cgcacgagtc
    90721 agcttctttt ttttcatacg gcgcgcaatg cgcgcgcggt agggcctcgt atactcttcc
    90781 gaggcatccc ctaacgcgag gtagacgacg atacattccg gaactttgtt agaaggagcg
    90841 tcgcgcaaca gcgtttgtcg caaagcagag agaaatcctg aggggagcac ttctacgagc
    90901 gcgtcttctt gagctcggat acccgaaaga gatgtacccg ttgtttccga tagctgacac
    90961 gggtactcct ggacgcgcgt cggcgaacct cgtgaccggg aatttaacgc caacgaatcc
    91021 gtctccggct cgggagaagt tggcgtaaac aactccggcg acatgctagc gcaagcatat
    91081 cggtccatcg gaatctatac agattaggcg cagtacggaa aggccgactt ttgggacgcg
    91141 aagtggccag aagcatcgct ttccttagca caactattct taaatgcgat gcttactcag
    91201 ggcggattga tagtcccgcc catacggcgc gtcaccacga tctgcacgcc gctccgtgcg
    91261 ctttttttta ccggtccgtt tttttgaaga tcgcctcctt cgcatcttct aacacatcct
    91321 gcagcgaggc tagcgtgccg agaaggttat acccgctcgg aggcggtact agctttagag
    91381 cttccaactc tccattcttc tcctctccac gaatcgctgt cgcaatgccg tcgggcgggt
    91441 ctcctcgctc aaattccaat tctaaatact ccatagcgtc gtcgcggtcg gctatatatt
    91501 catctacgct aacaggtcga tacaagcctt tacatacgta gcacaggtgg cggtatagct
    91561 taaacgtttc cgaccaaacg tctacagcga ggtcgtggta catggcggcg atcgtgaggt
    91621 gcgcgacgcc gatattcaaa tgccctagca gacgttgcag aacaatggta gtggctacca
    91681 cggttgcggt taaggtgtct cccgactcga tatctctctc attcgccgag gtgctgcgcg
    91741 atacgaactc gttcataagc tccgtaagcg cagatctagt agcgacataa gccccgacga
    91801 aagtctcccc tagcggcgcg cccccggtac cataagaagc tgattccaat ctccccaggc
    91861 acattccttc cgcataaaga acatcgaggc tctccattgg gagcttttta tgaccacggc
    91921 ctagcagtcg cgcccacgcg cgaacacgat tagctttgaa acggtgaagc attcgacccg
    91981 acgaaacata caggaactgc gcggcgatac tagcagccac acatcccaca gtaacgcacg
    92041 acgatagcat ttcaagttct tctttcgtca cagacaccgt gtcagacgac actctcgaca
    92101 ataaaaacac ttctgcccgt agcatagcgg cacgcatagc gcactgcact tttacacttc
    92161 gatcccaaaa tgcaacggat tctggccagt acgccagaga gccgtaggaa gcacgtaaaa
    92221 ttgcagcagc ggggcccttc gccttacgga tagcgccgcc ttcaaacatt ttagcgtcac
    92281 ccgtaggaac gcgtggcaaa gacgacaata atttggcgcg accgaatttg gaaaagcccc
    92341 ctttatgtat cctcaccgct agctccaaag ccgaggtaat taagaaaata atagcgtctt
    92401 tctgattcag ctcgccagac actacggcac tcctcagggc atctctcccg aggcagagaa
    92461 taagcgcgtg tgcttgcttc gccgtccgtt tccaggcgag agcgcctttt ggtggcgcgg
    92521 acgtatacat atcccccttg gcatagtctg atctgctgtc agaatgccaa agtggaccgt
    92581 ccccgaaagt attgccccgg gtatgtagta atttgtcttc tcgtatagcc tcgactcgag
    92641 gcacgggttc caacagccgc cgcaacggaa tgaacgtgcc aaggctctcg ataaacgtcg
    92701 gactcgtgcc ttcgaccttg atgctattga gatcgggttc ggccgataaa ggggaaggga
    92761 ccgtgtaagc agatacgacc cgctcgtaag gccgtaaatc gtcatcatct cccgaaaagc
    92821 tgtcgcttcc cagagattga ctcttttctc tagacgatgc acccgagcct ttacttatcc
    92881 agttctgttt taagtcagac ggcgcacgct ccaagctgct gtcgcgatta aatgaggttc
    92941 gatcctcatg accgccggct ctcggtcctc gcctgcgtga cgatccgcgg cgtcgtccgc
    93001 gcacgcgccc agaccgagcc gcatgtgtgt attccccccc tctagatgat cttcctctaa
    93061 actggaccca tcttctggat cgatggcgac cttcagagcc attcgagcct atcgaagacc
    93121 ggccagaacc cctagaataa tgcgtgcgca cgctagcgtt tcgatgtcgc cgtctagatg
    93181 acgacctccg acgtctagac ctaggtctcg acctcgatga ggcgtctgtc atgtcgcgcg
    93241 acgcatcccg gcctgaacga tccgaagagc gtccctcccg atctctgcga tagtgcgtat
    93301 gagcactagc gttgcgatga cgacgcctag acgaagacct tcgccgttta gaccgaggtt
    93361 tagatctcga cgatgcgtct atcgcatcac gcggtacatc ccgtcccgta tgctccaaag
    93421 ggcgtctatc ccgaaaagta tctcgaatgt agccaataaa cccttgtccg ttgcgacgac
    93481 tcgtagatcc ggcagagctc ctatatccat cagtctctag gcgatcgtac gtatcgtcgt
    93541 agttcgtctc tgatggtccc acgtgtatgc ttgccatgtt atagggactt cgcgataatc
    93601 ggacacgcgt tttagttccg cgcgttacat aatctcggac cgaaccggtt ctctgtcgct
    93661 gctcttgacc gacatcccca tgacggtgta gagccagcat tcgccttccc gtcacaactc
    93721 accggcaaag tacggcggcc gtccatcgcc gtctcatttt atacggtgcc taatcgaacg
    93781 gcggaaccgt agctatatcg accgcgttcc attgagaagg gggcgcgagg aacggtaacg
    93841 aagtaaatat aataaaatca tttattagct gtcgctttta cgtacaacat tgttttaact
    93901 acaaaatcgt accgtcgcat caagtattac atcaccgttt accgttcgcg gcttacattg
    93961 tgcgagcagc agcgatatcc tcggcaatcg cgggcccggg atgtgtagaa tcccgcaaca
    94021 tcgctttcac gatagtccca tggccacacg acgggccggc cttcccagcg cggccgctct
    94081 ctccccgcgc tgatgatcgc ggtcttggag ggtgcatgag agagtacact tccagctttg
    94141 atttgatgca ctggaataga tacgcggatg ccctaggcgc gtttgctaaa aatgcaggcg
    94201 gggctgtcaa aggcataccc cgctcttcca ctaactcgca tcgcatcacc ggcagtccga
    94261 gttcggaccg tacgtaattt tgtgttctta attcggcggc ggttaacgca cgcccttcaa
    94321 ctatcacaac gccgtggtta aaaataaccg gttgaaataa acactgaaag tgtcgtaatt
    94381 ggtgccaatc gcaccgcagg tctgcaaata agttttgcct tttcctctga ctggcttcga
    94441 gtcgccgcga tacatctctt gtaaccgaaa ggtataaatg catatacaga agtcttgcga
    94501 accttgccgc ttcccggtaa tacgccccgg cgatagatcg ccggggcgtc tctgacccgc
    94561 cgacgcacat atcgcatcgc gagggttcgt tcgctccctg cctaagataa catgccaaag
    94621 cacgacaata accgcaaagt agagtgacat aggatttttc tctagcttcc aattccatcg
    94681 aaaagaattt ttgaatctcc gtaacataaa caggcaagcc gtcctttgtt aatgggggcc
    94741 gcgggacttc catcccgcaa tgttcgttta gatttatcgc cgtatatgcc catttctctt
    94801 cggacgccgc atctaggact tcgctaggag agacggacag tagggttgca tgttcgtata
    94861 agtgcccatt aatcggaaag cacgagaaca agtctacgtt tagtttttcc agccgagata
    94921 acagggacgg gccctctgta aaatccagtt cgtgcaagag cctgttgtac aagcggttcg
    94981 gaggattcgg atttggggac ggaagcgaaa ttttgatcga aaatggagca ctcaaagaga
    95041 acgaggcaga ttgctccgcg catctcgttt gagagcaaag agtttcgcta aagctttcaa
    95101 tgccgcggag gatgtccgaa tccaaacagt ccgtcattcc gtttacgggc gcttcgatct
    95161 cggcggataa gtccgtactg tcgcggcgag catctcgact ccccggtccc attctccgcg
    95221 tcgccatcca tctgcttagt agcgcccgcc ccactaccga tactttatgt gacgctattc
    95281 actctcgcta ctatagttac cacgggaact tgagtagtgg cgacgtgaag tcgtcggagc
    95341 gcgaccgggg gtttttgagc gacgatctct cttatctacc ggagtgctct cgtcaccgtc
    95401 gcgttttcca tattgggatc tggacttagg gtttcccata tccggcgaca gtccggactc
    95461 ctccgataat tttcgcgtac atgcctcagc ttcatccaat aggtttgccc cttcttgaat
    95521 cgtgatcttg attatagccc tggcgaggaa ttcctcgagc tccgcattgg tcctcggggc
    95581 gttccgacgc caaagggaaa gcgctcccct atatgcatgg tactgggcca cagcagctac
    95641 ggctccgcag aatatacgct cgttatagac gagcgtgttt gatcgccagg tactagttgc
    95701 tgacgccgga gtcgtactaa aggcaaattt ccctttttct attgccctgg ctccgggttt
    95761 ggcacgaact ttggaggaca gcgactcccc tctttgggtt tccgatgagg aatcttttct
    95821 ttcgatcttt acagatctgc gtctttgtaa tgaatgagac gggggggaga tccggtccgg
    95881 cgactcgttc ttggacgaat ctcgtcgagc gcgggtcgac gatatatggg cactattatc
    95941 cggtgacgtg cgcatagttg agcgacgtcg actcgactta cgtctatccg aatctcccat
    96001 tgtatctcgt attaggcagc cgattacaga cgcgacgggc cgttacgttt caccgtgttg
    96061 cgtctccgac actgatcaag ctgttcacgg caatgacatt cttatacggg aacagtagcg
    96121 cccacgccca cacgatctta ccagccgtca tcgaacatac ttgccgtgaa tagtcggaag
    96181 catgcatggt acgacccggc caagagggcg gagattaccg ccaccagacc tagataaaaa
    96241 aggaccgaga agccagaaga aaaggctata gacacgccta cggcggaaca cgtagattcc
    96301 cagaaatttc ctgccacggc gatcggcctt cccgaatcga tcgaagtagc tcgcgactcc
    96361 acgagggacg caattacgca aattaacact ttacagacca catgatggat gtcggacaaa
    96421 cccatccctg cggtaacgct ttggaaaaga tgtcctcgca cgcgtcgggg gctccgtggc
    96481 gcatgcagtt ctccgtcgat gaagcgatat atgcgaggaa cccagaaggt tggacctgtt
    96541 atatagaaga acgcgacccg cgctgtcttc gcgttatcaa cgactgtgcg atctcgttgc
    96601 ccaaacgcga tgttaagcgg aagtatgaaa tatgtgcgtt agatctaggt gtacgagtgg
    96661 cagttcctcg gaattatgtc gttgtgctgg cgaaattgac ggacccggat ccaacgtctc
    96721 ggggcgtacc cgtaatccgc gttgccaatg gactaataga ttctggatac agggggaacg
    96781 ttcgagtggt acttttgtac gaagcagctt gcaccattcc taaaaacggg ctggttatac
    96841 gtctggcgct cgtgcagttg gcctatccgg atttcaacag tcgcgtgctt tttgacctcg
    96901 ctgatatcac gccccacttg gattgcgggc ctaacttttc gatgtcgatt gcaaccgctg
    96961 ctaaatcgca cagcgctcag gctcgaccgc tattgccccc tggcggcgag aaactatggc
    97021 cgggaaccgg gtgtcgggca ctcgtctgtt tgtacagcga tcgcgtgtct cgggcaactc
    97081 attataacac tttagacagc aatgtcatat ttgccgtaag gtacaatgat tctacgaccg
    97141 ttatcggctt aaaagatgtc ccgaagtatg tgcataaaac atttgtacgg ttttatacat
    97201 ccggtcaatt tgcaacgttc gttccttttt acgagacatt taatacaaag cggcacgaag
    97261 atgcggctta cgatatattc gctccgagcg acattgtatt ggaatcaatg tcttctgtaa
    97321 ctatcgcgat acagcagcga tatgcatgtg cggataagtc aatggttcct tggatcttcg
    97381 gacggtcgtc catgaatttg cgcgggttga ttatttcccc atctaggtgg atgcccgatt
    97441 cgtggttaac gctgacttta tgcaacttaa cggaagcaaa agcgaccatt aaacgcggag
    97501 ataggatcgc ccagctgttg ttagtcaatc aggaagccgc tgcgttgctt ccaacggaag
    97561 gcggcacggt gcgctgttcc ctacagtagg taaatgccgt cgtcccgcag cgtccgcgga
    97621 agctaagtgg agggaaacgg cagcattcga tacggaatcg ggcaggagcg agagagagtg
    97681 tgccggcttc gggtcgagcg ggcaataatg tatagttgcg cacgattaca tacaaaacaa
    97741 taaacacgaa caccacgctg cgttctggac aatcagttta ttcagttaca cagtccggta
    97801 acatgccctc gttgactcca catgtcttag cccttctacc gcttccctta cttacatcac
    97861 atgacgttgc acatgccgct tgctcggctt cagagtgcgg cggcgaaggt agccctccca
    97921 cccgaccgta aatatctgct ccactttcgt ccccgcagtt acgggggtca gtagcttccg
    97981 atagctctaa gttttccgtt tcgggacacg cggccaacgc ttcgagcgag caatcatttg
    98041 gggaagattt taagcctaac gctctttcca ctagagcgat atcattcata gcagtctctg
    98101 tagcagcagt tatttgtatc gcgtgttcta cgaaggcatc cgttcgtccc gtgccgacag
    98161 acatgtagat ctgcaagagg gcggcggcac acgtgtccac cacttcgtgc gcatttttgc
    98221 gatgggtctc gacgaccgcg tcgagcccag gggttccttg tcccgaaaca tgacgagata
    98281 ggcaatcgag attacggaga cacgcactgt acattctagc caacgactgg ccacgaacca
    98341 gttttcgcac tccgtcggca gacaatatcg ccatttctaa tgtgatgggc gtggggagca
    98401 taagattgac ggcttgtacc gcctccctga aacgatgcat aactctgtcg gaggaagacg
    98461 aggtagacag tgctgtgtat tccggctgaa tttttctaga gcgccttctt aacccggcgt
    98521 gcattgtggc caaatcttct attatgtccg atataccgga ggatgccgac cctgggatca
    98581 aagttttgtt tgccgttgat ggttgcgccg tctcgttctc ccttgcactt cttacgggtc
    98641 aggtcccatc tatcaatccc gtctacgtta tcagccactg ggatccgggc aatcgtttgt
    98701 tagatgtcct ttgccaccgc gcagacgatc gcgactgcgg aagaataccg aatgaacgag
    98761 gagatttaaa cgcggtctcc gaccctctaa aagtagagtt ttgccttctc agtcaaatga
    98821 cacgcggttt gggcggcgcc gatttaaaat tgcggacgcg agcgatattc gtgtgccggt
    98881 ttacttcgca ttccgagatt aactccatcg tggcttctat agcttccgga gcgcctattc
    98941 aaacagactt attaatagcc accctctccg aatatgacac atttcgccta catgatgact
    99001 tcaacatcgc cctccacatc tctctcgcct gtttatcgca aaagcgccgc aatgggaaag
    99061 agccggcaaa atcaccggat cgaaatctgc tatcgattat ggcgggaacc ttttctggag
    99121 gtcggcgcgg tctagccggg ctgtatttac aatacgagca aaaagtcacc gcggcctacc
    99181 gacgtgtata tggggggtcg acgacgacag cgttctggta cgtgtctaaa tttggaccgg
    99241 aagaaaagag cctggtcttg gcgctacgtt attacctttt gcaagctcag gccgaaccta
    99301 ctgggattgc tacgggttac gatttacagg ccataaaaga tatctgcgac acgtacgctg
    99361 tacccgtaga ggccaatcct accgggtttt cgacggcaga cttgacatcg tttgccagat
    99421 tatcgcgttt ctgttgcgtg agcaattatg ccaacggtcc cgtagctagg gcgtttcccc
    99481 tatacgtgga acacagaatt gcagccgacg tgacagaagt ggatgcattg aaagagtata
    99541 tagaaagaga ccggtccggg ttaaagattt cggatttgga atttgtcaaa tatatttact
    99601 tggcttactt cgagtgctac aatcgtgctc aattaagacg tcatttgcga gacgtgaccg
    99661 tgcgttgtcc cgaagaagat gtctacaaac gctcgtctct ggggaaacac gcagtcgata
    99721 atttctttac gcatgtgaga tccagactaa acgtgaacga tcacatagca tgtaacgtat
    99781 ctccggatca agtggaaatg ggaaacgttt tgacccgagc attttgtagg gccaggacct
    99841 atccaccgag taccatggaa agcgatgcgc gtttcaccgg gatttgcgaa ccctcgtcgg
    99901 tgattataaa gcgtctggat gccctagaat cgacattaca caaatacgga tggccgcgcg
    99961 cacggtctga aacagttaac atgatgtcag agtgcgcgaa tttgcccatc gcttcatctg
   100021 ccgatagtct taggccaccc ggcctgccgc tagaacatcc aggcactcat tgccggggtg
   100081 gtccaatgat cgtaaagcgc ctactagcgc tagtatccgc agatgcacgt gtcggggaca
   100141 taggaccgac aaacatgctc accggcattc gggaatcggc cgtcaagggc cctcttccga
   100201 tttaccggat aggcatgtcc aaaggcaaac aagcgtttgc cgtgatggtg gccgattgtt
   100261 gggacaaaat catcccgtct ccgggaattg tgaaagccca tctctctaaa ctcggcagat
   100321 ccggtagagc ccccgaagac gatgtgatcg cccgagatat tttttttaca tcagaacttg
   100381 agcgagtcac gggccatgct gcggaactgc cgtactttac ctgcggccct gccgaagaac
   100441 aacagtacat aaatcgcaac gaagtgttca atgacaatct tattgtgggg aacataatcc
   100501 tggatgtcga tgtgcactta cgaacccccg tacccgtcaa acttttgcat gtggcaatga
   100561 gaggttttag gaccggtgcg ctcaaagcgt tgtctctatt acttccaaaa gcaaaaatag
   100621 atcacggctc gtacccgtgc tacttttaca aaacctcgtg caagaaatct cgagtcgtgc
   100681 acgtaaaaca ttggatgtcg tctactaccg acttcgctct cgactgcgac ggtcccgccg
   100741 tcgaaagtgc agactgcgaa ctagaaatgg gcttcgatga cccgttactt atggatcaaa
   100801 ttgatgattc catcagtaga tgtgagtcag atgcatcaag tttgccgtcg gacgccgatc
   100861 tgccttgtaa ctgtcacgaa aaaataggat tgcgggtctg cattccggtg ccgcccccgt
   100921 atctactcgt aggtagcaga acaatgagcg gtctggctag ggtactgcaa caatcggttc
   100981 tgttagaacg tagtttcgta gaacctatcg gttcgtatct caaaaactat gatatagttg
   101041 atagcggagt atatggtcac ggtcgcagct tgcggcttcc tttttttggc aagatagacg
   101101 agaccgggct tatatcaggc cgcctgcttc cgttttgcgt gataccggag cgctgcggtg
   101161 acgcagaaca gttcgttctg tctcatttac agcctaaaac ctttcacttc cacagtccca
   101221 tgcccgaaga agatcacgcg tctgtagttc tgaagggcct aggcggagag tatgccggat
   101281 tctttgaaaa aaaaatcacg atcaatagag atacgttttt cggaatcaga ttatccttag
   101341 cggtagctct gaaagccagg ggggttgaca ttaacgactc tgcggcaatc gtatcattcg
   101401 taacggagca cattttagat gacataattc agtacatgca tgaccacata cccgatcacg
   101461 ctgcggaata taatcacgtt tctgtttcgt gctgcgtcat tagaccagat tggatcctct
   101521 tgcagctaat ggccaataaa acattgggac gcgctcacgg gtttacgtgc gtgaggttta
   101581 agcatacaag aacgactcga atgagttcgc gttcgtattt gtctttaaac atcgacgcac
   101641 atggtaggtt gtgcgcgtgt gtgattcagc agtgttttgc ggccaagtgt ggaaacaata
   101701 aactccgtac tctttttacg gtggatgtcg attcgaaatg ccaggcagaa catcgatagc
   101761 cctttcggga attatactct gcatctcgac atacgccatc gctttggtga tctacacgac
   101821 gatgatagct aaacacggtt ctgggtgcat ctatgccgtc ctggtagaca gcgatcatcg
   101881 cgatgccaaa aattttacat gggagccata caattctaca ctggtataca cgccgctggg
   101941 gaataaatta ccattggacg gaggatttgg cggttttagc gatgtatgta acacatatct
   102001 gatcaacgcg acggatttat tcggacgcgc gtctcacgcg tccgccaagt cgaaaatccg
   102061 ttcggtggta ggaacgcgca attgcgcagc ctacttttgg aagacgcata tacaagcctt
   102121 gaccttttcc ctaagttcgt acattatgtt ttgcgtcatt agagaatgga gacgcatgtt
   102181 tggggtggtg cgatctgaaa acgacagaat accgccgacg acgtacacga agaattatac
   102241 tgccagggta atcgctaacg gattgctaaa aacggtatat actagaatgt ctgaatttat
   102301 gtgcgagatt actatataca aaaattctat gtgcagaata tttacagacg accctatctc
   102361 gtttatctta cgtcaccctt tggctgcgat tctccttata accgagcggc tcataaggct
   102421 cggcggacag tgtctgtgtg tactaacggt atcgattttt tttgtaccgt gtaaaatagt
   102481 tttatcgaaa tggttcttgt ctatcaccgg agttttctta ggaatcgtta tttgcaccga
   102541 gatgggcctg ctgatagacc cgggaccggc tgaaaaacct gtcatgtttg cagaagttgc
   102601 cccagccccc aaaacccagc agaacggcgt ggctgtcccg ttcggtgcac acgctgtatg
   102661 ttccaattgc tgcgcctcca taatctccag catagtcatc aaagttctgt acgtgttatt
   102721 catggttacc ctcatcgtta ccctcgtgcg atatgaacga gcgctccaga ttgccctgtt
   102781 cgggcgtgcg tacctaccct aaaacattag tggccaagcc tcctatttgc atcgcgcgga
   102841 tgtgacacgc taaccgcgag accttataaa tggttccaat gactcattcg ccctcgggtg
   102901 tacgcggtat tctacagcag cgtattaaga taaactacac gggtttgccg tcgcgcctca
   102961 aggaaaatgt cagtgggagc tttctctcgt gattgggacg atataatgag tttgtcagac
   103021 tacgatttta cagaggaaga atccttagat gaaagcggcg aactgaaaga attcaagaac
   103081 acgtccgcgt tgaatgctat tgagacagcc cgcgacgcaa ttgaaagatc agccaattca
   103141 aaccccccca tcgaagaacc gtcgttcatc tccaaatctc atgcaggcga gacctcggcc
   103201 tcgaaatata gaagcttgcc cctcgacatc gaaaaggcag aacggtgtga tgacactcga
   103261 ggctacaacg tgagttcggg aaaacgaatg cgtttggcag tttcggccac tgttgacctg
   103321 tgcgagtctg agatcgaacg gcaatgtctg aatacggaaa cgcgggaccg tgcacggtcc
   103381 cccaaacatt ttgcatccca ttatgaaatc gccgccaaaa tacacgatct tcccagatct
   103441 acgggaaaaa ggcaacggca tcgcacgtta gattctcgct cacgacgcca cttagcggga
   103501 gagcatcggc ggcggggagc tcatgacgag gaaagcagac acttttccct cagaatgcgt
   103561 gaccctcatt cagcacccgg caagagcccg ctgtcgaaaa ggcgcagtcc cgttaggctc
   103621 cgtaacctct ctgtgcagga ggaacttaac gcgatgctac aacgagagaa actgaagctc
   103681 gacatgattt cgagagagcg caatttccgc acttctagca aaaaccgctg ggcctcagta
   103741 ctggcattct cctgtaccgg aaaaagtggg gcatacgggt ctcagataac gtggcaatat
   103801 ttgcttcaag agggaccgga gcttagaaag acgttcgaaa atagacctag aacctcattg
   103861 ctggcgtctg cggcgcgcga agctgtgttg cggggcgaaa acttagttgc ggcattggag
   103921 agcgccgagg aaaccctggc atggctgaaa ttacactctg ttctaaaact gcgtttaatg
   103981 aaccatgacc ctattttcag gacggcgggt gccgtcttag ataatctcaa gctgaaactc
   104041 gcacccataa tgatgtgtag aaatggtaca gacaaacggt cgttaggaga catgctgaga
   104101 agatccgcca cggacgatat cgccgattca ttgaccttat gcttaatttt gctatcgcgt
   104161 attcatcgca tgatgatgta tcgcgtgtcg ggtagaaaag atagttccat gatagatcct
   104221 cggggataca tgagagagta tactcctggt gaatgtatgg cgggtatatt gcattacgta
   104281 gacgcgcatg caaaaacgtg ttccgacaga gcgtgcaatt tatatattag ctgtaccctt
   104341 atgcctgttt acgtacacgg caggtacttt cgatgcaatt ccgcgtttga tatgtaacct
   104401 actacagacg ggcaattttg tattcttcaa tagctttatt tgatatccat taaacttaaa
   104461 taaagacacc gatattcaat tggacatgaa cagcgtgcgt tttattttac acttagcctg
   104521 tgtgctttcg acaccgagta ggaaaacgaa ggacctgaaa ttgcacgcac gaccgaagga
   104581 aataagccat cgcaatcgca tttgaaatcc aagtaggcaa attcaggaga acctatcact
   104641 tcattgaaca agttctcgag tattcttatg aatgataagc actggagccc gccaggcgag
   104701 tgcgcagaca caactaatta acatgccgtg agtgctgaag ttctctctca tggcagattc
   104761 gcataagtaa atagtcttcc ttcgagttcc tatctccgtg aatctgcggg ggttcatcag
   104821 aagcgcaggt ttgatttccg acgtgtgatt agaatgaaat tgtcgaaaga cagtctttag
   104881 agtcattggc atgtctgtca gtactatgga cacttccttg cggcagcgat cggtaaggaa
   104941 ccacagtagt tccttaggta gtatgtttct acctaggaac cacggtgttc ccacggccaa
   105001 aaaccaagcg tggtcaaacg atccggtgct cggagaagaa cgctgcgtat ccgctaccca
   105061 aagcagtatc ctttcgcaga tagacgacgt tgccgtgacc attctccctt tccaacctcc
   105121 cgtcagtaca ctgtttattg ggcccccggc gtgcgtgagg agtaccggtc tagcgactat
   105181 tccataaacg ttagtcggtg agagttctct cggggtgagc cacattggga agcccgtctg
   105241 ggttggagcg tccgatgtag agtcgtaatt ggcgcagcgc tggacctgcg gtctacaatg
   105301 catggtcatg ctagacggga caactagtcg cccggtgcat ttttcattac ggccatccct
   105361 tacgtccacg taccacgtgc cgtgagtgtg taggtaacac gtagtgggcg tggaaaaact
   105421 tatataacac ccggcagaaa ccacgtgcgc ccagcggtgg cagatcctca gttctacagt
   105481 gtccaatggc ggaaagtaca gctgaaccgt cagcttcacc ggtacgaatt ccgtacgttt
   105541 ggcaagtgat cgctccgtta gcaattgacg tgccgtccgc ctctactcaa ctagctacgg
   105601 gcgaacatgt gtcatgtgcc gcatccgtta ttcctcgttc gtacgtcata cgggcagcgt
   105661 gtaaatcgtc gacgactttc cacgcgttct tctttggatt ggcgacggat ccgtctgaga
   105721 acatgtccca atgcggtgcc tcgtatatcg cgtatagaat gaacaagaag ttacggactg
   105781 gtcgattgac aggcgaccaa tgcgagtcgc ctttttctca tgcgacgatc atcgactcac
   105841 tggatgaaaa ctacagcatg gctatagagg gactgtgttt tcattgccac tgcgaaaata
   105901 agttttcgct cgagtgttgg agatcggctt ttagcgctgc cgaaaaaatc gcatcgcagt
   105961 gcagagctat tcgcgagtac ggacactgaa taaaaacgaa tcatgatttg atctaccatt
   106021 tcagcattta ttggtttata cattctcggg ttcgtatgta tacaaaatct tatggcaacc
   106081 cgcgataaca attcatttac gcataccaat tgcgagagct aggggcgcac cctcaggttc
   106141 gcctacgccg gtatagcgtt gagatctaat acgggagtag tgattttgta ggaatgtaag
   106201 tggtagtaac acctaaagaa aaccacatac taacgctcta ctgttcactc gtatctacgt
   106261 gcagtgaggt tcccgcatat gtttgcgcgt catcaatcgc tctcgccagt atcgccacaa
   106321 tgcgtttttc gcgcgcgggt attgggacgc agtgtaagtg gaatagcatt ccgcaggcaa
   106381 aaaagttgtt tgtcatgcaa gcatccatca agtagcaatc acatagtggg accagacgcc
   106441 tcaaagcgac gtagtggggg gaaccctctt cccattgcaa ccactttcga aatctgtagg
   106501 tatatgctgc cagccagcgc cttgttctga cggttattac cctgaacccc ttaaatggga
   106561 agaagaatcc aaggtaccaa tcgttggcga ctggcccgtg cggacaacgg gttaaggatg
   106621 tgacaaactg tgtttgcgtg ggtacgttta cgatgtattt cgaatcccgc acgacgcatt
   106681 cctcccagtg agatagtagt atcccataat tcatgcatct gactaccttg ggggtgagac
   106741 acgctgtaat atgaggcgtc gcttgtaaaa cgcacctgta tggaaccgtt ccgagttcgg
   106801 ggattgattc tatgatagca agtctactta ttccggaaac cgccatgaca tcgcacaaag
   106861 gaagcagttg gttaattgca tgaatcagaa tgtttgtttc cagcacggca cctccaaagg
   106921 aaaataatgt ttcgatgcac gttcgtgccc cgttctctgt attacagctt actagcgcaa
   106981 ggctgaggac aaaaacgagt tcgggctttg tatgttcgag cggaacacca atgcgacata
   107041 ccgtatcgct taagtttttc ataaaagtgg atcttgcacg tttgccagat ctgctccaat
   107101 cggccgaaaa aaatttgcgc acaatcggat gcatgtctgt gcctacaaat accatgaaac
   107161 ataattcttg tgctggaccc ccatccccgc tatctatatc tacattgtct gacatgtgtt
   107221 gtgccgacaa caaacggtgt cttgtatccc catcaatcca gcgctttctg aggtttacgg
   107281 gctttaggat ggacacatca ccgcatttcg gcacgcataa cgcgggcatg tctgaacggg
   107341 caacgattct ctctgtgagc agatcgagac ggccgtgacg cacaccacgt gccggtacat
   107401 taggcacgac tgtagcaaaa ggatggtagc gatggagcca gcctaccgac agtcccgcaa
   107461 aaaatcttat cggcggaatg tctcttttaa ggggtagtgt gttacgaacc gatgaattca
   107521 atttctctgt ccaaccactt atcgcttccg caacagaaaa atcgtttcta agttgcgaat
   107581 atgtttctac cacccacttg agatcgctgc gaagggcttc cgacattttt ttagcgtatt
   107641 cctcatctcc atcacaatca cagtcgtgtc tttcatttgc aagtgtgggc gcgcagatgt
   107701 ctacgcgacg acttaaccga gacactgttt ctctagtgta ccggtaacat ggactggcgc
   107761 ccgctctgac cgttagcatg cgtttggatg caaccgaggt tagataaacg tctggagaac
   107821 tgcccaattc tttgctttca ctggcacata tccaaccgta tgtatcctct gtctgtcctg
   107881 ccgcctcaaa gttaccgggg agaggtccgg gactcgctag acagaagtcg atttgggaaa
   107941 attctgtgtc attgttgtag ggactgtgcg gcctatctac catagttgca gaatcgtgca
   108001 ttagaatttc agcgagcatg gaatcgatac gttcgtcggc acccgcatat acggcaccta
   108061 ttcctattcg cgtacaagag tcatcttcta catcaagctt ccagaacgtt gtcaggtatt
   108121 cgccataggc tgcaaagtct gcatctgtgg ttcttcttac aaattcaatc tccgggttcc
   108181 aacgtccacg tcccatacat aggttgcgca acgtgatcga gtacgccaac gtattgaaat
   108241 catttatgct agatgcttcg ctattatctt cgaacaaaat tatcgtatac aatttcgatt
   108301 gatgcatcga tcgaaggact gacaaatctg tcgcatatgt ctcctcgggg agaggtgtga
   108361 cggtgatagg ctcgtcccta cgttcgaacc ggataaggcc tactgtagcg gtggtttcag
   108421 tagtcctgat gcatcgtaaa attgtggcct cggttctaat tttcccgagt aaggcccacg
   108481 gaggtccgca attactatta cacagggcct ggattacgga ggaagtgcca gttggtgcac
   108541 accgaaactc tggaaaccat tccttggacg gaataggagg gtggaatttt tgtcgtttag
   108601 tccactccat ctgttcgtac atggaaaatc gtgttaattc ctgatcgtcg aaatgtgcta
   108661 atggagctat agtgctgcgt tcggctggtg cggaacctat agacacgaca tattttggtt
   108721 gcacgtgcag ttctctgagc tgattaggaa ataatactgc gtttgatgat agcaaagacc
   108781 tttcgggatc gagctccgga gtgcagtgcg aagcgtgaac aattctactt ttcttccgag
   108841 acggtgtgaa gcaaaacatc ttgacgatgc tacgttctat ggcattctgc aacaataaag
   108901 tatcaaatta ttttgacatt atcatctata gtatgagcgg tgtgttatat aagaggacga
   108961 aacacttgtg aagtagacac gttttattca ggaactcaca ttttcactac tacgctgttg
   109021 tgagcagaga gataagcgcg gcggaaaaaa cagtcacaaa tactactgtt aatataatga
   109081 tcgcagccgc gatcctgtcg ggcattaaac aaccaatcct cttcatcatt agtttccgaa
   109141 gagctagtct cataaggcgg cggaggagag tcgtaggtag gaggtggtcc atttgaggct
   109201 tcatacggag gcaaatatgc agcgtcgcat tgaccgtccc ccagttgtaa ttcgaaatgt
   109261 tcatataccg attccccggg agcgtctaaa aatggttgct cctcatgtaa cgcttgcgct
   109321 tcgctcgtca gaccgcggtc tagctctgcg ctcgtaagtt cggtttgcgg tcggtcgcta
   109381 tccattttcc ctcgcccgca gtaactgtgt cgatggttca ctactctcga aggagttaaa
   109441 ttgcctactt tctcctcgaa tctcgaatgt ggctatgcag catcagggtc attagcgtca
   109501 gtattttcct ctttggagtc tatggctcta ccccaaatac ctcccgcgat tgctcctgtg
   109561 cataaggcca taaacaggcc ggccctctgc caacccgttg aatccacctt cactgctctg
   109621 ccaattagta ttcctgcaaa aaatgccatg catgatccca ttactaatga tcttgcggac
   109681 cgaataagcg tgattaccat taaggagcgc attgtagcat tctcagattc cacagataaa
   109741 acagtacgag gtactgtagg agcaaggcgc tgacctacga ggttttgttg cacctttccc
   109801 gctccttttt ctgctatcat cagtaagtta atggactgca cgatttcgct ttcggcccgg
   109861 aggaggcggc gggcatcttg taccgcgcgc tcggcgcgcc ggagcaggcg cgcgtgcgcc
   109921 tcgtccgcgt ccgcgcccgg gtcgtcgccc gggtcgtcgc ccgggtccgc gcccggtccg
   109981 cgccctccgg cgtcgttctc tccggcgtcc gggtcgcccc ctccgtcccc ggctccgctc
   110041 tcgcgctccg catccctctc ggcgtccgga ggggcgcgcg gatcagcggt cgggtcgcga
   110101 tcgcgtccgt cggatcggcg ccttttcccc cgccgcatcg cgttccgccg ggccggtcgg
   110161 acgggagaag aagggggagg gggggaagga ggagaggggg gagggagggt agccggccgg
   110221 cctgcagttc gggaagagcg ggggaggcgc cgtccgaggc cgccggggag gaggttgtgg
   110281 gggcgggagg atgtgtgggg gaagggaagg gggagacggc cgaaacctac gcgttcgccg
   110341 cggcgtccga tccgggatcg ctcccgacgg ggctctcgtt cggcgatcgc ttatcctctg
   110401 ccgccacctt gcgtccgttc gcgggaagcg ccggaccggc gctctaagcg gagatccggc
   110461 gcctccgctt cttatgaccg ggccggtcgt gagggcgtaa cgatcacgtg atgcaatgca
   110521 aacgagcggg gcgaacgcgt cagcgttcgc accgcgaacc aatataagat tatatatata
   110581 atatattatt ggcgcaaggt gcgaacgccc gtccgggcca atcgggaagc gggatcc
//

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH