NCBI Nucleotide banner
My NCBI
[Sign In]  [Register]
PubMed Nucleotide Protein Genome Structure PMC Taxonomy OMIM Books
 Search  for    
  Limits Preview/Index History Clipboard Details
 Display   Show    Hide:     
  Range: from   to  Features:  
1:  NC_006151Reports  Suid herpesvirus ...[gi:51557483] Links
LOCUS       NC_006151             143461 bp    DNA     linear   VRL 08-MAR-2007
DEFINITION  Suid herpesvirus 1, complete genome.
ACCESSION   NC_006151
VERSION     NC_006151.1  GI:51557483
PROJECT     GenomeProject:14424
KEYWORDS    .
SOURCE      Suid herpesvirus 1 (SuHV-1)
  ORGANISM  Suid herpesvirus 1
            Viruses; dsDNA viruses, no RNA stage; Herpesviridae;
            Alphaherpesvirinae; Varicellovirus.
REFERENCE   1  (bases 1 to 143461)
  AUTHORS   Klupp,B.G., Hengartner,C.J., Mettenleiter,T.C. and Enquist,L.W.
  TITLE     Complete, annotated sequence of the pseudorabies virus genome
  JOURNAL   J. Virol. 78 (1), 424-440 (2004)
   PUBMED   14671123
REFERENCE   2  (bases 1 to 143461)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-AUG-2004) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 143461)
  AUTHORS   Hengartner,C.J., Klupp,B.G., Mettenleiter,T.C. and Enquist,L.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-OCT-2003) Department of Molecular Biology, Princeton
            University, 301 Schultz Labs, Washington Road, Princeton, NJ 08544,
            USA
COMMENT     VALIDATED REFSEQ: This record has undergone preliminary review of
            the sequence, but has not yet been subject to final review. This
            record has been curated by Dr. Andrew Davison (MRC Virology Unit,
            Glasgow, UK). The reference sequence was derived from BK001744.
            CURATION: The original gene nomenclature is retained. Genes
            inherited from the common ancestor of alpha-, beta- and
            gammaherpesviruses (core genes) are indicated. A standard protein
            nomenclature is applied so that orthologs have the same name in all
            herpesviruses. Protein information may not have been derived using
            this virus, but may have been propagated from orthologs in this
            genus.
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1405              AJ581560.1         1-1405
            1338-8750           X87246.2           1-7413              c
            8527-9621           U38547.1           1-1095              c
            9495-11694          AJ437285.1         1-2200
            11566-16882         AJ010303.1         1-5317
            16808-19858         M17321.1           1-3049              c
            19465-21988         X14573.1           1-2524              c
            21714-25668         U80909.1           1-3957              c
            25606-28749         L24487.1           1-3144
            28546-31145         AJ319028.1         1-2600
            30675-32600         AJ276165.1         1-1926
            32340-42783         AJ422133.1         1-10444             c
            41444-47569         AJ318065.1         1-6126              c
            44362-50018         X80797.1           1-5657
            49986-50210         AJ581562.1         1-225
            50173-51630         S57917.1           1-1458              c
            51517-51963         AY368489.1         1-446
            51628-52782         M94355.1           1-1155
            52640-53992         M77761.1           1-1361
            53834-55558         M12778.1           1-1722
            55404-59926         X95710.1           1-4523
            59125-60614         X55001.1           1-1492
            60490-63738         M61196.1           1-3249
            63388-64488         AY368488.1         845-1937
            63733-73114         L00676.1           1-9382
            73079-77111         AJ581563.1         1-4033
            76924-79124         M94870.1           1-2201
            78351-89409         X97257.1           1-11059
            88920-94119         AJ580965.1         1-5200
            93744-96534         U02513.1           1-2791              c
            96079-97923         M57504.1           1-1845              c
            97885-113025        M34651.1           1-15141             c
            112987-115448       AJ251976.1         1-2462
            115410-119417       D00676.1           1-4008
            119171-121194       M10986.1           1-2023
            120890-122323       M14001.1           1-1440
            121033-122622       AJ271966.1         1-1590
            122268-125923       AY368490.1         1-3656
            125661-126705       D10452.1           82-1125
            126409-126680       D00633.1           1-272
            126660-129192       D00676.1           1-2533              c
            129154-131615       AJ251976.1         1-2462              c
            131577-143461       M34651.1           1-11885
FEATURES             Location/Qualifiers
     source          1..143461
                     /organism="Suid herpesvirus 1"
                     /mol_type="genomic DNA"
                     /strain="Composite of 6 strains"
                     /specific_host="Sus scrofa"
                     /db_xref="taxon:10345"
                     /common="Pseudorabies virus"
                     /acronym="PRV"
                     /acronym="SuHV-1"
                     /note="strains Kaplan (Ka), Becker (Be), Rice,
                     Indiana-Funkhauser (In-Fh), NIA-3, TNL"
     misc_feature    1..101140
                     /note="UL"
     misc_feature    1..16882
                     /note="derived from strain Ka"
     repeat_unit     3..84
                     /note="inverted copy at 442..523"
     repeat_region   156..251
                     /note="2 copies of an imperfect 34 bp repeat plus a
                     partial copy of 28 bp"
                     /rpt_type=direct
     repeat_unit     442..523
                     /note="inverted copy at 3..84"
     repeat_region   529..656
                     /note="3 copies of an imperfect 41-44 bp repeat"
                     /rpt_type=direct
     repeat_region   751..963
                     /note="8 copies of a 26 bp repeat plus a partial copy of 5
                     bp"
                     /rpt_type=direct
                     /rpt_unit_seq="cccccaaccccctcgttccccccttt"
     misc_feature    1252..2259
                     /note="originally annotated as ORF1.2 CDS, a 5'-extended
                     version of ORF-1"
     gene            1584..2267
                     /gene="ORF-1"
                     /locus_tag="SuHV1_gp02"
                     /db_xref="GeneID:2952514"
     TATA_signal     1584..1590
                     /gene="ORF-1"
                     /locus_tag="SuHV1_gp02"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    1616
                     /gene="ORF-1"
                     /locus_tag="SuHV1_gp02"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             1636..2259
                     /gene="ORF-1"
                     /locus_tag="SuHV1_gp02"
                     /function="possibly vesicular trafficking"
                     /codon_start=1
                     /product="type 2 membrane protein UL56"
                     /protein_id="YP_068319.1"
                     /db_xref="GI:51557485"
                     /db_xref="GeneID:2952514"
                     /translation="MPPQRARGAPPRRRGSDPPDPGSLAGRLSPGGRSGGGSRRTLSR
                     SSSLTSVASAPVETPVAAEALGLGAPGSRPPSYGDVVRAGPRPHRSPDTPLFARGPPP
                     SYSETLLFDPPAYAVTIPDPPAYEPTVIGPQPPRPRDWISSPSVVQPSLLGPFSQCLP
                     QLTCPDCRYPEDRPMVLVGFLWGGLLLLVGLVFLILLPVLRESVVFP"
     polyA_signal    2262..2267
                     /gene="ORF-1"
                     /locus_tag="SuHV1_gp02"
                     /experiment="consistent with mRNA size (sense unknown) in
                     strain Ka"
                     /inference="ab initio prediction:PolyADQ:"
     repeat_region   2320..2682
                     /note="17 copies of a 21 bp repeat plus a partial copy of
                     6 bp"
                     /rpt_type=direct
                     /rpt_unit_seq="ggggagatggggagaggagat"
     gene            complement(2725..7722)
                     /gene="UL52"
                     /locus_tag="SuHV1_gp03"
                     /note="core gene"
                     /db_xref="GeneID:2952515"
     gene            complement(2725..4890)
                     /gene="UL53"
                     /locus_tag="SuHV1_gp04"
                     /db_xref="GeneID:2952532"
     gene            complement(2725..3873)
                     /gene="UL54"
                     /locus_tag="SuHV1_gp05"
                     /note="core gene"
                     /db_xref="GeneID:2952533"
     polyA_signal    complement(2725..2730)
                     /experiment="consistent with mRNA sizes (sense unknown) in
                     strain Ka"
                     /inference="ab initio prediction:PolyADQ:"
                     /note="UL54, UL53, UL52"
     CDS             complement(2730..3815)
                     /gene="UL54"
                     /locus_tag="SuHV1_gp05"
                     /function="gene regulation"
                     /function="RNA metabolism and transport"
                     /note="RNA-binding protein; shuttles between nucleus and
                     cytoplasm; inhibits pre-mRNA splicing; exports virus mRNA
                     from nucleus; exerts most effects post-transcriptionally"
                     /codon_start=1
                     /product="multifunctional expression regulator"
                     /protein_id="YP_068320.1"
                     /db_xref="GI:51557486"
                     /db_xref="GeneID:2952533"
                     /translation="MEDSGNSSGSEASRSGSEERRPVRERLGSRPPERRPVRARLGAI
                     RRRRGGRGGRAARQALRQRRRQQQQQQRQQQHQRRRQEADRPDGGPDAPPDRLSESAR
                     AAVSATHARVGATRVNELFASARHDLSRPVFNDGFRAAGSSPWAAVLEFGAEQFTPDG
                     RRVTWETLMFHGADLHRLFEVRPHATEAARVLREMVLLNEGLTESLASADETLTWVKL
                     ILTKGLTLRTLDPIVATAGAVLQNLRLKLGPFLRCYLRDTPVDELVRRRRLRDVRCIV
                     TYTLVMLARIARVVERGSSCVLPEDLGDSPVPLEEYVPGACLGGIMDALDSHKTGCDA
                     PTCRLTCSYTLVPVYMHGKYFYCNHLF"
     misc_feature    complement(3841)
                     /gene="UL54"
                     /locus_tag="SuHV1_gp05"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(3867..3873)
                     /gene="UL54"
                     /locus_tag="SuHV1_gp05"
                     /inference="ab initio prediction:TRANSFACFind:"
     CDS             complement(3895..4833)
                     /gene="UL53"
                     /locus_tag="SuHV1_gp04"
                     /function="virion morphogenesis"
                     /function="membrane fusion"
                     /codon_start=1
                     /product="type 3 envelope glycoprotein K"
                     /protein_id="YP_068321.1"
                     /db_xref="GI:51557487"
                     /db_xref="GeneID:2952532"
                     /translation="MLLGGRPLHLLVLGVMGAYAGLGAYYATVARLPHPVVYAALPLG
                     EDAAGGAPDWEAFNATAIYVAPNETDALSPALRDRARVVYARRDCRAYLWDVHFRLAA
                     VAWLLYAAFVYARQERRMFGPFRDPAEFLTPEKYTLNYAASVLAATVIGCSYTKFAWY
                     MAELATRRAALSRDLREDPITLAHRHPTLIALILLELGLRLGARMALFTTLGVTRAPC
                     ALVFPLYARALVWIFVLAVGALELLAATLPHIARVSGATATPARSDGGRAALGVCGAC
                     CSTVLAGIFAKALYLCLLVGGVLLFLHYERHITIFG"
     sig_peptide     complement(4774..4833)
                     /gene="UL53"
                     /locus_tag="SuHV1_gp04"
                     /inference="ab initio prediction:SignalP:"
     mat_peptide     complement(3898..4773)
                     /gene="UL53"
                     /locus_tag="SuHV1_gp04"
                     /product="type 3 envelope glycoprotein K"
                     /inference="ab initio prediction:SignalP:"
                     /protein_id="YP_068395.1"
                     /db_xref="GI:51557561"
     CDS             complement(4788..7676)
                     /gene="UL52"
                     /locus_tag="SuHV1_gp03"
                     /function="DNA replication"
                     /codon_start=1
                     /product="helicase-primase primase subunit"
                     /protein_id="YP_068322.1"
                     /db_xref="GI:51557488"
                     /db_xref="GeneID:2952515"
                     /translation="MPPSMIRVLYATDGCAITYSLMLLTGQEPSGAVYVVSYAWDGAG
                     LDEAFSLPGERAEAELLARRPGVTFCLTGHVASVRVRPVFVAAATPAVVRALCRGEPL
                     AARDVLEAMDEAATFALHDGLIAALTMVLEQVRPRTGNAEYAPERPLRSIAVGRRGLT
                     SLFVHHETQTLAAFRRLYGNHNTPFWYVARFGPEEKTLVLATRLHLFHPRPAYDLRAL
                     KDLLLTYNPRVDPNPSGLDPAGLLSFAALSRFCCLSGYARGPAAAHAARYVDERVRAD
                     RAEMGVLRDYISHDRGSLKLPDREFVTYVYLAHFESFNRARLREHLDAVNVTDPAAPV
                     GRSPLGERAAAAFFRHVRAQLNIRDYVAQNVTPSVARLAPAMGAGYVEDRTYAALAAD
                     APRGLCDAAAGLARRVTAVEERLAPHGWVRAPDEEQQQPGADGAVLRRLLELAAAPGG
                     GRARTALGALLGLPDACPPAPVYRVELAHRRQAFAVLAGDAWGRATARRDAAPEMAAH
                     EPAAQMYVSRHEVFNARLAVTNIVLDVDFRLARPVPAGTLEAAMRGFRRAVLDALALL
                     FPEADGDWAAHPCYVYKSACPPGGALAAAAGSASAASSDDGLEEAPWDDDAALADFGA
                     APGDEDWADWDAGVPAEVYTCDDDEVGVGIGGAGGDPGASALVRAPVPADERPPCGCR
                     AKMGFRVCTPVPSPYAVAGADTVRGLARVLQQAVLLERDFIEPMGPYLQDFTFVDTGV
                     YAHGRSLRLPFFAKVDGGGCHGRLLPFGDAPPGFDDPRNFHFHARPAHAVTRVLHSLG
                     GEYESFFERKAARNREAFFARRTPLADMLRGLAVDAEDRRALEAFVADVAMAPVLRHL
                     DAHFNGRAHEYAGATAQRVVAKPDWVLFQLCGSARFSCLRARHARSPPARTFVALSVD
                     AHDRLCISLSQQCFATKCGSNATRTIFTAEVGQSCSSAGARCTSSSSG"
     misc_feature    complement(4859)
                     /gene="UL53"
                     /locus_tag="SuHV1_gp04"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(4884..4890)
                     /gene="UL53"
                     /locus_tag="SuHV1_gp04"
                     /inference="ab initio prediction:TRANSFACFind:"
     gene            7492..8438
                     /gene="UL51"
                     /locus_tag="SuHV1_gp06"
                     /note="core gene"
                     /db_xref="GeneID:2952534"
     TATA_signal     7492..7498
                     /gene="UL51"
                     /locus_tag="SuHV1_gp06"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    7522
                     /gene="UL51"
                     /locus_tag="SuHV1_gp06"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             7663..8373
                     /gene="UL51"
                     /locus_tag="SuHV1_gp06"
                     /function="virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL51"
                     /protein_id="YP_068323.1"
                     /db_xref="GI:51557489"
                     /db_xref="GeneID:2952534"
                     /translation="MLGGIFSGWCGRRGRGRAYEPPDELRLRESLAVLNVILPAPLAA
                     EDVMASAEAARRLARADTLARTYQACQRNLECLARHEASGDDGLDAVVAAHAANARRL
                     ADTCLAALMHLYLSVGAVDADTDDLVEQALRMTAESNVVMSDVAVLERTLGLARRRQP
                     APVRAAPAGLGLPVPAQPAPRATAARPAPPPPPEEAGEDEEGDRPEDDAAPLLPPRAP
                     AKTRPPEKARRLAEACKM"
     misc_feature    complement(7690)
                     /gene="UL52"
                     /locus_tag="SuHV1_gp03"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(7716..7722)
                     /gene="UL52"
                     /locus_tag="SuHV1_gp03"
                     /inference="ab initio prediction:TRANSFACFind:"
     polyA_signal    8433..8438
                     /gene="UL51"
                     /locus_tag="SuHV1_gp06"
                     /experiment="consistent with mRNA size (sense unknown) in
                     strain Ka"
                     /inference="ab initio prediction:PolyADQ:"
     gene            complement(8443..9458)
                     /gene="UL50"
                     /locus_tag="SuHV1_gp07"
                     /note="core gene"
                     /db_xref="GeneID:2952537"
     polyA_signal    complement(8443..8448)
                     /gene="UL50"
                     /locus_tag="SuHV1_gp07"
                     /inference="ab initio prediction:PolyADQ:"
     CDS             complement(8527..9333)
                     /gene="UL50"
                     /locus_tag="SuHV1_gp07"
                     /EC_number="3.6.1.23"
                     /function="nucleotide metabolism"
                     /codon_start=1
                     /product="deoxyuridine triphosphatase"
                     /protein_id="YP_068324.1"
                     /db_xref="GI:51557490"
                     /db_xref="GeneID:2952537"
                     /translation="MEESAGATSAQSAATSVSESPAEETILVCASEPVTVDGGRLLVC
                     RSPGPEGFYKVPLGLKVALPTGYAMLVAQRGGGRTTNGIVDAGFRGEVQAIVAPGRPR
                     AQFYCTPLRLAPGIATDVPFFEVFAPKRDEDAGYDIPCPRELVLPPGGAETVTLPVHR
                     TDGRHWAYVFGRSSLNLRGIVVFPTPWESGPCRFRIQNRGAHPVTLESGQRVAQLVLT
                     REPLGWITGRSPFPATPRAPMQHRPAWLFARDFVAPSSARGARGFGSTGL"
     gene            9015..10341
                     /gene="UL49.5"
                     /locus_tag="SuHV1_gp08"
                     /note="core gene"
                     /db_xref="GeneID:2952538"
     TATA_signal     9015..9021
                     /gene="UL49.5"
                     /locus_tag="SuHV1_gp08"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    9046
                     /gene="UL49.5"
                     /locus_tag="SuHV1_gp08"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     9174..9180
                     /gene="UL49.5"
                     /locus_tag="SuHV1_gp08"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    9204
                     /gene="UL49.5"
                     /locus_tag="SuHV1_gp08"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             9257..9553
                     /gene="UL49.5"
                     /locus_tag="SuHV1_gp08"
                     /function="virion morphogenesis"
                     /function="membrane fusion"
                     /note="complexed with type 3 envelope glycoprotein M"
                     /codon_start=1
                     /product="type 1 envelope glycoprotein N"
                     /protein_id="YP_068325.1"
                     /db_xref="GI:51557491"
                     /db_xref="GeneID:2952538"
                     /translation="MVSSAGLSLTLVAALCALVAPALSSIVSTEGPLPLLREESRINF
                     WNAACAARGVPVDQPTAAAVTFYICLLAVLVVALGYATRTCTRMLHASPAGRRV"
     sig_peptide     9257..9328
                     /gene="UL49.5"
                     /locus_tag="SuHV1_gp08"
                     /inference="ab initio prediction:SignalP:"
     mat_peptide     9329..9550
                     /gene="UL49.5"
                     /locus_tag="SuHV1_gp08"
                     /product="type 1 envelope glycoprotein N"
                     /inference="ab initio prediction:SignalP:"
                     /protein_id="YP_068396.1"
                     /db_xref="GI:51557562"
     misc_feature    complement(9427)
                     /gene="UL50"
                     /locus_tag="SuHV1_gp07"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(9452..9458)
                     /gene="UL50"
                     /locus_tag="SuHV1_gp07"
                     /inference="ab initio prediction:TRANSFACFind:"
     gene            9549..10341
                     /gene="UL49"
                     /locus_tag="SuHV1_gp09"
                     /db_xref="GeneID:2952503"
     TATA_signal     9549..9555
                     /gene="UL49"
                     /locus_tag="SuHV1_gp09"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    9579
                     /gene="UL49"
                     /locus_tag="SuHV1_gp09"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             9591..10340
                     /gene="UL49"
                     /locus_tag="SuHV1_gp09"
                     /function="virion morphogenesis"
                     /function="possibly RNA transport to uninfected cells"
                     /codon_start=1
                     /product="tegument protein VP22"
                     /protein_id="YP_068326.1"
                     /db_xref="GI:51557492"
                     /db_xref="GeneID:2952503"
                     /translation="MSSSRKTRVAADETASGARRRAGSASRTRTTAPAAATPRRPSAY
                     DDYDDGFSYRSAPSYDDDGYYGYDGYGSSRAPRAAKVTPAAASRASTGAKSASAAKTP
                     ASAAKTARSAPAAAPAATTTTTTTAAAEPAARRASTRAAPGENLDVGRRRLAFSDRPC
                     EANVPWRGATHAFNKRIFCAAVGRVAEAHARAAAESLWDMNPPTTDAALDRFLQAAVV
                     RITVCEGLDLIEAANAVLDESTPGRKGKVYK"
     gene            10332..16176
                     /gene="UL48"
                     /locus_tag="SuHV1_gp10"
                     /db_xref="GeneID:2952504"
     TATA_signal     10332..10338
                     /inference="ab initio prediction:TRANSFACFind:"
                     /note="UL48"
     polyA_signal    10336..10341
                     /experiment="consistent with mRNA sizes and sense in
                     strain Ka"
                     /inference="ab initio prediction:PolyADQ:"
                     /note="UL49.5, UL49"
     misc_feature    10366
                     /gene="UL48"
                     /locus_tag="SuHV1_gp10"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             10404..11645
                     /gene="UL48"
                     /locus_tag="SuHV1_gp10"
                     /function="gene regulation"
                     /function="virion morphogenesis"
                     /note="transactivates immediate early genes"
                     /codon_start=1
                     /product="transactivating tegument protein VP16"
                     /protein_id="YP_068327.1"
                     /db_xref="GI:51557493"
                     /db_xref="GeneID:2952504"
                     /translation="MRDEECVVAFDEALLGGAAPGRPPVVAVPRAASPDALYQRLISD
                     LAFDEGPALLGAMERWNEDLFSCLPGNEDLYARLVMLSASADEVAAQVRAPTADASVD
                     LGVPGAEPMPRVPAVEEELPAYVAAVERFFVSTLRAREERYARLLDAYCRAVLRYLHA
                     QARRDEGKLRQLVRGRYYRDVARLAPWLFLHLYVATARELSWRLHADQVVAQDVFMSL
                     RYEWDQARQLTCLFHPVLFNHGVVLLSGAPVPAAQLRAVNHRRRELGLPLVRAGLIEE
                     DGADLVEEPPFSAALPRAAGYLSHQVRIKMEAYSREYRDHTYCRPPSPVASYGSTAEA
                     LLPPPSPSAVLPCDPTPPARVSAAPLITTVTLAEAEEDGALTTAAPAAAVATATVASP
                     GPATPAYHLIPRDALNRMFEM"
     gene            11695..16176
                     /gene="UL47"
                     /locus_tag="SuHV1_gp11"
                     /db_xref="GeneID:2952518"
     TATA_signal     11695..11701
                     /gene="UL47"
                     /locus_tag="SuHV1_gp11"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    11727
                     /gene="UL47"
                     /locus_tag="SuHV1_gp11"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             11746..13998
                     /gene="UL47"
                     /locus_tag="SuHV1_gp11"
                     /function="possibly gene regulation"
                     /note="modulates transactivating tegument protein VP16;
                     RNA-binding protein"
                     /codon_start=1
                     /product="tegument protein VP13/14"
                     /protein_id="YP_068328.1"
                     /db_xref="GI:51557494"
                     /db_xref="GeneID:2952518"
                     /translation="MSDAGPVRRPRRSQEQRFQPFPRAGLLVHLQDVLVGEVRRPDFR
                     PPPDEESSEEEEPVWTDDEEEEEGGAEEERTSGGRRGGEEGDDDGDEEEEEEEEESEG
                     GAWSDGELYVAADGDAWDAEEEEDEDGDEDGDDDYDDDDDGYDGRGAAASRAAAGPPA
                     DVDYLSRALRGMETASGPDEREAFTRYAGTLYRRQFQPGRPGYRPPRPRDPPPPPPPR
                     ARPPTTATAAASTAAAHCGPARAADGDDSAPRLERDPDAAYASWTRDMPDGTFLAMPS
                     WVALRREPRGPPGRPVGPPDILRRAPRALTFTPQAASAALVSRDQDAWEALVPLHHLQ
                     MHSWGGSAPPSRGGVYATPAPETRGVWRRALRQAIALHHAMFLAPLQSSTVGAPALAG
                     EALAFALDAAARAAVNHDAAARELPERAARALRAVGRRAPAASGPRAGLFRAFCGSLA
                     YWPELRVLSGHPEDVRFAAFHLAVAEVYLLARAHGQNPGFTAEERELLAPMFTLTVLA
                     MHHALRWLTTAVARAVSDIPDDEAFRAVRSRVPASLVPLGSIALSDAEYAVLNATEVA
                     AARDATGLGQAVSLGYAAARSALTGLMRAHAGGSDALVAFALVLQRLAGHANLLLNCL
                     LGAAVHGGRTVRVYEAALDDYAELMDALDPLVRTCPLAEFWEQRDAVMRQLRLTAAPG
                     PPVGGKRLVIAPALPSEDLDGLVPPTAVRPAHLGPDVDLAEYAARHPELVGVPEPRAH
                     LSARRPPRGR"
     gene            13963..16176
                     /gene="UL46"
                     /locus_tag="SuHV1_gp12"
                     /db_xref="GeneID:2952519"
     TATA_signal     13963..13969
                     /gene="UL46"
                     /locus_tag="SuHV1_gp12"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    13994
                     /gene="UL46"
                     /locus_tag="SuHV1_gp12"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             14017..16098
                     /gene="UL46"
                     /locus_tag="SuHV1_gp12"
                     /function="possibly gene regulation"
                     /note="modulates transactivating tegument protein VP16"
                     /codon_start=1
                     /product="tegument protein VP11/12"
                     /protein_id="YP_068329.1"
                     /db_xref="GI:51557495"
                     /db_xref="GeneID:2952519"
                     /translation="MLRRARGTRRASWKDASRRVTEGRTRASCLLAAPGEVLTAAVAA
                     LRDVAESQCAPALFGAQRASALALVRSNYAPESVITACSAEPHREVYARAADAALKGI
                     TADVAWRAVLATYWRYLKASSGVEVRSDDERDAPTVMLLWSTFGKPLSKHPFKHKAQS
                     AAYGATRAALAEATEAVERYAYYMRPLDPMVSSPQTSVRLHEMLAYAATLYRWLLWMM
                     DTVDARVVRHLGRTPRVARGPRETMSPEALFGRHRAGGPAVASGSGEVLVLTSHTATV
                     FDALEILGATWAETPWKSGVCGLTAAVVAAVDLVTFVHHHAQTLINLTLAGYVCWLDD
                     GMEDPYLRAALRAQCRFHHLIGDLAPTSSSHAWGAMERGTLAWFNYAIARSLASYGGP
                     TERFARVLATTGQRDMRFLSVAPAQPPLPPLPRASQTPSPPPRDRDAEPPHEYVDPFA
                     EYLNWPVPVSPPPLPEGPPSSDDELEVDGGGRRPLRRSRDAATYVNRKDLAPPRAAAG
                     EGEGDDEEEEEDDRFPRRDGDAGASTSSSQESAADEEFPPGIGVRDGEEDDEDEGVEE
                     EDVYVDPDGDGERGAGGGHDDDAPWAPLTRHGSMRTSFRRGVRGSFRAAQRFVRRRLS
                     RTSAEATPRAPVDSAAAPATPAVPAQGETDHVYQHPRPRTRADDGLYQHPRPVIDLTG
                     HRASRRKSWRV"
     polyA_signal    16153..16158
                     /experiment="consistent with mRNA sizes and sense in
                     strain Ka (UL48, UL47)"
                     /inference="ab initio prediction:PolyADQ:"
                     /note="UL48, UL47, UL46"
     polyA_site      16176
                     /experiment="S1 mapping in strain Ka and cDNA sequence in
                     strain TNL (UL46)"
                     /note="UL48, UL47, UL46"
     repeat_region   16212..16802
                     /note="39 copies of a 15 bp repeat plus a partial copy of
                     6 bp"
                     /rpt_type=direct
                     /rpt_unit_seq="gggacggaggggaga"
     misc_feature    16808..21988
                     /note="derived from strain Be"
     gene            complement(16808..21741)
                     /gene="UL28"
                     /locus_tag="SuHV1_gp13"
                     /note="core gene"
                     /db_xref="GeneID:2952557"
     gene            complement(16808..19722)
                     /gene="UL27"
                     /locus_tag="SuHV1_gp14"
                     /note="core gene"
                     /db_xref="GeneID:2952558"
     polyA_site      complement(16808)
                     /experiment="cDNA sequence in strain TNL (UL27)"
                     /note="UL27, UL28"
     polyA_signal    complement(16830..16835)
                     /experiment="consistent with mRNA size and sense in strain
                     Ka (UL27)"
                     /inference="ab initio prediction:PolyADQ:"
                     /note="UL27, UL28"
     CDS             complement(16854..19595)
                     /gene="UL27"
                     /locus_tag="SuHV1_gp14"
                     /function="cell entry"
                     /function="cell-to-cell spread"
                     /note="possible membrane fusogen; binds cell surface
                     heparan sulphate"
                     /codon_start=1
                     /product="type 1 envelope glycoprotein B"
                     /protein_id="YP_068330.1"
                     /db_xref="GI:51557496"
                     /db_xref="GeneID:2952558"
                     /translation="MPAGGGLWRGPRGHRPGHHGGAGLGRLWPAPHHAAAARGAVALA
                     LLLLALAAAPPCGAAAVTRAASASPTPGTGATPNDVSAEASLEEIEAFSPGPSEAPDG
                     EYGDLDARTAVRAAATERDRFYVCPPPSGSTVVRLEPEQACPEYSQGRNFTEGIAVLF
                     KENIAPHKFKAHIYYKNVIVTTVWSGSTYAAITNRFTDRVPVPVQEITDVIDRRGKCV
                     SKAEYVRNNHKVTAFDRDENPVEVDLRPSRLNALGTRGWHTTNDTYTKIGAAGFYHTG
                     TSVNCIVEEVEARSVYPYDSFALSTGDIVYMSPFYGLREGAHGEHIGYAPGRFQQVEH
                     YYPIDLDSRLRASESVTRNFLRTPHFTVAWDWAPKTRRVCSLAKWREAEEMTRDETRD
                     GSFRFTSRALGASFVSDVTQLDLQRVHLGDCVLREASEAIDAIYRRRYNSTHVLAGDR
                     PEVYLARGGFVVAFRPLISNELAQLYARELERLGLAGVVGPAAPAAARRARRSPGPAG
                     TPEPPAVNGTGHLRITTGSAEFARLQFTYDHIQAHVNDMLGRIAAAWCELQNKDRTLW
                     SEMSRLNPSAVATAALGQRVSARMLGDVMAISRCVEVRGGVYVQNSMRVPGERGTCYS
                     RPLVTFEHNGTGVIEGQLGDDNELLISRDLIEPCTGNHRRYFKLGSGYVYYEDYNYVR
                     MVEVPETISTRVTLNLTLLEDREFLPLEVYTREELADTGLLDYSEIQRRNQLHALKFY
                     DIDRVVKVDHNVVLLRGIANFFQGLGDVGAAVGKVVLGATGAVISAVGGMVSFLSNPF
                     GALAIGLLVLAGLVAAFLAYRHISRLRRNPMKALYPVTTKTLKEDGVDEGDVDEAKLD
                     QARDMIRYMSIVSALEQQEHKARKKNSGPALLASRVGAMATRRRHYQRLESEDPDAL"
     sig_peptide     complement(19419..19595)
                     /gene="UL27"
                     /locus_tag="SuHV1_gp14"
                     /inference="ab initio prediction:SignalP:"
     mat_peptide     complement(16857..19418)
                     /gene="UL27"
                     /locus_tag="SuHV1_gp14"
                     /product="type 1 envelope glycoprotein B"
                     /inference="ab initio prediction:SignalP:"
                     /protein_id="YP_068397.1"
                     /db_xref="GI:51557563"
     CDS             complement(19466..21640)
                     /gene="UL28"
                     /locus_tag="SuHV1_gp13"
                     /function="DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 2"
                     /protein_id="YP_068331.1"
                     /db_xref="GI:51557497"
                     /db_xref="GeneID:2952557"
                     /translation="MAERRLVAVLGQVQTYVFQLEMLKRCDPAVVRELAPRVKLNALM
                     CRYLARRLPLEAQTTPLTCALRLALAYARAEGDRVLGALAAAGDDAEAYFERTMGGAC
                     RFHARVALDTYGGRVETELQFLHDAENLLKQLNYCHLITPHAVDLSAVDEFLARTIGG
                     GLVVPPELYDPAQPCAVCFEELCVTANQGEATHRRLLGCVCDHLTRQLAVRVDPEDVA
                     KNLPHVHGLDEARRGRALAALAAVDAAEAREAEAASTAAAGAEAGDAGETARRRADAL
                     LDAHDVFRPASRRLYAVSELQFWLASTNQAVRALDLFTHNLDDLERRERRAEVRAAAV
                     ELALFGRRPEHFDRARAARELDIIDGLLVGGCAASPDERLEALIRACYDHHMSTPMLR
                     MLDPDRANRDALERLLEGGDDADADGGAAGGADAGDGGVGDEDGPGAPPPADAVAWAD
                     LPAAALRDAERRRRLYADRLSRRSAASLAQCVREQRRELEKTLRVNVYGDALLHTYVA
                     VAAGFRARRAFCEAAARAGTVVDERETGCFDAHSFMKATVQRHPVDAALLPAVTRKFF
                     ELVNGPLFAHDTHAFAQPPNTALYFAVENVGLLPHLKEELARFMVARDWCVSEFRGFY
                     RFQTAGVTATQRQAWRYIRELVLAVAVFRSVFHCGDVEVLRADRFAGRDGLYLTYEAS
                     CPLVAVFGAGPGGIGPGTTAVLASDVFGLLHTTLQLRGAPSR"
     misc_feature    complement(19691)
                     /gene="UL27"
                     /locus_tag="SuHV1_gp14"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(19716..19722)
                     /gene="UL27"
                     /locus_tag="SuHV1_gp14"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    complement(21713)
                     /gene="UL28"
                     /locus_tag="SuHV1_gp13"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     gene            complement(21714..25518)
                     /gene="UL29"
                     /locus_tag="SuHV1_gp15"
                     /note="core gene"
                     /db_xref="GeneID:2952495"
     polyA_site      complement(21714)
                     /gene="UL29"
                     /locus_tag="SuHV1_gp15"
                     /experiment="cDNA sequence in strain TNL"
     TATA_signal     complement(21735..21741)
                     /inference="ab initio prediction:TRANSFACFind:"
                     /note="UL28"
     polyA_signal    complement(21736..21741)
                     /gene="UL29"
                     /locus_tag="SuHV1_gp15"
                     /inference="ab initio prediction:PolyADQ:"
     CDS             complement(21788..25315)
                     /gene="UL29"
                     /locus_tag="SuHV1_gp15"
                     /function="DNA replication"
                     /function="possibly gene regulation"
                     /note="contains a zinc-finger"
                     /codon_start=1
                     /product="single-stranded DNA-binding protein"
                     /protein_id="YP_068332.1"
                     /db_xref="GI:51557498"
                     /db_xref="GeneID:2952495"
                     /translation="MEAAAKTVTVRAAPLGYVYVTPIEALRRDLLALLVARSADDAAA
                     VAPLVRGLTVEAGFAGHVAVVAGARTTGLGGGLTLKLTPNHFHPNVFFFHNGDCVPPS
                     SAAPALSRACEAARARFGFSAYRTPVDNAEETTGAEVCARLGLAADAHAAYLVVADGF
                     KEAVYLCNAFLHYGGAGTVSINGHEAWRVPLYPVHLFMPDVNRLVADPFNAKNRSISE
                     EFVYPRPFFNGPLCRLLHGYVLGPAAVATRVRNLDAVARGAAHLAFDENHESAVLPAD
                     VTFTLFEQRRRGGDAAAGGLERRMASVMSADAALSLEALVAAGVYDEEPPALDDWPVL
                     SEAGAKDGGAAAASAGAPVSQAAALGAYVSRAAGLVGALVFSSNSVLYLTEVDDAGAA
                     DARKEGAGPSFNRFYQVAAPYLAGNPQTDKDGRVLLHTASQPATAPGNHDFAMDHLVM
                     ACGFCPQLLARVLFYLERCDAGTFVGRGDVDAVRYVAGSLDAEVPCSLCDRASRPACA
                     HTTLHRLRHRSRASARRRSPMGVFGTMNSAYSDCDVLGNYASYGALKRPNDSEPPKAI
                     MQDTYRAAVDRLLADVAGARIGETVTDHAGFRHALRALRDTVEQAADRFVRTLVETRD
                     FKLRDALYDANHTMSLSLDPYSGALCPATSFLARRTLLAVLQDLALSQCHGVLHGQPV
                     EGRNFRNQFQPVLRRRVVDMLNGGFVTAKTVTVTLADGIVAPDPTKGSAEPPARDHDG
                     DLARVSFEVLRELRVKSRVMFSTGSGSLSDAARARVAGLAGAYQRPDTAVDVLNGPLG
                     FLLKQHHATLFPRGKPPGGQSPNPQWFWTLLQRNQLPARLLTKDDIETIAAVKRFSVD
                     YGAINYVNLTPGTVAELAQFYLANLILRYCDHKQFFINSLTGITMQSKRPRDPAAVMA
                     WVRRPLADAADAERAAREVLDAPRDDTWVATYTSSHLLRSVMASRPLVVLGLGVSKYH
                     GMAGNNRVFQAGNWSGLNGGKHVCPLMVFDRTRHFVLACPRVGFTCSQTGGGAGLHDH
                     SLGEHVKTILADGGPLVQTAVYAAVLHALGARTQHLEPDDWRAIVDDEFLAAALAEIN
                     GRVADRDGRWSVEAAAELVRDLEGQTGADGGEETAFDFGACGAGGDVAGLAPASLVPA
                     ELGGKRPPPEDDLFDMGAPPEKRLTFDML"
     misc_feature    21966..25668
                     /note="derived from strain TNL"
     misc_feature    complement(25488)
                     /gene="UL29"
                     /locus_tag="SuHV1_gp15"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     gene            25512..28773
                     /gene="UL30"
                     /locus_tag="SuHV1_gp16"
                     /note="core gene"
                     /db_xref="GeneID:2952496"
     TATA_signal     25512..25518
                     /gene="UL30"
                     /locus_tag="SuHV1_gp16"
                     /inference="ab initio prediction:TRANSFACFind:"
     TATA_signal     complement(25512..25518)
                     /inference="ab initio prediction:TRANSFACFind:"
                     /note="UL29"
     misc_feature    25544
                     /gene="UL30"
                     /locus_tag="SuHV1_gp16"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     misc_feature    25606..52782
                     /note="derived from strain Ka"
     CDS             25606..28752
                     /gene="UL30"
                     /locus_tag="SuHV1_gp16"
                     /EC_number="2.7.7.7"
                     /function="DNA replication"
                     /codon_start=1
                     /product="DNA polymerase catalytic subunit"
                     /protein_id="YP_068333.1"
                     /db_xref="GI:51557499"
                     /db_xref="GeneID:2952496"
                     /translation="MAARQGSYVTRLSEFKFIAPRCLDAPEQRGVHVGTLAREPTVYC
                     GGATRPILRGEPFWPRRVAAWEGAPERPVSPRFERFHVYDIVESTEYASADPRFPNGT
                     VVTLLGLSACGKRVAVHVYGVRHYFFLGKAEADAALGVASAEQLARALSAAAARGPRL
                     GPADVDARVVDAAPVYYYDAPRRPFYRVSSNSGRLVAHLRETVCAGLVTHEAGVDATT
                     RLLLDHDLPSFGWYRLRPGPAGERVVLRHQRLTSSDVEVNCTPLNLARDEDGPWPDYK
                     LLCFDIECKAGDDAAFPAAENPEDLVIQISCLLYSLATQRLEHTLLFSLGSCDSDDPA
                     VTVLEFDSEFELLLAFVTFLKQYAPEFATGYNIINFDWAFVHTKLTTVYGLALDGYGR
                     FNRGGQFRVYDAGQNSFQKRSKVKINGLVSLDMYAVAADKLKLPSYKLNAVAEEALGE
                     RKLDLDYKDIPRYYAAGPRERGVIGRYCVQDSALVGKLFFKFLPHLELSAVARLANIT
                     LARAIYDGQQIRVFTCLLKLAGSRGFVLPDKRRAIADEDDGGGYQGAKVLEPDSGFHV
                     DPVLVLDFASLYPSIIQAHNLCFTTLALARPAGLREDEFSAFEVNGERLYFVHAGVRE
                     SLLSILLRDWLAMRKAIRARIPTSAPEEAVLLDKQQAAIKVVCNSVYGFTGVANGLLP
                     CLPVAATVTTIGRDMLVATRDYVQTRWATRELLERDLPARPPAGEYAVRVVYGDTDSV
                     FIRFSGIAYDDVCELGELMAARITRDLFRPPIKLECEKTFRRLLLITKKKYIGVINGG
                     KMLMKGVDLVRKNNCAFINAYARRLVDLLFGDEAVSAAAATIARAPAARWLERPLPRG
                     FAAFGRVLAEAHARVAGGAGLDVADFVMTAELSRPPDAYSNTRLPHLTVYHKLAMRHG
                     EVPSVKERVSYVIIAPTPEAERDAGAVRPGLAPGKLLVSDLAEDPAYVVAHGVPLNTE
                     YYFSHLLSTLSVTFKALFGNDTKITERLLKRFIPETAPGDAPFEHEAFAALTGEGGES
                     LQTLRTIFCTPTAAPRRS"
     gene            complement(28599..31240)
                     /gene="UL32"
                     /locus_tag="SuHV1_gp17"
                     /note="core gene"
                     /db_xref="GeneID:2952497"
     gene            complement(28599..29614)
                     /gene="UL31"
                     /locus_tag="SuHV1_gp18"
                     /note="core gene"
                     /db_xref="GeneID:2952498"
     polyA_site      complement(28599)
                     /experiment="cDNA sequence from strain TNL (UL31)"
                     /note="UL31, UL32"
     polyA_signal    complement(28615..28620)
                     /inference="ab initio prediction:PolyADQ:"
                     /note="UL31, UL32"
     CDS             complement(28673..29488)
                     /gene="UL31"
                     /locus_tag="SuHV1_gp18"
                     /function="nuclear egress"
                     /note="interacts with nuclear egress type 2 membrane
                     protein"
                     /codon_start=1
                     /product="nuclear egress lamina protein"
                     /protein_id="YP_068334.1"
                     /db_xref="GI:51557500"
                     /db_xref="GeneID:2952498"
                     /translation="MFERRRLLRRKSSAARRKTLTRAARDRYAPYFAYAAAQPSDEVT
                     TVRGLSNPLIKTAPVTLPFDLGQAVADNCLSLSGMGYYLGLGGCCPTCAAAEPRLGRS
                     DRAALVLAYVQQLNSIYEYRVFLASVAARDPSERALEEVLAHPELFFAYYVLRDGGLR
                     DVRVLFFEDPDAQGALMMYVVFPEKSVHVHHRVLDRLLGACAGHRIVAHVWQTMFVLV
                     VRKKGDGRPADDVPAVSASDIYCKMRDISFDGELLLEYKRLYAAFEDFRPPRP"
     polyA_signal    28768..28773
                     /gene="UL30"
                     /locus_tag="SuHV1_gp16"
                     /inference="ab initio prediction:PolyADQ:"
     CDS             complement(29481..30893)
                     /gene="UL32"
                     /locus_tag="SuHV1_gp17"
                     /function="DNA encapsidation"
                     /function="possibly capsid transport"
                     /codon_start=1
                     /product="DNA packaging protein UL32"
                     /protein_id="YP_068335.1"
                     /db_xref="GI:51557501"
                     /db_xref="GeneID:2952497"
                     /translation="MGWSEDAFEAPYTAFDPALLTKNDALFRELIFAAHVMLDEEDSP
                     AGFVEAAAAPLALDEPCRVCRTIDVYRRERSLAPPWLADYAALCAKALACPPCATAVF
                     VAAFEFVYVMDKHFRGRASLQRAFATRVLTLVDVQRHFFLHGCFRTVGDKIRFSNQSF
                     LVQAATRAMFFTVADARAPPSLGGWKDHTGDDACAGCCAAAEREDDAYERAAVAAATG
                     GGAADADAAGPGYADLAMLLLGNVATGEPNAQTDAAEERRHRAVDEYWAEHEGFLARN
                     TAAAYARYRAVDATLGPVLALALKHVRGRNRTHGECLLCNMLLTRAHWLALRRFRRGV
                     LSYSENNAGLFDCIEPVLEGFVADARFLALMRAAGPRAVYKHLFCDPLCAVAERQADP
                     RVLFERGDALRKAQIAAENRFEGRVCGELWTLAYVFKAYQLFPPKPTARAAFLRDAHA
                     LLRRHGLALVSLEHTLGSYV"
     misc_feature    complement(29584)
                     /gene="UL31"
                     /locus_tag="SuHV1_gp18"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(29608..29614)
                     /gene="UL31"
                     /locus_tag="SuHV1_gp18"
                     /inference="ab initio prediction:TRANSFACFind:"
     gene            30892..32571
                     /gene="UL33"
                     /locus_tag="SuHV1_gp19"
                     /note="core gene"
                     /db_xref="GeneID:2952545"
     CDS             30892..31239
                     /gene="UL33"
                     /locus_tag="SuHV1_gp19"
                     /function="DNA encapsidation"
                     /note="interacts with DNA packaging terminase subunit 2"
                     /codon_start=1
                     /product="DNA packaging protein UL33"
                     /protein_id="YP_068336.1"
                     /db_xref="GI:51557502"
                     /db_xref="GeneID:2952545"
                     /translation="MARGGGGAAVDLRAAIPEAALRDFDVDFLEANYLPPRVRVWFED
                     VMPRELEVILPTTDAKLNYLAHTQRLAAATSERDCAHGEALRARRDRFAAAVNKFLDL
                     HQVLRDGVELGAL"
     misc_feature    complement(31212)
                     /gene="UL32"
                     /locus_tag="SuHV1_gp17"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(31234..31240)
                     /gene="UL32"
                     /locus_tag="SuHV1_gp17"
                     /inference="ab initio prediction:TRANSFACFind:"
     gene            31235..32571
                     /gene="UL34"
                     /locus_tag="SuHV1_gp20"
                     /note="core gene"
                     /db_xref="GeneID:2952546"
     TATA_signal     31235..31241
                     /gene="UL34"
                     /locus_tag="SuHV1_gp20"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    31275
                     /gene="UL34"
                     /locus_tag="SuHV1_gp20"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             31398..32186
                     /gene="UL34"
                     /locus_tag="SuHV1_gp20"
                     /function="nuclear egress"
                     /note="interacts with nuclear egress lamina protein"
                     /codon_start=1
                     /product="nuclear egress type 2 membrane protein"
                     /protein_id="YP_068337.1"
                     /db_xref="GI:51557503"
                     /db_xref="GeneID:2952546"
                     /translation="MSGTLVQRLKLILSGGNLRCSDGETACDPERPPTRCVFQVHGQD
                     GSNDTFPLEYVLRLMRSWAHVPCDPYVRVQNTGVSVLFQGFFFRPADAPLAAITAEHN
                     NVILASTHSTGMSLSALDDIKRAGGVDTRPLRAMMSVSCFVRMPRVQLSFRFMGPDDA
                     SQTQRLLDRAEMRQRSVSRPGGGAGGGDDGEGPSPRAPIRPTVISPVPGHAAAAFVGQ
                     AAYPPPARFPASLLHTLLGLRRLAGYAVACVTGALAIVIILNMR"
     gene            32182..32571
                     /gene="UL35"
                     /locus_tag="SuHV1_gp21"
                     /note="core gene"
                     /db_xref="GeneID:2952490"
     TATA_signal     32182..32188
                     /gene="UL35"
                     /locus_tag="SuHV1_gp21"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    32213
                     /gene="UL35"
                     /locus_tag="SuHV1_gp21"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             32241..32552
                     /gene="UL35"
                     /locus_tag="SuHV1_gp21"
                     /function="capsid morphogenesis"
                     /function="possibly capsid transport"
                     /note="located externally on capsid hexons"
                     /codon_start=1
                     /product="small capsid protein"
                     /protein_id="YP_068338.1"
                     /db_xref="GI:51557504"
                     /db_xref="GeneID:2952490"
                     /translation="MSFDPNNPRTITAQTLEGALPVDILLRLNRATGLQMDAAEAHAI
                     VEDARRTLFIGTSLALVNLRHAHDKHLVERQPMFATSDYSSWARPTVGLKRTFCPRPP
                     P"
     polyA_signal    32565..32571
                     /experiment="consistent with mRNA size and sense in strain
                     Ka (UL34)"
                     /inference="ab initio prediction:PolyADQ:"
                     /note="UL33, UL34, UL35"
     repeat_region   32674..32881
                     /note="21 copies of an imperfect 8-11 bp repeat plus a
                     partial copy of 5 bp"
                     /rpt_type=direct
     gene            complement(33056..42314)
                     /gene="UL36"
                     /locus_tag="SuHV1_gp22"
                     /note="core gene"
                     /db_xref="GeneID:2952494"
     polyA_signal    complement(33056..33061)
                     /gene="UL36"
                     /locus_tag="SuHV1_gp22"
                     /inference="ab initio prediction:PolyADQ:"
     CDS             complement(33060..42314)
                     /gene="UL36"
                     /locus_tag="SuHV1_gp22"
                     /function="capsid transport"
                     /note="complexed with tegument protein UL37;
                     ubiquitin-specific protease (N-terminal region)"
                     /codon_start=1
                     /product="large tegument protein"
                     /protein_id="YP_068339.1"
                     /db_xref="GI:51557505"
                     /db_xref="GeneID:2952494"
                     /translation="MTADAVVVGYRNQYDPDLGPGSGVSCLRSSLSFLRLVFTNGVEA
                     ALTADAVDACLREGQAWTGPGGGMCAISELPNKIVYEGAGGAALHCVFSRVHGECNFF
                     TPPAEGFQSTQITARAFFDGLWAQRAESFTLVVVGAVGLGLYRRGDVVYVFDPHGHGQ
                     ITQAFVARLRPADVYAHVAGYAASELRWAGAFVFFLPHDQFAAVPALYGVGETYLVDE
                     PYVERAVPSVHPMALPPDPAAAAPPTRGPGAIPVLAVAPVPAVPVSAAAAPAPAPGGA
                     PLPPPPRVQKRPSMPKRRRPPWPASQEDLSSTHTVGGRPSRKFRPRTREPMGFAVREL
                     ELAPLDLGPLQAHADELEEHVVACAGRSLFPGRAGLLERFAELLFGHLQDFLVENGAR
                     THGEAPCAVAALFEPILGALPERGPAGDFVAATHMVLTEARALLDVAGDDASAPVAKL
                     ALVAARVARPANEAMHRALDALESGGSYAQLSACFMDAAARDPGGVYDQTVVARARAL
                     FARARARESRESQRALERARDVSALEAALEAAHANFDAVDAGAPGAGGAAEPNTRDVK
                     ERAAKLPRKLALMVGDAIREYFLRGAQYSAKAMLMDRNGAQRFRVANAAVAGLRRLVD
                     SLAAAEERLRALDAAPAAHDGALLAQLLEAGEDVSTDERLGAWFALLAEAQAHGHLER
                     RELDTLTRDVTQINERAAKRASADADLARFDAMDAALAAAPDEETRVRAMEDLLRHIR
                     AMGGHVLSQETRARLARRDAELRTLVQAAQQRAAEQNDLYMRLRALLGDFATLGPAVD
                     LLAHITATPVPGTVLAALWRLVARYRELLTSDPGALVGAGQPLGALVNALADNPPITR
                     FFLAHADAVAAALADADTAEKAARAAGVLRAAVEHPELGFLEPLARQCEERAAALRES
                     ERVAALQAALSAAVAAAVEMLGRLRAQPDEGTLVEARHLALEVARAAAVEEPQLQKMA
                     LAARQRVGELEAAVAAVEARRAAEVERAQRQLWARAADAALRRAEQHAFDAAEFVRLR
                     DVAADRGYDAAELRPAAERALGANAETVTTALDAVFAFNPHLPENAGAAAGPPLQALQ
                     RLTWLDDYAVAAPVIGSLFGADTEPLSRLARIAGGVLARAAAGMGRFSYYDAVGFVGA
                     DMAHVPRLAKYVDFYRRGFPEYEAELAALGARRADVLQAGGSRGAEICRALEEVTYVR
                     AAADAARALDEGVHLHVPSTELLRGAVTYLERFDFARFERTAYAEAMRALVRRDLAAA
                     RDGLAAAEADQAAATERATRLLREVVDAAAARDRDGALELANLKNLLRVTPPPASLNI
                     DRAASAEELVTQAALLLGAVEEAPELDVQAVEWLHQARLIIDTHPLTTRVDGRGPMDE
                     FAERIEALQTLRQEADTLRQRLTAAEVAWDEAWEDFGRARGRAGASEDEAPLAEARAR
                     ALQTATMEVLALRSDAVYPRLPAKFVGRIESKYSARAGALGDFFRDAGAVEEDVRELD
                     RMAARIGPELRHDALRALAAAFDARAERLPRWIPPKYAAYRELLTLRLQFYAAYGGAG
                     PTPARPRASTAPCARLKQRVAARLGDRDVICTVREARSDADAVFPTVFLDDNNVPVEY
                     QVCYRAVGDKLAAMLCTDEGAELRPPLTEGLMETATVAGMRLMNEIIHLRLNYEKARD
                     TGFATFARFVRHRRADWDSAAKAAAETYAAVLATTLSRTFGALDRVAHPPLEPAVRLA
                     LPDLMVAAVAGEPTHLFNFTRVDLAGQHEYMAKTLDAVLDRALDAVDTLDAGARPPRR
                     PLRDGQALFTLRVADWTEGRFSETELWAPWAHTETGQRLARAVPGALATFTVLARMCI
                     PPRLLSALWSALQPEANAAYDAAVTERLDAAAHVREAAALGAPGAGDLYAPVGTGMTF
                     TVTGSPPSSATRVSAMDLAAAAVLVGAPLVIAMENLDVYSPGSGLTLAVTLCDLRDPA
                     LHRGVSTDLSSWGERLLALDDNPIENACLAPQLERLSALIAARPLAGEPACLVLVDSQ
                     LAVSRVLWAPPEPPRRPGFTLEDDPLLREIPFLETTEDQLPEMDPADPLFTSIIMGDA
                     RVDPATSEELYGRPSFRNLGDPFPYAVSATPTRPAAPIPGLPPELAGEDDGFVPDDDF
                     GANPWLDLLGDDLVASALPLPPSPPVDPPTLPPLAPAAPPAPPPAKPAELTPAAKLAP
                     PAPPPAKPVETTPLTKPQPQPQQGPPAAHKKPAAGTKAAAAPKQQPREPAPKPHSSPR
                     KIQPSLKARIEPPPPVINPPYPATAPAPETAPPEAPQAQPPAAAKPTPQPQGPPPPPQ
                     PPSAQAPPAQKPPAQPATAAATTAPKATPQTQPPTRAQTQTAPPPPSAATAAAQVPPQ
                     PPSSQPAAKPRGAPPAPPAPPPPSAQTTLPRPAAPPAPPPPSAQTTLPRPAPPPPSAP
                     AATPTPPAPGPAPSAKKSDGDRIVEPKAGAPPDVRDAKFGGKVAGAASPGRPLDDERY
                     KAGRADKCEHTVGPDQHRTRSPPGTSDSEPASASSSAASTPSREAASSSSSPAGTPSD
                     GARGGPPSAAGAAARAPPGAPGSGGQRRGDGGPAADASRGDQPAGHLPAAPVAQPLPS
                     AVLRTKARTSVGIRDHSRRKSMALVPRRPVSAPRQTGGLPPAAQPEGRPPGGLEPRPP
                     QAQAQAPATAPTGPPAAAAAAATAAVPAPGVGPGGPVRRAAGPRPPAGHLRLHIPPPQ
                     PVQLEGVVVPLPASPETPAPAQTQPPRSPLAAPTSLAAPSEIERPAASAAAAAAATTT
                     TTSSSSATTSSAPAAPPPAPPPSRPAAPPPAPPPSRPAPTPERHGEPPRLMFTPPPLP
                     PQPSQQRPPEAPWTWPEPRDSAGPPALFTPPPSDPPVQFPGREEPPLPPPPPPQPLWA
                     SEGEAETPATPLRSPLERMPWPPPLEAPGTTPELPPEFAPPAPRSPLADPHQPPAWFD
                     DLTALVPPAHPPPRRQQQRPPPPASPLGGLGRVWPTREDLTREPAEEAPELDPWGLED
                     EEGDEDGDEDVSLAQELLPPRVVESDTLINRRYMRATGLGALALLIAACRLIARRLRE
                     TRTTLKGSARRFNVDLFQVRLILG"
     gene            complement(42351..45251)
                     /gene="UL37"
                     /locus_tag="SuHV1_gp23"
                     /note="core gene"
                     /db_xref="GeneID:2952491"
     polyA_signal    complement(42351..42356)
                     /gene="UL37"
                     /locus_tag="SuHV1_gp23"
                     /experiment="consistent with mRNA size and sense in strain
                     Ka"
                     /inference="ab initio prediction:PolyADQ:"
     CDS             complement(42352..45111)
                     /gene="UL37"
                     /locus_tag="SuHV1_gp23"
                     /function="virion morphogenesis"
                     /note="complexed with large tegument protein"
                     /codon_start=1
                     /product="tegument protein UL37"
                     /protein_id="YP_068340.1"
                     /db_xref="GI:51557506"
                     /db_xref="GeneID:2952491"
                     /translation="MEALVRALEEADHAVATVVQSRILEFFMAAGRETPAGVRGLWAR
                     ALRLACRAYVETGTCEAAVLAENLAGLALWRLRHDWDEGTAPLLELLGVVNGDDTTAA
                     LTEAGLRTSAEFGPDAMFRLVSEWCAAFDEALAGARSADDVLAAPRVVPPEQTARALV
                     QPRFATLYDMDFVQDGLRYVAQHTNWALPLALAVRQMQNEGLKPLTRALFALTIADEF
                     FHDRQNPTLREQFAEAARAVDEAALVPVGEVNATPRTAVEVRVSAALAHGDAYVRELR
                     PGTVARRLRTDQGVLALLDPGAQAVHVAAAADLDHTQVDATGVWEAVQASASPLQVVE
                     ALVTAGFTRRHCDLLERAVLDRAPRLTDAQRAVGCTAVVGGVVHRLLDDYGPGLDYVR
                     AYTDVADTLEPLYGDVTAALGLPEKGVEHVVRHCMAPRPPTEHVGAARAALLREVAAA
                     ERRAGLAHSAAREALNTWLAFRAQSRWGLRADGAGETPMEAPTSAALVDLAAAADLVN
                     YPSMVHLEAMADPSFAPFFVVTAVADAYNCLLTASYDRRADLAQVLTWARDYGAGLIP
                     NVSGYRTKLAALVAALAREDLTVAHARNVEALAHELHGVVRAAAEVLEAPAPAPPSLA
                     ASAFLGDLLARALRRRLEDMATHTGDLLDSMATAAGAVAERVVALERLFTCRFVFRGR
                     TASVFAPGEGGPCLGTWRLADVVDAVGAFRAEVNTHRSDMRADAGALRGVMAQTTEAL
                     RECEALGLQAPVFRTLCADHARLSKLQTSAALTAGRLQAATVLRPVERFLARWDLVSA
                     ALRRAVDERGVLALVATLRETWTEAREEQAPPAPAFTPEELREAADRVLGDYHEVAGD
                     GEAGPDAVPLSASVNVRDWAAVNLEVLRRGARAPDDASAGVPLLAQTWVPVDRLLAEV
                     DAVSK"
     misc_feature    complement(45087)
                     /gene="UL37"
                     /locus_tag="SuHV1_gp23"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site; would generate an
                     N-terminally truncated translation product"
     misc_feature    complement(45099)
                     /gene="UL37"
                     /locus_tag="SuHV1_gp23"
                     /experiment="approximation (+/- 10 nt) of transcriptional
                     inititation site from S1 mapping in strain Ka"
                     /note="UL37 major transcript; would generate an
                     N-terminally truncated translation product"
     TATA_signal     complement(45109..45115)
                     /gene="UL37"
                     /locus_tag="SuHV1_gp23"
                     /inference="ab initio prediction:TRANSFACFind:"
     gene            45112..46330
                     /gene="UL38"
                     /locus_tag="SuHV1_gp24"
                     /note="core gene"
                     /db_xref="GeneID:2952492"
     TATA_signal     45112..45118
                     /gene="UL38"
                     /locus_tag="SuHV1_gp24"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    45140
                     /gene="UL38"
                     /locus_tag="SuHV1_gp24"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     misc_feature    45145
                     /gene="UL38"
                     /locus_tag="SuHV1_gp24"
                     /experiment="approximation (+/- 6 nt) of transcriptional
                     initation site from S1 mapping in strain Ka"
     CDS             45168..46274
                     /gene="UL38"
                     /locus_tag="SuHV1_gp24"
                     /function="capsid morphogenesis"
                     /note="complexed 1:2 with capsid triplex subunit 2 to
                     connect capsid hexons and pentons"
                     /codon_start=1
                     /product="capsid triplex subunit 1"
                     /protein_id="YP_068341.1"
                     /db_xref="GI:51557507"
                     /db_xref="GeneID:2952492"
                     /translation="MSVQIGNGLLMVVAPGTLTVGSARARLIRQVTLADFCEPQAERP
                     GLVVLALRHPADLAGAAYAATPPGKNHRDLEEAWLALDEGGRGLGGDGIRASVVSLNF
                     LVAAAENADDALRAHVTTNYRDRRTAARLERFATVLRAMIRSHVFPHRALHVLGGLLG
                     HVTQDRLASVTCVARGDQEAARTNDMAARRSQVHVPACALMDVDRELRLGGDDGLRFA
                     YLVFVYTQRHRREALRVHVAVSRLPELGDALSFLLAGTRVDNAIHGTDEADAPAAPAA
                     AAAFPAYLFNDPRSARCPTGRLNTPAAEALPVWAPDMRGRATRNSCMYAAYVRLGTVE
                     RVVRRAERCGSVDLPLAHMERFTWDVGAWEECFF"
     misc_feature    complement(45221)
                     /gene="UL37"
                     /locus_tag="SuHV1_gp23"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     misc_feature    complement(45224)
                     /gene="UL37"
                     /locus_tag="SuHV1_gp23"
                     /experiment="approximation (+/- 10 nt) of transcriptional
                     initation site from S1 mapping in strain Ka"
                     /note="UL37 minor transcript"
     TATA_signal     complement(45245..45251)
                     /gene="UL37"
                     /locus_tag="SuHV1_gp23"
                     /inference="ab initio prediction:TRANSFACFind:"
     TATA_signal     46325..46331
                     /inference="ab initio prediction:TRANSFACFind:"
                     /note="UL39"
     polyA_signal    46325..46330
                     /gene="UL38"
                     /locus_tag="SuHV1_gp24"
                     /experiment="consistent with mRNA size and sense in strain
                     Ka"
                     /inference="ab initio prediction:PolyADQ:"
     misc_feature    46356
                     /inference="ab initio prediction:NNPP:"
                     /note="UL39; transcriptional initiation site; would
                     generate an N-terminally extended translation product"
     gene            46538..49964
                     /gene="UL39"
                     /locus_tag="SuHV1_gp25"
                     /note="core gene"
                     /db_xref="GeneID:2952535"
     TATA_signal     46538..46544
                     /gene="UL39"
                     /locus_tag="SuHV1_gp25"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    46569
                     /gene="UL39"
                     /locus_tag="SuHV1_gp25"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             46605..48977
                     /gene="UL39"
                     /locus_tag="SuHV1_gp25"
                     /EC_number="1.17.4.1"
                     /function="nucleotide metabolism"
                     /codon_start=1
                     /product="ribonucleotide reductase subunit 1"
                     /protein_id="YP_068342.2"
                     /db_xref="GI:126802153"
                     /db_xref="GeneID:2952535"
                     /translation="MASVVAPAASSSAAAPGADAFLDAACPEDVARALAAELEALRAL
                     GHDVGAPAPGASRREAALFITRAVDGLKAFSRVDERVYVACGKLVHLRVRSREADLDA
                     WLASPELALIPAVAAAVRRHRARVEAALRWFWREAYPALYARGLQSALKYEEMYLARL
                     EHGRCEAMDQFFVRLAAAAATATRRPMALVLCGSDAWPEVFDAYFRALATQAIVPATP
                     LMLFAGRARGSLASCYLLNPLPRTTEEAVRAITDEVAPILLRRGGVGLSLQSFNRTPS
                     GDCTRGIMAVLKALDSMTAAINSDSERPTGVCVYVEPWHADVRAVLNMRGMLAADESL
                     RCDNIFSCLWTPDLFFQRYQRHLDGERAVKWTLFDDRASHLASLHGPDFAREYERLER
                     LGLGVESLPIQDMAFLIVRSAVMTGSPFLMMKDACNRHFHTDTRGAALATSNLCTEIV
                     QRATPGENGVCNLASVNLPACLAGGAFDFAALRRAARVAAVFVNAMMRIGNYPTGASV
                     EGVRRSRSLGIGLQGLHTTVLALDMDMADPAARRLNAAIAEELLYGVMDASVELCERG
                     LRPFDGFEHSRYARGVMPFDAYERVSLREPMRWDALRVRIAEHGVYNAQFVALMPTVS
                     SSQVTESSEGFSPTFTNMFSKVTISGELLRPNLPLMETLRRLFPRECARRDAVARLER
                     AQWSVAAAFGELPAGHPLAKFKTAFEYDQELLIDMCADRAPFVDHSQSMSLFLTEPAD
                     GKLHASRVMGLLMRAYNLGLKTGMYYCKIRKATNNGVFTGGDLVCTSCHL"
     gene            48868..49964
                     /gene="UL40"
                     /locus_tag="SuHV1_gp26"
                     /note="core gene"
                     /db_xref="GeneID:2952536"
     TATA_signal     48868..48874
                     /gene="UL40"
                     /locus_tag="SuHV1_gp26"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    48900
                     /gene="UL40"
                     /locus_tag="SuHV1_gp26"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             48987..49898
                     /gene="UL40"
                     /locus_tag="SuHV1_gp26"
                     /EC_number="1.17.4.1"
                     /function="nucleotide metabolism"
                     /codon_start=1
                     /product="ribonucleotide reductase subunit 2"
                     /protein_id="YP_068343.1"
                     /db_xref="GI:51557509"
                     /db_xref="GeneID:2952536"
                     /translation="MEYFYTSQCPDMDHLRSLSVANRWLETDLPLGDDAKDVAALSEP
                     ELEFYRFLFAFLSAADDLVNVNLGSLSELFTQKDILHYYIEQECIEVVHSRVYSAIQL
                     MLFRGDAAARERYVRAALRDEAIRRKVEWLDSRVAECASVAEKYLLMILIEGIFFASS
                     FASISYLRTHNLFVVTCQSNDFISRDEAIHTSASCCIYNNYLGDAPRPDEARIHQLFA
                     EAVEIECEFLRARAPRDSLLLDLPAIISYVRYSADRLLQAIGASPLFGAPAPAADFPM
                     ALMVAEKHTNFFERRSTNYTGTVVNDL"
     polyA_signal    49959..49964
                     /experiment="consistent with mRNA sizes (sense unknown) in
                     strain NIA-3"
                     /inference="ab initio prediction:PolyADQ:"
                     /note="UL39, UL40"
     repeat_region   50181..50276
                     /note="8 copies of an 11 bp repeat plus a partial copy of
                     8 bp"
                     /rpt_type=direct
                     /rpt_unit_seq="gggacggcggg"
     gene            complement(50400..51571)
                     /gene="UL41"
                     /locus_tag="SuHV1_gp27"
                     /db_xref="GeneID:2952522"
     polyA_signal    complement(50400..50405)
                     /gene="UL41"
                     /locus_tag="SuHV1_gp27"
                     /inference="ab initio prediction:PolyADQ:"
     CDS             complement(50401..51498)
                     /gene="UL41"
                     /locus_tag="SuHV1_gp27"
                     /function="cellular mRNA degradation"
                     /note="mRNA-specific RNase"
                     /codon_start=1
                     /product="tegument host shutoff protein"
                     /protein_id="YP_068344.1"
                     /db_xref="GI:51557510"
                     /db_xref="GeneID:2952522"
                     /translation="MGLFGLLKYAHRHRLVRSEAISTPPGVLTPIAIDLWNVMYTLME
                     KHYQETTEDNATTTARCLLRLLRMLHKRTYFPIFVSDRGIFGNGRIARGAKAIMAAAV
                     RADGDGAADAPPRPRWSTMLHAPRIVHRLCVNLIRHMGYAYVDVSDMEADDVCANLYH
                     TNTVAQVHTTDTDMILTGCDMILDIAPVFPLVLRCRDVLASLGVDYSEFLAAFVRCHT
                     DLHRAPDVDSVQQVAESLEGREVAPEDVKLKYASRCPDIMRDAGKALALLPAAGDARS
                     PRAEREFIQHVVAMLTPARHGHLSVLRRVPIVQEPSDVNKVFGSLLRHVKNETRAKEL
                     AGLFWKHIPPPPNYQAVLMAYWDDCNAHRRK"
     gene            51526..52800
                     /gene="UL42"
                     /locus_tag="SuHV1_gp28"
                     /note="core gene"
                     /db_xref="GeneID:2952523"
     TATA_signal     51526..51532
                     /gene="UL42"
                     /locus_tag="SuHV1_gp28"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    complement(51541)
                     /gene="UL41"
                     /locus_tag="SuHV1_gp27"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     misc_feature    51556
                     /gene="UL42"
                     /locus_tag="SuHV1_gp28"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     51564..51570
                     /gene="UL42"
                     /locus_tag="SuHV1_gp28"
                     /inference="ab initio prediction:TRANSFACFind:"
     TATA_signal     complement(51565..51571)
                     /gene="UL41"
                     /locus_tag="SuHV1_gp27"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    51596
                     /gene="UL42"
                     /locus_tag="SuHV1_gp28"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             51628..52782
                     /gene="UL42"
                     /locus_tag="SuHV1_gp28"
                     /function="DNA replication"
                     /note="dsDNA-binding protein"
                     /codon_start=1
                     /product="DNA polymerase processivity subunit"
                     /protein_id="YP_068345.1"
                     /db_xref="GI:51557511"
                     /db_xref="GeneID:2952523"
                     /translation="MSLFDDGLEDLDRHPTHAHHPAQVIHDGPFVLEDGEPLQRTGML
                     VLSDEHLEHARAAIAPLAAHLAHAFLVFSEAGLLVHASVRGEQVYVTLAPDQFSTFVW
                     SGPQAVFLGNVDGSGGVLDALKVDRRRTVFNVTFEVYGAFPARLLTRRAYFADAGVLA
                     TGPGSPSVACVYKHEFNDYCIMLPSRAPDVSLTLSRPQVAKLAAVAKGAAAGTTFALA
                     RGLDFSVSSSAGVVTFPARDRDGTAVLERASQRRQGVDAVGATEPFAMTLETAHGLLT
                     LLQRLRAGNAELTFNFFTTPRQAPLFSVTTCGPVRATTFFFCAPADPATVPAAPEGAA
                     ATVAAACGAGASAAPAAGDKRPAAPRMYTPIAKRPRAASGEGGHAYGDLF"
     misc_feature    52686..55454
                     /note="derived from strain Be"
     polyA_signal    52781..52786
                     /gene="UL42"
                     /locus_tag="SuHV1_gp28"
                     /experiment="consistent with mRNA size (sense unknown) in
                     strain Ka"
                     /inference="ab initio prediction:PolyADQ:"
     gene            52798..53988
                     /gene="UL43"
                     /locus_tag="SuHV1_gp29"
                     /db_xref="GeneID:2952524"
     TATA_signal     52798..52804
                     /gene="UL43"
                     /locus_tag="SuHV1_gp29"
                     /inference="ab initio prediction:TRANSFACFind:"
     polyA_site      52800
                     /gene="UL42"
                     /locus_tag="SuHV1_gp28"
                     /experiment="cDNA sequence in strain TNL"
     misc_feature    52829
                     /gene="UL43"
                     /locus_tag="SuHV1_gp29"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             52842..53963
                     /gene="UL43"
                     /locus_tag="SuHV1_gp29"
                     /function="possibly membrane fusion"
                     /codon_start=1
                     /product="type 3 envelope protein UL43"
                     /protein_id="YP_068346.1"
                     /db_xref="GI:51557512"
                     /db_xref="GeneID:2952524"
                     /translation="MISQGNGGGCRPGEPCWRCALESTRCITLMGVLVALLAACMLSV
                     PPAASTMLLGVASLMAMLRLPMPLVDRFIPACMGLQLVGAAVFAAGWALASRDAISAG
                     VLLWAVCALISHMYNVVCVASGPDAHYRPACLVMGVAAACGAAGALVNVRTEARLGIA
                     LGLAVTCATNNVARSLRGTCTYVASRARFLAAPADLGRGYSVENADADPTAEPERRVY
                     EATVPHTHAYAGSIALFALVFSAASSLQWMVSQMVGRGNQLVSPTTAAAAGAAGFLDA
                     AAVSLFVRPSTRHLSVAVKGAHTLLILAAIVLTAAGEPMGVPISLAASTGLGAARGGP
                     RPLRHTRAYRLAAAHVTRALLVQAYVTVAMCATSIKSVS"
     polyA_signal    53946..53951
                     /gene="UL43"
                     /locus_tag="SuHV1_gp29"
                     /inference="ab initio prediction:PolyADQ:"
     gene            53986..55505
                     /gene="UL44"
                     /locus_tag="SuHV1_gp30"
                     /db_xref="GeneID:2952505"
     TATA_signal     53986..53992
                     /gene="UL44"
                     /locus_tag="SuHV1_gp30"
                     /inference="ab initio prediction:TRANSFACFind:"
     polyA_site      53988
                     /gene="UL43"
                     /locus_tag="SuHV1_gp29"
                     /experiment="cDNA sequence in strain TNL"
     misc_feature    54016
                     /gene="UL44"
                     /locus_tag="SuHV1_gp30"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     misc_feature    54018
                     /gene="UL44"
                     /locus_tag="SuHV1_gp30"
                     /experiment="approximation (+/- 5 nt) of transcriptional
                     initation site from S1 mapping in strain Be"
     CDS             54029..55468
                     /gene="UL44"
                     /locus_tag="SuHV1_gp30"
                     /function="cell attachment"
                     /note="binds cell surface heparan sulphate; binds
                     complement C3b to block neutralization"
                     /codon_start=1
                     /product="type 1 envelope glycoprotein C"
                     /protein_id="YP_068347.1"
                     /db_xref="GI:51557513"
                     /db_xref="GeneID:2952505"
                     /translation="MASLARAMLALLALYAAAIAAAPSTTTALDTTPNGGGGGNSSEG
                     ELSPSPPPTPAPASPEAGAVSTPPVPPPSVSRRKPPRNNNRTRVHGDKATAHGRKRIV
                     CRERLFSARVGDAVSFGCAVFPRAGETFEVRFYRRGRFRSPDADPEYFDEPPRPELPR
                     ERLLFSSANASLAHADALAPVVVEGERATVANVSGEVSVRVAAADAETEGVYTWRVLS
                     ANGTEVRSANVSLLLYSQPEFGLSAPPVLFGEPFRAVCVVRDYYPRRSVRLRWFADEH
                     PVDAAFVTNSTVADELGRRTRVSVVNVTRADVPGLAAADAADALAPSLRCEAVWYRDS
                     VASQRFSEALRPHVYHPAAVSVRFVEGFAVCDGLCVPPEARLAWSDHAADTVYHLGAC
                     AEHPGLLNVRSARPLSDLDGPVDYTCRLEGLPSQLPVFEDTQRYDASPASVSWPVVSS
                     MIVVIAGIGILAIVLVIMATCVYYRRAGP"
     sig_peptide     54029..54091
                     /gene="UL44"
                     /locus_tag="SuHV1_gp30"
                     /inference="ab initio prediction:SignalP:"
     mat_peptide     54092..55465
                     /gene="UL44"
                     /locus_tag="SuHV1_gp30"
                     /product="type 1 envelope glycoprotein C"
                     /inference="ab initio prediction:SignalP:"
                     /protein_id="YP_068398.1"
                     /db_xref="GI:51557564"
     misc_feature    55404..59926
                     /note="derived from strain Ka"
     polyA_site      55489
                     /gene="UL44"
                     /locus_tag="SuHV1_gp30"
                     /experiment="approximation (+/- 40 nt) from S1 mapping in
                     strain Be"
     polyA_signal    55500..55505
                     /gene="UL44"
                     /locus_tag="SuHV1_gp30"
                     /inference="ab initio prediction:PolyADQ:"
     gene            complement(55645..59665)
                     /gene="UL24"
                     /locus_tag="SuHV1_gp31"
                     /note="core gene"
                     /db_xref="GeneID:2952506"
     gene            complement(55645..58956)
                     /gene="UL25"
                     /locus_tag="SuHV1_gp32"
                     /note="core gene"
                     /db_xref="GeneID:2952507"
     gene            complement(55645..57333)
                     /gene="UL26"
                     /locus_tag="SuHV1_gp33"
                     /note="core gene"
                     /db_xref="GeneID:2952508"
     gene            complement(55645..56577)
                     /gene="UL26.5"
                     /locus_tag="SuHV1_gp34"
                     /note="core gene"
                     /db_xref="GeneID:2952525"
     polyA_site      complement(55645)
                     /experiment="approximation (+/- 40 nt) from S1 mapping in
                     strain NIA-3 (UL26.5, UL26, UL25)"
                     /note="UL26, UL26.5, UL25, UL24"
     polyA_signal    complement(55654..55659)
                     /experiment="consistent with mRNA size and sense in strain
                     Ka (UL26.5, UL26, UL25, UL24)"
                     /experiment="consistent with mRNA sizes (sense unknown) in
                     strain NIA-3 (UL26.5, UL26, UL25)"
                     /inference="ab initio prediction:PolyADQ:"
                     /note="UL26, UL26.5, UL25, UL24"
     CDS             complement(55699..57273)
                     /gene="UL26"
                     /locus_tag="SuHV1_gp33"
                     /EC_number="3.4.21.97"
                     /function="capsid morphogenesis"
                     /note="serine protease (N-terminal region); minor scaffold
                     protein (remainder of protein, clipped near C terminus)"
                     /codon_start=1
                     /product="capsid maturation protease"
                     /protein_id="YP_068348.1"
                     /db_xref="GI:51557514"
                     /db_xref="GeneID:2952508"
                     /translation="MGPVYVSGYLALYDRDGGELALTREIVAAALPPAGPLPINIDHR
                     PRCDIGAVLAVVDDDRGPFFLGVVNCPQLGAVLARAVGPDFFGDMRLSDEERLLYLLS
                     NYLPSASLSSRRLAPGEAPDETLFAHVALCVIGRRVGTIVVYDASPEAAVAPFRQLSA
                     RARSELLARAAESPDRERVWHMSEEALTRALLSTAVNNMLLRDRWELVAARRREAGVR
                     GHTYLQATMWAGLLPKSGASPAPGPSAAMAAPPSAAPGDYIFVPAAQYNQLVVNQRPA
                     PSLESQLGAIVSAAMDRRHRRSPSPEPRPPARKRRYDDYAQDNAYYPGEAPPPASDLA
                     AVVSSLQREISHLRAQQLRYPTPYYAPAAPPQLLPPGAVVGHPHPHHAAGALYPPMYA
                     PQPGLHAPPPSPVAHAVPALPGLPGLQGLAAPVAHVPAQVVPQQPVVVQAQPVAVPAA
                     AAAAPAPAPAAAAAAAAPVQAAAPAAPASAPQPPVQASVSAPADVSAGTIDASSAAVA
                     CQRGADIFVSQMMSQR"
     CDS             complement(55699..56535)
                     /gene="UL26.5"
                     /locus_tag="SuHV1_gp34"
                     /function="capsid morphogenesis"
                     /note="clipped near C terminus"
                     /codon_start=1
                     /product="capsid scaffold protein"
                     /protein_id="YP_068349.1"
                     /db_xref="GI:51557515"
                     /db_xref="GeneID:2952525"
                     /translation="MAAPPSAAPGDYIFVPAAQYNQLVVNQRPAPSLESQLGAIVSAA
                     MDRRHRRSPSPEPRPPARKRRYDDYAQDNAYYPGEAPPPASDLAAVVSSLQREISHLR
                     AQQLRYPTPYYAPAAPPQLLPPGAVVGHPHPHHAAGALYPPMYAPQPGLHAPPPSPVA
                     HAVPALPGLPGLQGLAAPVAHVPAQVVPQQPVVVQAQPVAVPAAAAAAPAPAPAAAAA
                     AAAPVQAAAPAAPASAPQPPVQASVSAPADVSAGTIDASSAAVACQRGADIFVSQMMS
                     QR"
     misc_feature    complement(56545)
                     /gene="UL26.5"
                     /locus_tag="SuHV1_gp34"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     misc_feature    complement(56546)
                     /gene="UL26.5"
                     /locus_tag="SuHV1_gp34"
                     /experiment="approximation (+/- 1 nt) of transcriptional
                     initation site from primer extension in strain NIA-3"
     TATA_signal     complement(56571..56577)
                     /gene="UL26.5"
                     /locus_tag="SuHV1_gp34"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    complement(57304)
                     /gene="UL26"
                     /locus_tag="SuHV1_gp33"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             complement(57307..58911)
                     /gene="UL25"
                     /locus_tag="SuHV1_gp32"
                     /function="DNA encapsidation"
                     /note="located on capsid near vertices; possibly
                     stabilizes the capsid and retains the genome"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL25"
                     /protein_id="YP_068350.1"
                     /db_xref="GI:51557516"
                     /db_xref="GeneID:2952507"
                     /translation="MDRAWFAFEAAAIPGSARHFIAPPFPVGFWARPGFSEGLDARLA
                     LAHANARRRAAAAALDNAMAAGARLEAEVDEQLRPLERQVERVAEALVVLEETARAAE
                     EADAARAAEEAPEATAAADEGREVQIAKNDVALAYDANLSLDFLAMVYAARGAASGVL
                     FGTWYATLQATLVAERPQVSRAIDSRDGRMSRTFMGVTTTALQACGRLYVGNRHYSAL
                     ESAALCLHLVHRVRQGAGAAGAAAPLGIADLLERVPEYLDALSQALAEGGRISYRYNY
                     PRVPREQLHGRYALEGHSVLAALARLRVVPGANVGANEVDGAGFVDEVNRAAAAFLGR
                     GQNLFLGEDAPLLRATVNTITGLLLLRRLLHNGNVYGDRLRNNFQLGALVPNAPPPRG
                     ASGDAPASRSGDGNLRFLLAHYVVVAYRADERTELTQLFPGLAALALDAHSIRARVQR
                     HQLNLVRLVALELQNRQRVTAPVNEVIAAHDAVAVQYEEGLGLLLQQPHLRNAADKRL
                     GQFGVSSDYDLLYFLCLGYIPQFAAA"
     TATA_signal     complement(57327..57333)
                     /gene="UL26"
                     /locus_tag="SuHV1_gp33"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    complement(57400)
                     /experiment="approximation (+/- 1 nt) of transcriptional
                     initation site from primer extension in strain NIA-3"
                     /note="UL26"
     misc_feature    complement(58927)
                     /gene="UL25"
                     /locus_tag="SuHV1_gp32"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(58950..58956)
                     /gene="UL25"
                     /locus_tag="SuHV1_gp32"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    complement(58963)
                     /experiment="approximation (+/- 1 nt) of transcriptional
                     initation site from primer extension in strain NIA-3"
                     /note="UL25; would generate an N-terminally extended
                     translation product"
     CDS             complement(59004..59519)
                     /gene="UL24"
                     /locus_tag="SuHV1_gp31"
                     /function="unknown"
                     /codon_start=1
                     /product="nuclear protein UL24"
                     /protein_id="YP_068351.1"
                     /db_xref="GI:51557517"
                     /db_xref="GeneID:2952506"
                     /translation="MRIPARFRAGIRCHNRFYERLRRDPSAYGESLFGLPRETLKKAS
                     LTLAFEVNLGVRRPDCVCVVRLGVGPHLCFVIELKTCRFPRNLNTPSKRGQRHEGLCQ
                     LRDSARLLAAAVPPGGEEITLVPLLVFVAQRSMRVLDVTRLPCTQTRGNASAMAATVR
                     GLAEYVAGPRR"
     gene            59512..60590
                     /gene="UL23"
                     /locus_tag="SuHV1_gp35"
                     /note="core gene"
                     /db_xref="GeneID:2952559"
     CDS             59512..60474
                     /gene="UL23"
                     /locus_tag="SuHV1_gp35"
                     /EC_number="2.7.1.21"
                     /function="nucleotide metabolism"
                     /codon_start=1
                     /product="thymidine kinase"
                     /protein_id="YP_068352.1"
                     /db_xref="GI:51557518"
                     /db_xref="GeneID:2952559"
                     /translation="MRILRIYLDGAYGTGKSTTARVMALGGALYVPEPMAYWRTLFDT
                     DTVAGIYDAQTRKQNGSLSEEDAALVTAQHQAAFATPYLLLHTRLVPLFGPAVEGPPE
                     MTVVFDRHPVAATVCFPLARFIVGDISAAAFVGLAATLPGEPPGGNLVVASLDPDEHL
                     RRLRARARAGEHVDARLLTALRNVYAMLVNTSRYLSSGRRWRDDWGRAPRFDQTTRDC
                     LALNELCRPRDDPELQDTLFGAYKAPELCDRRGRPLEVHAWAMDALVAKLLPLRVSTV
                     DLGPSPRVCAAAVAAQTRGMEVTESAYGDHIRQCVCAFTSEMGV"
     misc_feature    complement(59633)
                     /gene="UL24"
                     /locus_tag="SuHV1_gp31"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(59659..59665)
                     /gene="UL24"
                     /locus_tag="SuHV1_gp31"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    59732..60503
                     /note="derived from strain NIA-3"
     misc_feature    60490..77111
                     /note="derived from strain Ka"
     gene            60560..62670
                     /gene="UL22"
                     /locus_tag="SuHV1_gp36"
                     /note="core gene"
                     /db_xref="GeneID:2952560"
     TATA_signal     60560..60566
                     /gene="UL22"
                     /locus_tag="SuHV1_gp36"
                     /inference="ab initio prediction:TRANSFACFind:"
     polyA_signal    60585..60590
                     /gene="UL23"
                     /locus_tag="SuHV1_gp35"
                     /experiment="consistent with mRNA size (sense unknown) in
                     strain Ka"
                     /inference="ab initio prediction:PolyADQ:"
     misc_feature    60589
                     /experiment="approximation (+/- 1 nt) of transcriptional
                     initation site from primer extension in strain Ka"
                     /note="UL22"
     misc_feature    60590
                     /gene="UL23"
                     /locus_tag="SuHV1_gp35"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             60610..62670
                     /gene="UL22"
                     /locus_tag="SuHV1_gp36"
                     /function="cell entry"
                     /function="cell-to-cell spread"
                     /note="possible membrane fusogen; complexed with envelope
                     glycoprotein L"
                     /codon_start=1
                     /product="type 1 envelope glycoprotein H"
                     /protein_id="YP_068353.1"
                     /db_xref="GI:51557519"
                     /db_xref="GeneID:2952560"
                     /translation="MPASSVRLPLRLLTLAGLLALAGAAALARGAPQGGPPSPQGGPA
                     PTAAPARGPTLFVLVGDGSAWFVFQLGGLGALNDTRIRGHLLGRYLVSYQVVPPPVSA
                     WYFVQRPRERPRLSGPPSGAELVAFDAPGVRRTYTTAAVWPAEVAVLADAEARCPAAV
                     FNVTLGEAFLGLRVALRSFLPLEVIISAERMRMIAPPALGSDLEPPGPPAGRFHVYTL
                     GFLSDGAMHQTMRDVAAYVHESDDYLAQLSAAHAAALAAVVQPGPYYFYRAAVRLGVA
                     AFVFSEAARRDRRASAPALLRVESDARLLSRLLMRAAGCPAGFAGLFDGRAERVPVAP
                     ADQLRAAWTFGEDPAPRLDLARATVAEAYRRSVRGKPFDQQALFFAVALLLRAGGPGD
                     ARETLLRTTAMCTAERAAAAAELTRAALSPTAAWNEPFSLLDVLSPCAVSLRRDLGGD
                     ATLANLGAAARLALAPAGAPGAAAATDEGAEEEEEDPVARAAPEIPAEALLALPLRGG
                     ASFVFTRRRPDCGPAYTLGGVDIANPLVLAIVSNDSAACDYTDRMPESQHLPATDNPS
                     VCVYCDCVFVRYSSAGTILETVLIESKDMEEQLMAGANSTIPSFNPTLHGGDVKALML
                     FPNGTVVDLLSFTSTRLAPVSPAYVVASVVGAAITVGILYALFKMLCSFSSEGYSRLI
                     NARS"
     sig_peptide     60610..60699
                     /gene="UL22"
                     /locus_tag="SuHV1_gp36"
                     /inference="ab initio prediction:SignalP:"
     mat_peptide     60700..62667
                     /gene="UL22"
                     /locus_tag="SuHV1_gp36"
                     /product="type 1 envelope glycoprotein H"
                     /inference="ab initio prediction:SignalP:"
                     /protein_id="YP_068399.1"
                     /db_xref="GI:51557565"
     polyA_signal    62652..62657
                     /gene="UL22"
                     /locus_tag="SuHV1_gp36"
                     /experiment="consistent with mRNA size (sense unknown) in
                     strain Ka"
                     /inference="ab initio prediction:PolyADQ:"
     repeat_region   63110..63319
                     /note="14 copies of a 15 bp repeat"
                     /rpt_type=direct
                     /rpt_unit_seq="cgccctctctcccac"
     repeat_region   63388..63459
                     /note="6 copies of an 11 bp repeat plus a partial copy of
                     6 bp"
                     /rpt_type=direct
                     /rpt_unit_seq="aaggggtctct"
     stem_loop       63848..63908
                     /note="oriL palindrome"
     protein_bind    63849..63856
                     /bound_moiety="DNA replication origin-binding helicase"
     protein_bind    complement(63900..63907)
                     /bound_moiety="DNA replication origin-binding helicase"
     gene            complement(64488..66126)
                     /gene="UL21"
                     /locus_tag="SuHV1_gp37"
                     /db_xref="GeneID:2952541"
     CDS             complement(64488..66065)
                     /gene="UL21"
                     /locus_tag="SuHV1_gp37"
                     /function="virion morphogenesis"
                     /note="interacts with microtubules"
                     /codon_start=1
                     /product="tegument protein UL21"
                     /protein_id="YP_068354.1"
                     /db_xref="GI:51557520"
                     /db_xref="GeneID:2952541"
                     /translation="MEFEYQSTIVHQGVLFYVADGGDRAYFVHGGCIVSVHRRSREIG
                     KFGLTLRGNAPGNRVVANYVRTELARLGRAWAAPQGSDDVFVDALGLLLPLTELDLCG
                     RAELDVYDPYLVECMVSLPASALSLTLVHDRQQDRVLELLAEPAIVHPSSGFVYAVNE
                     ACFALVQAYLSELPSSLQVLTEGLFDGIPGVRPPLSGETRPTAVVVKGGRAAPTLSVR
                     PRRYAERALRATVVSDFVQVRYIPATRRIWATRGGSLSLQMLCDLVAGADAILRRAAG
                     ASDDASAAVVEAVSAVAADPFFGTGSTSLTGAQRFALYQFILARWHLPSCYAALEGML
                     DRLDERPGAGAGDDDDDDGGEGGGGGGHGGSRAASAVAHAVNRVLREATVFGEVMRML
                     VNAAVVHAPAIADPAGASPPTTKHAREDAATGLELAVMMSDAETNAPDADACELVEAA
                     GARVLDGLYAGRGLVAATAPVGRALRPTSAVCAEAALLTAFGDSPAALRGAQYLFQLF
                     RARLTRANISIVLNKNR"
     polyA_signal    complement(64497..64502)
                     /gene="UL21"
                     /locus_tag="SuHV1_gp37"
                     /experiment="consistent with mRNA size (sense unknown) in
                     strain NIA-3"
                     /inference="ab initio prediction:PolyADQ:"
     misc_feature    complement(66097)
                     /gene="UL21"
                     /locus_tag="SuHV1_gp37"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(66120..66126)
                     /gene="UL21"
                     /locus_tag="SuHV1_gp37"
                     /inference="ab initio prediction:TRANSFACFind:"
     gene            66121..66658
                     /gene="UL20"
                     /locus_tag="SuHV1_gp38"
                     /db_xref="GeneID:2952542"
     TATA_signal     66121..66127
                     /gene="UL20"
                     /locus_tag="SuHV1_gp38"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    66151
                     /gene="UL20"
                     /locus_tag="SuHV1_gp38"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             66172..66657
                     /gene="UL20"
                     /locus_tag="SuHV1_gp38"
                     /function="virion morphogenesis"
                     /function="membrane fusion"
                     /codon_start=1
                     /product="type 3 envelope protein UL20"
                     /protein_id="YP_068355.1"
                     /db_xref="GI:51557521"
                     /db_xref="GeneID:2952542"
                     /translation="MEDAAADVDAAADAKMTGENDALLSSAFVGARPPRPRFSSHVVS
                     LLALALALRPACCLVLALHGSRATLAALLTALAFYARAAVCAVLVARNVARDRMPLSP
                     AQQAALGLLAAARLAFLYVALDAGRHYAPALAGALYGADCVCDALAFLLPRAYARSIM
                     H"
     gene            66652..71846
                     /gene="UL19"
                     /locus_tag="SuHV1_gp39"
                     /note="core gene"
                     /db_xref="GeneID:2952543"
     TATA_signal     66652..66658
                     /gene="UL19"
                     /locus_tag="SuHV1_gp39"
                     /inference="ab initio prediction:TRANSFACFind:"
     polyA_signal    66653..66658
                     /gene="UL20"
                     /locus_tag="SuHV1_gp38"
                     /inference="ab initio prediction:PolyADQ:"
     misc_feature    66683
                     /gene="UL19"
                     /locus_tag="SuHV1_gp39"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     misc_feature    66684
                     /gene="UL19"
                     /locus_tag="SuHV1_gp39"
                     /experiment="approximation (+/- 1 nt) of transcriptional
                     initation site from primer extension in strain Indiana S"
     CDS             66744..70736
                     /gene="UL19"
                     /locus_tag="SuHV1_gp39"
                     /function="capsid morphogenesis"
                     /note="6 copies form hexons, 5 copies form pentons"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="YP_068356.1"
                     /db_xref="GI:51557522"
                     /db_xref="GeneID:2952543"
                     /translation="MERPAILPSGQILSNIEVHSHRALFDIFKRFRSDDNNLYGAEFD
                     ALLGTYCSTLSLVRFLELGLSVACVCTKFPELSYVAEGTIQFEVQQPMIARDGPHPAD
                     QPVHNYMIKRLDRRSLNAAFSIAVEALGLISGENLDGTHISSAMRLRAIQQLARNVQA
                     VLDSFERGTADQMLRVLMEKAPPLSLLAPFTLYEGRLADRVACAALVSELKRRVRDDT
                     FFLTKHERNKDAVLDRLSDLVNCTAPSVAVARMTHADTQGRPVDGVLVTTAGVRQRLL
                     HHVLTLADTHADVPVTYGEMVIANTNLVTALVMGKAVSNMDDVARYLLGGEPAPDDGK
                     PVGSARVRADLVVVGDRLVFLEALEKRVYQATQVPYPLVGNLDVTFVMPLGVFKPAAD
                     RYARHAGSFAPTPGLPDPRTHPPRAVHFFNKDGVPCHVTFEHAMGTLCHPSFLDVDAT
                     LAALRQEPAEVQCAFGAYVADARPDALVGLMQRFLEEWPGMMPVRPRWAAPPAADQLL
                     APGNADLRLELHPAFDFFVAPEVDVPGPFAVPQVMGQVRAMPRIINGNIPLALCPVDF
                     RDARGFELSVDRHRLAPATVAAVRGAFRDANYPMVFYIIEAVIHGSERTFCALARLVA
                     QCIQSYWRNTHNAAFVNNFYMVMYINTYLGNGELPEDCAAVYKDLLEHVHALRRLIGE
                     FTLPGDPLGNQPQEELNHALADATLLPPLIWDCDPILYRDGLAERLPELRVNGAHFQH
                     ILWVEMAQVNFRNVGGGLVHNRPVRNENQPLHPHHDAEWSVLSKIYYYAVVPAFSRGN
                     CCTMGVRYDRVYQLVQTMVVPETDEEVGTDDPRHPLHPRNLVPNSLNVLFHNACVAVD
                     ADAMLILQETVTNMAERTTPLLASVAPDAGMATVATRDMRTHDGSLHHGLLMMAYQPN
                     DATLLEGAFFYPAPVNALFACADHLGAMRDVGAEVRAAAQHVPCVPHFLGANYYATVR
                     QPVAQHAAQSRADENTLSYALMAGYFKMSPVAFTHQLRRQLHPGFALTVVRQDRFATE
                     NVLFAEKASESYFMGQMQVARTESGGGLHLQLTQPRANVDLGVGFTAAYAAAALRAPV
                     TDMGNLPQNLFATRGAPPMLDADADDYLRRTVNAGNRLAPVPVFGQMLPQVPAGLARG
                     QQSVCEFIATPVSVDLAYFRRACNPRGRAAGEVHGEEGLMFDHSHADPAHPHRATANP
                     WASQRHSYADRLYNGQYNMSGPAYSPCFKFFTPAEAVAKSRGLARLIADTGAAASPTS
                     NGEYQFKRPVGAGELVEDPCALFQEAYPPLCASDSALLRTPLGAEEHFAQYLIRDESP
                     LKGCFQHASA"
     gene            70837..71846
                     /gene="UL18"
                     /locus_tag="SuHV1_gp40"
                     /note="core gene"
                     /db_xref="GeneID:2952544"
     TATA_signal     70837..70843
                     /gene="UL18"
                     /locus_tag="SuHV1_gp40"
                     /inference="ab initio prediction:TRANSFACFind:"
     polyA_signal    70838..70844
                     /gene="UL19"
                     /locus_tag="SuHV1_gp39"
                     /experiment="consistent with mRNA size (sense unknown) in
                     strain Indiana S"
                     /inference="ab initio prediction:PolyADQ:"
     polyA_site      70857
                     /gene="UL19"
                     /locus_tag="SuHV1_gp39"
                     /experiment="cDNA sequence in strain Indiana S"
                     /note="UL19 major transcript"
     misc_feature    70867
                     /gene="UL18"
                     /locus_tag="SuHV1_gp40"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             70896..71783
                     /gene="UL18"
                     /locus_tag="SuHV1_gp40"
                     /function="capsid morphogenesis"
                     /note="complexed 2:1 with capsid triplex subunit 1 to
                     connect capsid hexons and pentons"
                     /codon_start=1
                     /product="capsid triplex subunit 2"
                     /protein_id="YP_068357.1"
                     /db_xref="GI:51557523"
                     /db_xref="GeneID:2952544"
                     /translation="MEVDIALPTLSPGDLSALQRCEGRVVFLETLRRHATLREVALPC
                     GGDVLAAMADRRRFAAVITRVTPHRMLATPLGVGGRGQSLVLQNTGPFDLTNGDHVCL
                     VPPLLGDECLRLTSANLELRFPMTLPLAQARELTARVVARAAETLRGGAPARGADVVF
                     SNGRRYQLPPPHRDNAEAATRSLVLNMIFLLNEGAVILLSLIPNLLTLGAQDGYANAV
                     IQLGSATRELGQLVRQPPPPLPQDHARRFCVFEALEAWIASASRLGDTLGTRPVARVC
                     IFDGPPTVPPGEKAAVVEV"
     polyA_signal    71841..71846
                     /experiment="consistent with mRNA size (sense unknown) in
                     strain NIA-3"
                     /inference="ab initio prediction:PolyADQ:"
                     /note="UL19 (minor transcript), UL18"
     gene            complement(71892..77204)
                     /gene="UL15"
                     /locus_tag="SuHV1_gp41"
                     /note="core gene"
                     /db_xref="GeneID:2952554"
     polyA_signal    complement(71892..71897)
                     /gene="UL15"
                     /locus_tag="SuHV1_gp41"
                     /inference="ab initio prediction:PolyADQ:"
     CDS             complement(join(71979..73115,75995..77065))
                     /gene="UL15"
                     /locus_tag="SuHV1_gp41"
                     /function="DNA encapsidation"
                     /note="contains an ATPase domain; rare splice donor
                     sequence confirmed in two strains"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 1"
                     /protein_id="YP_068358.1"
                     /db_xref="GI:51557524"
                     /db_xref="GeneID:2952554"
                     /translation="MFGLGDATRRYYADLKRKREASERDCAEEARFFNFAIAAPQCHQ
                     TVVPAVGTLHNCCESARIFAGLARAALFGGARGRAAVDPALARAAEALDFAAYDGERL
                     AFHRNAYTSAMAAVDAMRTSGAFRQLRRFVNRFALLSRRSFRDAATAALGTAAAAAGP
                     GDDDGDEEDGGEEEKDERARGGAKGAPGPAPEDAAEEGHDGGGGEGKGGGGRGTLELF
                     QKMILMHAVYFLATVLLGDHAERATAYLLAAFDTPLFSEDAVRHFRQRVTVFLVPRRH
                     GKTWFLVPLIALALATFRGIRVGYTAHIRKATEPVFEEIHARLRRWCRDARVDHVKGE
                     NITVTFPDGARSTIVFASSHNTNGIRGQDFNLLFVDEANFIRPDAVQTILGFMNQASC
                     KIIFVSSTNTGKASTSFLTNLRGTDMLNVVTYVCDEHMRRVVAHTDATACSCYVLNKP
                     VFITMDAATRTTAERLLPDSFMQEILGGAVAAREAPVLTRAAGERFLLYRPSSVANRR
                     LLAGTLHVYVDPAFTANARASGTGVAVVGSYRRSWIVLGLEHFFLRALTGASADEIAR
                     CVVRCLARVLALHDGAFSAVRVAVEGNSSQDSAVAIVGAMRRELAELRAARVVADPAV
                     VFYHHGAAGAGAVRYPFFLLQKQKTPAFDFFVKQFNSGAVMASQELVSVTVGARADPV
                     EYLNAQLGNLVETASGAGEHRVFTGKRGGCADDLAVALVMAVHLSTLPDGLFA"
     gene            73062..75962
                     /gene="UL17"
                     /locus_tag="SuHV1_gp42"
                     /note="core gene"
                     /db_xref="GeneID:2952555"
     TATA_signal     73062..73068
                     /gene="UL17"
                     /locus_tag="SuHV1_gp42"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    73092
                     /gene="UL17"
                     /locus_tag="SuHV1_gp42"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             73166..74959
                     /gene="UL17"
                     /locus_tag="SuHV1_gp42"
                     /function="DNA encapsidation"
                     /function="capsid transport"
                     /note="capsid-associated"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL17"
                     /protein_id="YP_068359.1"
                     /db_xref="GI:51557525"
                     /db_xref="GeneID:2952555"
                     /translation="MDAHIANETKQQMTRFAPALVHVIVPDPLLRRAGVDPLAPFAAH
                     AQTRYHGSGVCEPWVSVFAGHVQTGAVESVLTLPPLQRPRGPGGLFVSLPLALGAHFD
                     GFTTAALRVGARELVFTYDELLPARTRYNVDGERLERLCRQFANYARARRVAPAVAAA
                     GGHIDALLPPAAATIDGEAQLTRGGFDDPAAPHARDADREILSLVRRAAELVAARHPV
                     RSHVASGLMQGALARRGGGGGGAGALEAAATVPAPAAREDANGGGAAWRDELLLTPQD
                     PRPLTALDWLDAGYAALAGGDAPAHVWRRRPVSLVARRHYQTGETFVVVAYEHSTAWG
                     GRRGPRSEPLARVLAEECERHGVEHPRALPAEARRELVRRHAELAVPLGDEEPPLPVF
                     DATAELVLLERFRNACVRALLAGVRESVRREPRMRQIIEFAIRPRDREAVLDVAGRAP
                     ALLDAFARRLEHTPAREMVDSGLMTAAAAHLAARATAGYVTFESGPLLGGVFLFDYYS
                     AGGEVIRVTRAPPAVAVEPATRGQFACRFRGASHRCLPGESYAYLCVGVSRDLRALVV
                     LPGGFGFFATLRLEWPAALVDPVLERLCRRV"
     gene            74704..75972
                     /gene="UL16"
                     /locus_tag="SuHV1_gp43"
                     /note="core gene"
                     /db_xref="GeneID:2952556"
     TATA_signal     74704..74710
                     /gene="UL16"
                     /locus_tag="SuHV1_gp43"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    74734
                     /gene="UL16"
                     /locus_tag="SuHV1_gp43"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             74986..75972
                     /gene="UL16"
                     /locus_tag="SuHV1_gp43"
                     /function="possibly virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL16"
                     /protein_id="YP_068360.1"
                     /db_xref="GI:51557526"
                     /db_xref="GeneID:2952556"
                     /translation="MEVAAALTEDFAAWRLLRSDSRVKVYAALAVVGARLAAVAPGAA
                     TVAARVYLTRPRALRLAQGRFHVVVLLNDAAYALVAAVTTTTLRGSGGELVRLTLGDA
                     SLEALPADLPVAEPVPAAPAGRLDLDAAEPVAAAPAGRRDCVVLAPGAWWARGRVYFL
                     QMDPRLLALCPAGWRARHLGAVLAGLLSPRDDDGGSCCRECRVEHVDALNATPHPDGA
                     AAPCLCAAPCLWRQADKRELRASDSGLFRVLFLDAVRFVRMLPRRKIVDVASELIGGL
                     DARGRHVVVNDAGWRLVALDPDASRALVCGCPLLRALCDPPARAIPELINDY"
     polyA_signal    75957..75962
                     /inference="ab initio prediction:PolyADQ:"
                     /note="UL17, UL16"
     misc_feature    76943..79033
                     /note="derived from strain NIA-3"
     gene            76965..80300
                     /gene="UL14"
                     /locus_tag="SuHV1_gp44"
                     /note="core gene"
                     /db_xref="GeneID:2952529"
     TATA_signal     76965..76971
                     /gene="UL14"
                     /locus_tag="SuHV1_gp44"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    76996
                     /gene="UL14"
                     /locus_tag="SuHV1_gp44"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             77064..77543
                     /gene="UL14"
                     /locus_tag="SuHV1_gp44"
                     /function="virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL14"
                     /protein_id="YP_068361.1"
                     /db_xref="GI:51557527"
                     /db_xref="GeneID:2952529"
                     /translation="MLASDRRERRVRLEEAFQRESVFKARTVELLRGRADKKNPEFVR
                     AFMAAKQARRDVERHLRLAARVESVEQKARALQARVEAQAAVRGVLDRHRRFTRADFA
                     EALDAAEDALAAGEDRLDDAAALDEDWAGGGAPDEDEGEEADEALLTQWLLEEAEEA"
     misc_feature    complement(77173)
                     /gene="UL15"
                     /locus_tag="SuHV1_gp41"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(77198..77204)
                     /gene="UL15"
                     /locus_tag="SuHV1_gp41"
                     /inference="ab initio prediction:TRANSFACFind:"
     gene            77272..80300
                     /gene="UL13"
                     /locus_tag="SuHV1_gp45"
                     /note="core gene"
                     /db_xref="GeneID:2952530"
     TATA_signal     77272..77278
                     /gene="UL13"
                     /locus_tag="SuHV1_gp45"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    77304
                     /gene="UL13"
                     /locus_tag="SuHV1_gp45"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             77513..78709
                     /gene="UL13"
                     /locus_tag="SuHV1_gp45"
                     /function="protein phosphorylation"
                     /codon_start=1
                     /product="tegument serine/threonine protein kinase"
                     /protein_id="YP_068362.1"
                     /db_xref="GI:51557528"
                     /db_xref="GeneID:2952530"
                     /translation="MAAGGGGGGVSRAALARPPIHRGTSAPGGAIAAAGGDGDGDEAS
                     RLLGRAQPREAPYLIPRPDGDLAVPDDLQYATLDLTGDPVAVGAGSYGSVLVYGSVAV
                     KTLRAGFGHEAVMTLLAAEEARSAGVRGVVRLMGLSAPLRQLMFPAYEMDMDAYRRSL
                     TARPGHVVHALGRVFTELGRALVFLNGRGLSHLDVKGGNIFVRTCGNMVVTAVIGDFS
                     LMALNSRSALADPRFRLARRKALKITSLARSPPTGVLLGHARDRPTRVLMDFINGRPP
                     PPGPLPYEVGLAIDLCALGHVLLDVALGLRPQRGQALTREYAVEVLARRCVLFAALLP
                     PGSGPSAEALAGDILEEELAAGFREGVASSRPGNQPPRTVAPLLELVARFCGEDGGAR
                     FAELAA"
     gene            78322..80300
                     /gene="UL12"
                     /locus_tag="SuHV1_gp46"
                     /note="core gene"
                     /db_xref="GeneID:2952531"
     TATA_signal     78322..78328
                     /gene="UL12"
                     /locus_tag="SuHV1_gp46"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    78351..96534
                     /note="derived from strain Ka"
     misc_feature    78351
                     /gene="UL12"
                     /locus_tag="SuHV1_gp46"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     misc_feature    78501
                     /gene="UL12"
                     /locus_tag="SuHV1_gp46"
                     /experiment="approximation (+/- 8 nt) of transcriptional
                     initation site from primer extension in strain TNL"
     CDS             78675..80126
                     /gene="UL12"
                     /locus_tag="SuHV1_gp46"
                     /function="DNA processing"
                     /codon_start=1
                     /product="deoxyribonuclease"
                     /protein_id="YP_068363.1"
                     /db_xref="GI:51557529"
                     /db_xref="GeneID:2952531"
                     /translation="MAALVLPNSLPEELAARTFLRFLRGAPRPAAGGAAPLAYRLAYV
                     HDLLVELARHGLAAPDAAAAAFGGARPPPAPAGVPAAAARAAILTVEAATRAQSESDL
                     WTLLRRGLATASTVRWGADGPRFPPTWCEASTARCGTPDNAALIFGRVNESVARAAVA
                     ALYAEAPTPDLPGAIAGGDGGGDGAKEEMFTFDETGAPPPGHDLFSCGLLLDPRTGMV
                     GASLDLLVCDRDAIGRLAPHRTQTEMRFFEIKCRAKYLFSADDASPTARAYARLLERP
                     DADTLRGFLYSIARPGVEFFEGAPGPGEALATADPAWRRGGAEDAPPTRRRCGAFDGR
                     HVAANAHAQSEVWLFSDPVDGRQDIVPWASGERALRVPVFANPRHANFRQILVQSYVV
                     AGVFPDRPARPHLATFFGRRRRPCEQNRTLDLASLCDVPPACAVPVLLIVTPVSVCEE
                     AFEDLRARAEEAFRVTASRTWDSVAADSPATAS"
     gene            80084..80300
                     /gene="UL11"
                     /locus_tag="SuHV1_gp47"
                     /note="core gene"
                     /db_xref="GeneID:2952499"
     CDS             80084..80275
                     /gene="UL11"
                     /locus_tag="SuHV1_gp47"
                     /function="virion morphogenesis"
                     /note="envelope-associated"
                     /codon_start=1
                     /product="myristylated tegument protein"
                     /protein_id="YP_068364.1"
                     /db_xref="GI:51557530"
                     /db_xref="GeneID:2952499"
                     /translation="MGQCCCRFSSNRVVTSSGEVLTFDADAFEDFELEPMVGEPGPVR
                     PKAPYRVSRGNLREASRAY"
     polyA_signal    80280..80285
                     /experiment="consistent with mRNA sizes (sense unknown) in
                     strain NIA-3 (UL14, UL13, UL12)"
                     /inference="ab initio prediction:PolyADQ:"
                     /note="UL14, UL13, UL12, UL11"
     polyA_site      80300
                     /experiment="cDNA sequence in strain TNL (UL12)"
                     /note="UL14, UL13, UL12, UL11"
     repeat_region   80324..80545
                     /note="18 copies of a 12 bp repeat plus a partial copy of
                     5 bp"
                     /rpt_type=direct
                     /rpt_unit_seq="tgggggagagga"
     gene            complement(80753..82219)
                     /gene="UL10"
                     /locus_tag="SuHV1_gp48"
                     /note="core gene"
                     /db_xref="GeneID:2952500"
     polyA_signal    complement(80753..80758)
                     /gene="UL10"
                     /locus_tag="SuHV1_gp48"
                     /experiment="consistent with mRNA size and sense in strain
                     Ka"
                     /inference="ab initio prediction:PolyADQ:"
     CDS             complement(80754..81935)
                     /gene="UL10"
                     /locus_tag="SuHV1_gp48"
                     /function="virion morphogenesis"
                     /function="membrane fusion"
                     /note="complexed with type 1 envelope glycoprotein N"
                     /codon_start=1
                     /product="type 3 envelope glycoprotein M"
                     /protein_id="YP_068365.1"
                     /db_xref="GI:51557531"
                     /db_xref="GeneID:2952500"
                     /translation="MCGPRNAEAVSWRSWLIEVCGFALAALTLVLTLIFASLPEMGFP
                     CFYATVADYDTLNDTSGGVWTRQPLVAPALFLETPTVTSFFGFTATVLLAHALYAVAG
                     AVVLRREAGRLAFQPSVVLYAASTVAAPGTLMLGALCAWTLQAVVLLMAHKQAGLAAA
                     AYITHFVFLALFGACHACKGTGDVRAALAASPPLRRVAVHARAVVTNVVLGAVGLGAA
                     VVGLMLGVLLANSFHISLWKTAEAALAVFTLLALALMVFVEVVVSGYVQVLPTPAFCV
                     LVASAAFGVSAHRYFAKFSEALGETHGVVIGTRAVLAVLSLIALAMIVVRLVRACIAH
                     RARGSRFYANVDKARTTARRYLQKRLHGRGNDEYLLAPGSGDDEFDDGDEVVYENLGF
                     E"
     sig_peptide     complement(81819..81935)
                     /gene="UL10"
                     /locus_tag="SuHV1_gp48"
                     /inference="ab initio prediction:SignalP:"
     mat_peptide     complement(80757..81818)
                     /gene="UL10"
                     /locus_tag="SuHV1_gp48"
                     /product="type 3 envelope glycoprotein M"
                     /inference="ab initio prediction:SignalP:"
                     /protein_id="YP_068400.1"
                     /db_xref="GI:51557566"
     gene            81883..86521
                     /gene="UL9"
                     /locus_tag="SuHV1_gp49"
                     /note="core gene"
                     /db_xref="GeneID:2952547"
     TATA_signal     81883..81889
                     /gene="UL9"
                     /locus_tag="SuHV1_gp49"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    81907
                     /gene="UL9"
                     /locus_tag="SuHV1_gp49"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             81934..84465
                     /gene="UL9"
                     /locus_tag="SuHV1_gp49"
                     /function="DNA replication"
                     /codon_start=1
                     /product="DNA replication origin-binding helicase"
                     /protein_id="YP_068366.1"
                     /db_xref="GI:51557532"
                     /db_xref="GeneID:2952547"
                     /translation="MAADAGGRRGGAEEDGGAFASSVSLARMLYGCDLPAVVRSRWPG
                     VSLDLQRDAPVELPSPHDTACRRVLVARAPMGSGKTTALLKWLSAALAATDMSALVLS
                     CRRSFTRTLARRMDDAGLGFVTYFDSDAYVMTGRPYRRLLVQIESLHRVDEHLINNYD
                     VLVVDEVMSTLGQLYSPTMARLARVDALLARLLRGCPRVLVMDATINAQLVELLVELR
                     GEPSVHVVVSDYATTAFASRRCLVLRHLGAEVAAGAAGAREDGGGDGSEDAARAGSPA
                     PTTAAATTAVEAAGAAGDSFFGLLGARLAAGDNVCVFSSTLAFSELVARFCARFTPSV
                     LVLNSQRPPEDVGRWAVRALVYTTVVTVGLSFDAPHFHSMFAYVKPMAHGPDMASVYQ
                     STGRVRRLLRDELFVYVDGSGARGEPIFTPVLLNHVVGSGWPARLSQVTNLVCAQFQR
                     RCRPAFAAARGMRLFSRFKFKHLFERCTLTSVNDSLNILHALLENNRLRVALEGCEPP
                     LTARAFCDFLRDARLDAFASQQVLRQLRPPDRPVAADIADSGEVATFVEKYLVADVPE
                     DELQELLRALANPVTREQFVGLAVLGACARVPEALRSERVFGAVYGHYASGAVPVVAD
                     GRLELAALAPDFNVPARWALTRRCARVAEAAGLFEGASPEVDSAAVAAAAADAELAPL
                     LLEVLRCHVLDATTAARRPVRAALSALGAGGGAGPLSRGRHAALVFKVMWEEAFGVRV
                     GRSRQTFPGPTRVKNLRKAEIAALLRDAGLDPPAGATHRQLYALLMERRGDFAGERYK
                     LRLPAWSRLMYLTQGGFDAPLDAALSLVPAEAWPRTEGAVDFAAL"
     misc_feature    complement(82189)
                     /gene="UL10"
                     /locus_tag="SuHV1_gp48"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(82213..82219)
                     /gene="UL10"
                     /locus_tag="SuHV1_gp48"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    83053..84465
                     /note="originally annotated as UL8.5 CDS"
     gene            84322..86521
                     /gene="UL8"
                     /locus_tag="SuHV1_gp51"
                     /note="core gene"
                     /db_xref="GeneID:2952549"
     TATA_signal     84322..84328
                     /gene="UL8"
                     /locus_tag="SuHV1_gp51"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    84350
                     /gene="UL8"
                     /locus_tag="SuHV1_gp51"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             84462..86513
                     /gene="UL8"
                     /locus_tag="SuHV1_gp51"
                     /function="DNA replication"
                     /codon_start=1
                     /product="helicase-primase subunit"
                     /protein_id="YP_068368.1"
                     /db_xref="GI:51557534"
                     /db_xref="GeneID:2952549"
                     /translation="MTAAAGERVCAAGIYTAWTEPGAPGELHALAHLLCRDGAGAYAA
                     RFVHVTAAPWTGSAAAVAAALRDASGTGALADPALWRGAHGAVMAALRRALPALAFYE
                     PLRFETDPATNLVTAATPAGGGGEEETTGEGGEEDEDEAGPRAGIIHVDADVVVDRDA
                     ARAHATEAWLPHAQLRAMAGCAALSVEITTRRTSFARAYAEAGAPPLKRRGEMSDPFD
                     VRETVLRPAGRRVAARVLVPRGFDCLVAHGVSNAALVALYRRWHAAAYGAGDATPPVF
                     AFLGPELAREGADEDYYCALGFPLFATIKVAAAAPEAVRGALAAHRLTDGLWPALGFR
                     AFHALGPVSCGLRLRCDVWPAGRATSAVEHPCALRGAWLAKFDFAAFFPNLFLALCPG
                     HERLRRAVRARAVKPALVAFFGGLKHTCPEAYHSVIALANGVSRAVEAAAAEAGLVTC
                     AYVKDGFWGVLGDVPAAAPEAAAAAAAERVRVACEAAAARHLADAGAAATDVTLRCEG
                     VFDAALAWSCHAYWLRRREGPADFVGFPSRSGFGRAAKAALDALLREAVEGRADAEAA
                     RAACDGLVERAFASRHDPDFWAAPGDALAPAACAGATAGRGGARCSRRCVRLRGAGPV
                     PYEQLRPPLILPWIDCLAHMEPIFAALVGMYNRALEALSAGDAPPPFVFTYTPDAFLF
                     G"
     polyA_signal    86516..86521
                     /experiment="consistent with mRNA sizes (sense unknown) in
                     strain Ka"
                     /inference="ab initio prediction:PolyADQ:"
                     /note="UL9, UL8"
     gene            complement(86527..89301)
                     /gene="UL6"
                     /locus_tag="SuHV1_gp52"
                     /note="core gene"
                     /db_xref="GeneID:2952550"
     gene            complement(86527..87567)
                     /gene="UL7"
                     /locus_tag="SuHV1_gp53"
                     /note="core gene"
                     /db_xref="GeneID:2952509"
     polyA_signal    complement(86527..86532)
                     /experiment="consistent with mRNA sizes (sense unknown) in
                     strain Ka"
                     /inference="ab initio prediction:PolyADQ:"
                     /note="UL7, UL6"
     CDS             complement(86679..87479)
                     /gene="UL7"
                     /locus_tag="SuHV1_gp53"
                     /function="virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL7"
                     /protein_id="YP_068369.1"
                     /db_xref="GI:51557535"
                     /db_xref="GeneID:2952509"
                     /translation="MEAVMDELTWHALPRLVCEVREVPGLIPVFTSASVTDARVEGGA
                     LTLRLESGETVSCDEYRRRCLAGEAFRGFAFAVVTAAEDRVLSLAVPPVALPHRLALV
                     RPEDPTEFALCVLQMFLETCPAAEADAARCLSLGRWLERARAPPARKLRRLLHVGATR
                     ALNTLMFAAHLSPLDETRVLPHYPIAQRLLSAPRAPPVVDALFAAGFGPLLGLPGDAP
                     PPDGLVRTRPGGALTAPLRTPEMAEAVYRWWTTAPRALTEKTMFVRYE"
     CDS             complement(87370..89301)
                     /gene="UL6"
                     /locus_tag="SuHV1_gp52"
                     /function="DNA encapsidation"
                     /note="dodecamer located at one capsid vertex in place of
                     a penton"
                     /codon_start=1
                     /product="capsid portal protein"
                     /protein_id="YP_068370.1"
                     /db_xref="GI:51557536"
                     /db_xref="GeneID:2952550"
                     /translation="MSAATAAAADGLCPGGAAEEANNLLGAPSRILIHPTPRTMVFKE
                     ILMGNLGYTEGQGIYNSVRSTEAAVRQIQSTLLTRTLNAARYEDVARDWMAHLRARGL
                     GAEALARRFGDEAPAVAERLFDTWYRTLQMALLDFVRGIAACFSASESNGTASFAKYI
                     DWIVCLGVVPVRRARPGGKRRRERCVDEHDLAGHLRVAGSVLGQGLDEVAELAEAMRG
                     VTIMDYDRVQLYYEPRHRRVLARDALTGERGECLVLWQPLWRDGELLFDSPAQRVHGE
                     VLACHALREHARLCQLLNTAPVKVLVGRKPAEGHPAGAVEKMLGEDPAGSAAARLVRL
                     IVNMKGMRHIGDITETVRSYLDETGARILDSVDTSQPGFGHHGAGAQPVQDAFRTSVV
                     NSINGMLEGYVNNLFKTIESLKADNGGLREQVREREQEVRRLREQALRAAQAGADGTG
                     AAGPAGGRAPGAADGQPPRDLGHEVIDITRAMGDDAYVANSFQSRYVPPYESDVERLS
                     RLWEQELIRCFKLTRVANNQGQEVSVSYSNSSISLILAPYFFSILRVRHLGFLITSQE
                     VYRSEEDLCGVVFKKTRLEAYLTEIAALFAADVRRATERLRDGGRDGRADLARPPAAG
                     VRGARGARADPGLHERLGD"
     misc_feature    complement(87537)
                     /gene="UL7"
                     /locus_tag="SuHV1_gp53"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site; would generate an
                     N-terminally truncated translation product"
     misc_feature    complement(87538)
                     /gene="UL7"
                     /locus_tag="SuHV1_gp53"
                     /experiment="approximation (+/- 1 nt) of transcriptional
                     initation site from primer extension in strain Be"
                     /note="would generate an N-terminally truncated
                     translation product"
     TATA_signal     complement(87561..87567)
                     /gene="UL7"
                     /locus_tag="SuHV1_gp53"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    complement(89208)
                     /gene="UL6"
                     /locus_tag="SuHV1_gp52"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     misc_feature    complement(89212)
                     /gene="UL6"
                     /locus_tag="SuHV1_gp52"
                     /experiment="approximation (+/- 1 nt) of transcriptional
                     initation site from primer extension in strain Be"
     gene            89235..92399
                     /gene="UL5"
                     /locus_tag="SuHV1_gp54"
                     /note="core gene"
                     /db_xref="GeneID:2952510"
     TATA_signal     89235..89241
                     /gene="UL5"
                     /locus_tag="SuHV1_gp54"
                     /inference="ab initio prediction:TRANSFACFind:"
     TATA_signal     complement(89235..89241)
                     /gene="UL6"
                     /locus_tag="SuHV1_gp52"
                     /inference="ab initio prediction:TRANSFACFind:"
                     /note="low probability"
     misc_feature    89257
                     /gene="UL5"
                     /locus_tag="SuHV1_gp54"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     misc_feature    89262
                     /gene="UL5"
                     /locus_tag="SuHV1_gp54"
                     /experiment="approximation (+/- 1 nt) of transcriptional
                     initation site from primer extension in strain In-Fh"
     CDS             89300..91804
                     /gene="UL5"
                     /locus_tag="SuHV1_gp54"
                     /function="DNA replication"
                     /codon_start=1
                     /product="helicase-primase helicase subunit"
                     /protein_id="YP_068371.1"
                     /db_xref="GI:51557537"
                     /db_xref="GeneID:2952510"
                     /translation="MAAAAAAEGPRATNATYLNFTSMHGVEPIVERVRELAATPAEAP
                     PPLAWFKSLAAADNPVDIEALELPFAAYLISGNAGSGKSTCIQTLNETMDCVITGSTR
                     VAAQNVYAKLSAAYSSRYVNTIFQEFGFRGNHVQAQLGRYSYACPTSPPTVRELQKRD
                     LVYYWEVLQDISRRVLAGSHEEFARLRALERLTGRAAEHLAFACHGSLPAFARSNVIV
                     IDEAGLLGRHLLTAVVYCWWLINAAYDTTQYAARARPVLVCVGSPTQTDSLESRFEHA
                     RQLCRVRASENLLTYLITNRALREYTDLSRNWAIFINNKRCQEYEFGELMKALEYGLP
                     LTDEHLRLVDSFVVPEAYINNPANLQGWTRLYSSHREVSAYMSRLHAHLKVAGDAQFV
                     VFTLPAYTIVRTAAFDRYREATQQPHLTLDRWLAANAGRITNYSQSRDQDAAALRCEA
                     RAQQGVVLARCEVTYVLNSQVAVTTRLKKLVIGFSGTFEAFAAVLRDDAFVHAQGGSA
                     EYTYRFLSSLLFSGMIAFYNFLQRPGLAPEAVTAAYRRLAAVTAAALRVPEEHFDFSG
                     AAAPAAPAGPGGAPADDDDDLFAALSENMLDMLYCHYDFARPETTSEVYAQFLMLKTL
                     FADRYAALSELFGAAFARAPFETHVDSVSVRGCEVFMGGLRGALLSTALQTDSYTLVG
                     YTHATAPAFAEELARRKLHAGTAELLASLDTPRVVLRDQSGFLSILNVNLSDFVESLD
                     DLELDMATYVDYGISSKLAMTIARSQGLSLERVAVCFTRANLRMNSVYVAMSRVISSR
                     FLRMNMNPLREEPERDNGISEHILAALRDGAVHIVY"
     gene            91757..92399
                     /gene="UL4"
                     /locus_tag="SuHV1_gp55"
                     /db_xref="GeneID:2952526"
     TATA_signal     91757..91763
                     /gene="UL4"
                     /locus_tag="SuHV1_gp55"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    91783
                     /gene="UL4"
                     /locus_tag="SuHV1_gp55"
                     /experiment="approximation (+/- 1 nt) of transcriptional
                     initation site from primer extension in strain In-Fh"
     misc_feature    91789
                     /gene="UL4"
                     /locus_tag="SuHV1_gp55"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             91863..92300
                     /gene="UL4"
                     /locus_tag="SuHV1_gp55"
                     /function="unknown"
                     /note="colocalizes with regulatory protein ICP22 and
                     nuclear protein UL3 in small, dense nuclear bodies"
                     /codon_start=1
                     /product="nuclear protein UL4"
                     /protein_id="YP_068372.1"
                     /db_xref="GI:51557538"
                     /db_xref="GeneID:2952526"
                     /translation="MTALVAYSFYEIKLPGGWAQSGCGQTVCEYERGVRVMATDGCTR
                     CDALAPGRVTIQHGPVLTVLAVDGEPERCSYVFARTWPAAPEGALVMPFSTWSCAERS
                     RRLRGPAGGLLATLVVERALHVTITAYRPDVLRDALREARILE"
     TATA_signal     91895..91901
                     /gene="UL4"
                     /locus_tag="SuHV1_gp55"
     misc_feature    91925
                     /gene="UL4"
                     /locus_tag="SuHV1_gp55"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site; would generate an
                     N-terminally truncated translation product"
     polyA_signal    92394..92399
                     /experiment="consistent with mRNA sizes (sense unknown) in
                     strain In-Fh"
                     /inference="ab initio prediction:PolyADQ:"
                     /note="UL5, UL4"
     gene            complement(92475..95360)
                     /gene="UL1"
                     /locus_tag="SuHV1_gp56"
                     /note="core gene"
                     /db_xref="GeneID:2952527"
     gene            complement(92475..94940)
                     /gene="UL2"
                     /locus_tag="SuHV1_gp57"
                     /note="core gene"
                     /db_xref="GeneID:2952528"
     gene            complement(92475..94078)
                     /gene="UL3"
                     /locus_tag="SuHV1_gp58"
                     /db_xref="GeneID:2952501"
     gene            complement(92475..93362)
                     /gene="UL3.5"
                     /locus_tag="SuHV1_gp59"
                     /db_xref="GeneID:2952502"
     polyA_signal    complement(92475..92480)
                     /experiment="consistent with mRNA sizes and sense in
                     strain In-Fh"
                     /inference="ab initio prediction:PolyADQ:"
                     /note="UL3.5, UL3, UL2, UL1"
     CDS             complement(92476..93150)
                     /gene="UL3.5"
                     /locus_tag="SuHV1_gp59"
                     /function="possibly virion morphogenesis"
                     /codon_start=1
                     /product="protein ORF57"
                     /protein_id="YP_068373.1"
                     /db_xref="GI:51557539"
                     /db_xref="GeneID:2952502"
                     /translation="MSTFGRASVATVDDYHRFLQANETAARRLAAASRRVSAGGGETR
                     APRSSRGPPDEEAPLRAGGLGTARGRSRQRGATEPDPVYATVVQPTHHHHQQQHHHRS
                     QHPQQQQQQQQQQRAPRRRGSVHASATAAGGPESCAAAPPRRRGSVHASATAAPAVQL
                     PRPRQRSINASTTAAPTPQLPRPRQRSVHASARAAVPSAAALPRPRTPSRGRRAPPAS
                     CCYRDQ"
     CDS             complement(93147..93860)
                     /gene="UL3"
                     /locus_tag="SuHV1_gp58"
                     /function="unknown"
                     /note="colocalizes with regulatory protein ICP22 and
                     nuclear protein UL4 in small, dense nuclear bodies"
                     /codon_start=1
                     /product="nuclear protein UL3"
                     /protein_id="YP_068374.1"
                     /db_xref="GI:51557540"
                     /db_xref="GeneID:2952501"
                     /translation="MDGGERMMEPALAGAPASALPVLAVLREWGWAVEEVEPSGPRPE
                     DADAPPESAPPPREGVLGSEDGEGDVEDGEEGKATEKEETEDEEDGGDEGTTTAAAGP
                     RWAQHVEFDTLFMVASVDELGRRRLTDTIRRDLAAALAGLPVACTKTSAFARRARGPR
                     GAPGRGHKSLQMFILCRRAHAARVRDQLRSAVRARRPREPRARPTSGRARPAAPVFIH
                     EFITPEPVRLHRDNVFAAP"
     misc_feature    complement(93332)
                     /gene="UL3.5"
                     /locus_tag="SuHV1_gp59"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(93356..93362)
                     /gene="UL3.5"
                     /locus_tag="SuHV1_gp59"
                     /inference="ab initio prediction:TRANSFACFind:"
     CDS             complement(93916..94866)
                     /gene="UL2"
                     /locus_tag="SuHV1_gp57"
                     /EC_number="3.2.2.3"
                     /function="DNA repair"
                     /codon_start=1
                     /product="uracil-DNA glycosylase"
                     /protein_id="YP_068375.1"
                     /db_xref="GI:51557541"
                     /db_xref="GeneID:2952528"
                     /translation="MEGPPPSKRPCGLPPGVRLVVPAAAAASASNAATAAAAAAPAGA
                     GAGASKPARPSAAARPAKGTPAASAATTATGADASAPPPDPGAPTWDAFAAEFDVAPS
                     WRALLEPEIAKPYARLLLAEYRGRCLTEEVLPAREDVFAWTRLTAPEDVKVVIIGQDP
                     YHGPGQAHGLAFSVRRGVPIPPSLANIFAAVRATYPTLPAPAHGCLEAWARRGVLLLN
                     TTLTVRRGVPGSHAPLGWARLVRAVVQRLCETRPKLVFMLWGAHAQKACAPDPRRHKV
                     LTFSHPSPLARTPFRTCPHFGEANAYLVQTGRAPVDWSVD"
     misc_feature    complement(94047)
                     /gene="UL3"
                     /locus_tag="SuHV1_gp58"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(94072..94078)
                     /gene="UL3"
                     /locus_tag="SuHV1_gp58"
                     /inference="ab initio prediction:TRANSFACFind:"
     CDS             complement(94844..95314)
                     /gene="UL1"
                     /locus_tag="SuHV1_gp56"
                     /function="cell entry"
                     /function="cell-to-cell spread"
                     /note="complexed with type 1 envelope glycoprotein H"
                     /codon_start=1
                     /product="envelope glycoprotein L"
                     /protein_id="YP_068376.1"
                     /db_xref="GI:51557542"
                     /db_xref="GeneID:2952527"
                     /translation="MSPLVAVLVFFSAALGVPGTGVAGNPHGLDAIFEPPVTPAPPTR
                     APRREELEWDDEDHPLLGLEPPVGSRCHPYIAYSLPPDMTAVTSVVVKPYCSPPEVIL
                     WASGTAYLVNPFVAIQALAIGEPLNEAALKELGEVAVHKDSLPPLRYNGGPPAE"
     sig_peptide     complement(95267..95314)
                     /gene="UL1"
                     /locus_tag="SuHV1_gp56"
                     /inference="ab initio prediction:SignalP:"
     mat_peptide     complement(94847..95266)
                     /gene="UL1"
                     /locus_tag="SuHV1_gp56"
                     /product="envelope glycoprotein L"
                     /inference="ab initio prediction:SignalP:"
                     /protein_id="YP_068401.1"
                     /db_xref="GI:51557567"
     misc_feature    complement(94908)
                     /gene="UL2"
                     /locus_tag="SuHV1_gp57"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(94934..94940)
                     /gene="UL2"
                     /locus_tag="SuHV1_gp57"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    complement(95329)
                     /gene="UL1"
                     /locus_tag="SuHV1_gp56"
                     /experiment="approximation (+/- 1 nt) of transcriptional
                     initation site from primer extension in strain Ka"
     misc_feature    complement(95330)
                     /gene="UL1"
                     /locus_tag="SuHV1_gp56"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(95354..95360)
                     /gene="UL1"
                     /locus_tag="SuHV1_gp56"
                     /inference="ab initio prediction:TRANSFACFind:"
     repeat_region   95518..95623
                     /note="9 copies of an 11 bp repeat plus a partial copy of
                     7 bp"
                     /rpt_type=direct
                     /rpt_unit_seq="ggggggagtct"
     gene            96079..109118
                     /gene="LLT"
                     /locus_tag="SuHV1_gp60"
                     /db_xref="GeneID:2952511"
     TATA_signal     96079..96085
                     /gene="LLT"
                     /locus_tag="SuHV1_gp60"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    96111
                     /gene="LLT"
                     /locus_tag="SuHV1_gp60"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     misc_RNA        join(96112..97588,102241..109118)
                     /gene="LLT"
                     /locus_tag="SuHV1_gp60"
                     /product="large latency transcript"
                     /experiment="translational initiation site from primer
                     extension in strain Ka"
                     /note="contains ORF1, ORF2, ORF3"
                     /db_xref="GeneID:2952511"
     gene            complement(96247..97736)
                     /gene="EP0"
                     /locus_tag="SuHV1_gp61"
                     /db_xref="GeneID:2952512"
     polyA_site      complement(96247)
                     /gene="EP0"
                     /locus_tag="SuHV1_gp61"
                     /experiment="cDNA sequence from strain In-Fh"
     polyA_signal    complement(96268..96273)
                     /gene="EP0"
                     /locus_tag="SuHV1_gp61"
                     /experiment="consistent with mRNA size (sense unknown) in
                     strain In-Fh"
                     /inference="ab initio prediction:PolyADQ:"
     misc_feature    96313..97900
                     /note="derived from strain In-Fh"
     CDS             complement(96481..97584)
                     /gene="EP0"
                     /locus_tag="SuHV1_gp61"
                     /function="gene regulation"
                     /function="cellular protein degradation"
                     /function="reactivation from latency"
                     /note="contains a RING finger; disrupts ND10;
                     proteasome-dependent degradation of several cellular
                     proteins"
                     /codon_start=1
                     /product="ubiquitin E3 ligase ICP0"
                     /protein_id="YP_068377.2"
                     /db_xref="GI:126802154"
                     /db_xref="GeneID:2952512"
                     /translation="MDCPICLDVAATEAQTLPCMHKFCLDCIQRWTLTSTACPLCNAR
                     VTSILHHVDSDASFVETPVEGATDVDGEEDEPVGGGFAVIWGEDYTEEVRHEEAEGQG
                     SGSGSRARPRVPVFNWLYGQVSTVIESDPIREAVVDNIVEIIQEHGMNRQRVTEAMLP
                     MFGANTHALVDTLFDISAQWMRRMQRRAPMSHQGVNYIDTSESEAHSDSEVSSPDEED
                     SGASSSGVHTEDLTEASESADDQRPAPRRSPRRARRAAVLRREQRRTRCLRRGRTGGQ
                     AQGETPEAPSSGEGSSAQHGASGAGAGPGSANTAASARSSPSSSPSSSMRRPSPSASA
                     PETAAPRGGPPASSSSGSPRSATIFIDLTQDDD"
     misc_feature    96506..96997
                     /gene="LLT"
                     /locus_tag="SuHV1_gp60"
                     /note="originally annotated as LLT ORF1 CDS"
     misc_feature    join(96700..97588,102241..102464)
                     /gene="LLT"
                     /locus_tag="SuHV1_gp60"
                     /note="originally annotated as LLT ORF2 CDS"
     misc_feature    96729..97157
                     /gene="LLT"
                     /locus_tag="SuHV1_gp60"
                     /note="originally annotated as LLT ORF3 CDS"
     misc_feature    complement(97707)
                     /gene="EP0"
                     /locus_tag="SuHV1_gp61"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(97730..97736)
                     /gene="EP0"
                     /locus_tag="SuHV1_gp61"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    complement(97754)
                     /experiment="approximation (+/- 1 nt) of transcriptional
                     initation site from primer extension in strain In-Fh"
                     /note="EP0; would generate an N-terminally extended
                     translation product"
     misc_feature    97885..119417
                     /note="derived from strain Ka"
     repeat_unit     101141..117942
                     /note="IRS; inverted repeat flanking US"
     repeat_region   101376..101501
                     /note="5 copies of a 22 bp repeat plus a partial copy of
                     16 bp"
                     /rpt_type=direct
                     /rpt_unit_seq="gcataacccctccccctaatct"
     repeat_region   101650..101791
                     /note="2 copies of a 63 bp repeat plus a partial copy of
                     16 bp"
                     /rpt_type=direct
                     /rpt_unit_seq="ccggacgtgacgccggtccccacggatctcatctgcatatcgc
                     gccggccccttccgcttccc"
     misc_feature    102007..107208
                     /note="originally annotated as ORF-3 CDS; not conserved
                     among strains"
     gene            complement(102696..107804)
                     /gene="IE180"
                     /locus_tag="SuHV1_gp63"
                     /db_xref="GeneID:2952540"
     polyA_site      complement(102696)
                     /gene="IE180"
                     /locus_tag="SuHV1_gp63"
                     /experiment="from S1 mapping in strain Ka and cDNA
                     sequence in strain In-Fh"
     polyA_signal    complement(102714..102719)
                     /gene="IE180"
                     /locus_tag="SuHV1_gp63"
                     /experiment="consistent with mRNA size (sense unknown) in
                     strain In-Fh"
                     /inference="ab initio prediction:PolyADQ:"
     CDS             complement(103171..107511)
                     /gene="IE180"
                     /locus_tag="SuHV1_gp63"
                     /function="gene regulation"
                     /codon_start=1
                     /product="transcriptional regulator ICP4"
                     /protein_id="YP_068382.1"
                     /db_xref="GI:51557548"
                     /db_xref="GeneID:2952540"
                     /translation="MADDLFDFIETEGNFSQLLAAAAAAEEEGIASGPDGGSQGSRRR
                     GSSGEDLLFGPGGLFSDDAAEAEAAVLAAAAGATRPPRPPSAQQQQQPRRGSGEIVVL
                     DDEDEEEDEPGSPAAGSPGRALHQGSEHGHLVLGPRSRAGSGPRPPTPAALAAAEAGA
                     PGGPGRSSPSAASPASSSGSPGPSAAPRRWSPARGDPVGEPGPAARPRTPAPPAQPAA
                     VAAAPARRGPASPASPAAGPVSAPGGGGAPSAGGDRGRHHHQHREPLLDEPAAARRLD
                     PRPLGARSPVSSNPNSNSNSTTTVAVETVARGPEKDEDGLGLAGDGGAPPQRQPRRRR
                     AGEGALRRGRGFSSSSSSGSDSDLSPARSPSAPRAPAAAARRSASSSSSSSSSSSSSS
                     SSSSSEGEEDEGVRPGAPLARAGPPPSPPAPAAAPRPSASSASSSAAASPAPAPEPAR
                     PPRRKRRSTNNHLSLMADGPPPTDGPLLTPLGEPWPGSDPPADGRVRYGGAGDSREGL
                     WDEDDVRQAAARYRAAAGPVPVFIPEMGDSRKQHEALVRLIYSGAAGEAMSWLQNPRM
                     QAPDQRFNQFCQRRVHAPHGHGSFITGSVTPPLPHIGDAMAAQDPLWALPHAVSAVAM
                     SRRYDRTQKTFILQSLRRAYADMAYPGRAADPRAGEATVEALCARVRAAFAAAQPGRV
                     PRELADACVLACRGVLERLLPCPLRLPAPARAPAALGPACLEEVTAALLALRDAIPGA
                     GPAERRQAADSVALVARTVAPLVRYSVDGARAREAAWTYAAALFAPANVAAARLAEAA
                     ARPGPAEPAPGLPPLWPEQPGLVVPAPAPAAAGAPSGLPGSGPSSPASTKSSSSTKSS
                     SSTKSGLSGSSGYASSPAAGPDPAPERRKKKRRAPGARRPGDGEEDEGLSGAALRGDG
                     HGHRDDEEDRGPRRKRRSLGLGPAPDPAPALLSSSSSSSEDDRLRRPLGPMPEHPAPD
                     GGFRRVPAGETHTPRPSEAALAAYCPPEVARALVDQEVFPELWRPALTFDPAALAHIA
                     ARRGAPLRRRAAWMRQIADPEDVRVVVLYDPLPHEELCAEPAEGAPRPAWDPRRGGLS
                     ALLAAFAHRLCTPDSHAWAGNWTGRPDIGRLNAQGVLLLSARDLGFAGAVEYLCSRLG
                     AARRRLIVLDTIEDWPADGPAVGDYHVYVRVRLDPAAQCAVRWPGCRELRAAVLDSSS
                     IVGPACFARVEASFARLHPGAEPLRLCRQDNVRYTVSTRAGPRTPVPLPPRAYRQRVL
                     PTVDGCKDMARQRSALGLGDPDFDAGAAFGHRAANRWGLGAPLRPVFVSCGRRGLAEL
                     RGPEGLPAELRAFCAAALLEPDAEAAPLVLTPGAVAAAGAPPAVLWDFAPFETSVRAA
                     AGGAVETHRPAGASGAGAGPGEDGDSVEIVGVRGGDGRPRGPLGPIKVEAISDDEEAE
                     DAGNPYLLLR"
     misc_feature    complement(107773)
                     /gene="IE180"
                     /locus_tag="SuHV1_gp63"
                     /experiment="approximation (+/- 1 nt) of transcriptional
                     initation site from S1 mapping in strain Ka and primer
                     extension in strain In-Fh"
                     /inference="ab initio prediction:NNPP:"
     TATA_signal     complement(107798..107804)
                     /gene="IE180"
                     /locus_tag="SuHV1_gp63"
                     /inference="ab initio prediction:TRANSFACFind:"
     repeat_region   108494..108688
                     /note="10 copies of a 19 bp repeat plus a partial copy of
                     5 bp"
                     /rpt_type=direct
                     /rpt_unit_seq="gtggtctctgtgttgtgtg"
     polyA_signal    109092..109097
                     /gene="LLT"
                     /locus_tag="SuHV1_gp60"
                     /experiment="consistent with mRNA size (sense unknown) in
                     strain Be"
                     /inference="ab initio prediction:PolyADQ:"
     polyA_site      109118
                     /gene="LLT"
                     /locus_tag="SuHV1_gp60"
                     /experiment="cDNA sequence in strain Be"
     repeat_region   114359..115158
                     /note="2 copies of an imperfect 280-281 bp repeat plus a
                     partial copy of 239 bp"
                     /rpt_type=direct
     stem_loop       114392..114451
                     /note="oriS palindrome"
     protein_bind    114393..114400
                     /bound_moiety="DNA replication origin-binding helicase"
     protein_bind    complement(114443..114450)
                     /bound_moiety="DNA replication origin-binding helicase"
     stem_loop       114672..114731
                     /note="oriS palindrome"
     protein_bind    114673..114680
                     /bound_moiety="DNA replication origin-binding helicase"
     protein_bind    complement(114723..114730)
                     /bound_moiety="DNA replication origin-binding helicase"
     stem_loop       114951..115010
                     /note="oriS palindrome"
     protein_bind    114952..114959
                     /bound_moiety="DNA replication origin-binding helicase"
     protein_bind    complement(115002..115009)
                     /bound_moiety="DNA replication origin-binding helicase"
     gene            115211..117215
                     /gene="US1"
                     /locus_tag="SuHV1_gp64"
                     /db_xref="GeneID:2952489"
     TATA_signal     115211..115217
                     /gene="US1"
                     /locus_tag="SuHV1_gp64"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    115241
                     /gene="US1"
                     /locus_tag="SuHV1_gp64"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     intron          115396..115516
                     /gene="US1"
                     /locus_tag="SuHV1_gp64"
                     /experiment="cDNA sequence in strain Ka"
     intron          115570..115724
                     /gene="US1"
                     /locus_tag="SuHV1_gp64"
                     /experiment="cDNA sequence in strain Ka"
     CDS             115995..117089
                     /gene="US1"
                     /locus_tag="SuHV1_gp64"
                     /function="gene regulation"
                     /function="cell cycle regulation"
                     /note="required for expression of a subset of late genes"
                     /codon_start=1
                     /product="regulatory protein ICP22"
                     /protein_id="YP_068383.1"
                     /db_xref="GI:51557549"
                     /db_xref="GeneID:2952489"
                     /translation="MDRVWADWYEPVPSPPFSPVDPPGPRPTTPVPGSSPPSPASTPT
                     PPKRGRYVVEHPEYGPPPDPEEVRVHGARGPGAFCAAPWRPDTRRLGADVNRLFRGIA
                     VSAADVTGDTRALRRALFDFYAMGYTRQRPSAPCWQALLQLSPEQSAPLRSALRELNE
                     RDVYDPRVLSPPVIEGPLFGEECDVDEDDAGSDTTVASEFSFRGSVCEDDGEDEDEEE
                     DGEEEDEDEEGEEEEDEEEEEGDEDGETDVYEEDDEAEDEEDEEDGDDFDGASVGDDD
                     VFEPPEDGSDGEGSGSDDGGDGEDEDEDEDEDEDEDDGEDEEDEEGEDGGEDGEDGEE
                     DEDEDGEGEEGGKDAARRGTRAPTRPAAAP"
     polyA_signal    117191..117196
                     /gene="US1"
                     /locus_tag="SuHV1_gp64"
                     /experiment="consistent with mRNA size and sense in strain
                     Ka"
                     /inference="ab initio prediction:PolyADQ:"
     polyA_site      117215
                     /gene="US1"
                     /locus_tag="SuHV1_gp64"
                     /experiment="cDNA sequence in strain TNL"
     repeat_region   117279..117687
                     /note="11 copies of a 35 bp repeat plus a partial copy of
                     24 bp"
                     /rpt_type=direct
                     /rpt_unit_seq="ggggtggagacggtggagggagaggggagtgggat"
     repeat_region   117752..117841
                     /note="9 copies of a 10 bp repeat"
                     /rpt_type=direct
                     /rpt_unit_seq="gggggagtcc"
     misc_feature    117943..126659
                     /note="US"
     TATA_signal     118076..118082
                     /inference="ab initio prediction:TRANSFACFind:"
                     /note="US3; low probability"
     misc_feature    118108
                     /experiment="approximation (+/- 13 nt) of transcriptional
                     initation site from S1 mapping in strain NIA-3"
                     /inference="ab initio prediction:NNPP:"
                     /note="US3; possible minor transcript would generate an
                     N-terminally extended translation product"
     gene            118239..120956
                     /gene="US3"
                     /locus_tag="SuHV1_gp65"
                     /db_xref="GeneID:2952561"
     TATA_signal     118239..118245
                     /gene="US3"
                     /locus_tag="SuHV1_gp65"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    118266
                     /gene="US3"
                     /locus_tag="SuHV1_gp65"
                     /experiment="approximation (+/- 5 nt) of transcriptional
                     initation site from S1 mapping in strain NIA-3"
     misc_feature    118268
                     /gene="US3"
                     /locus_tag="SuHV1_gp65"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             118332..119336
                     /gene="US3"
                     /locus_tag="SuHV1_gp65"
                     /EC_number="2.7.11.1"
                     /function="protein phosphorylation"
                     /function="apoptosis"
                     /function="nuclear egress"
                     /note="tegument protein; phosphorylates nuclear egress
                     lamina protein; mediates phosphorylation of HDAC1 and
                     HDAC2 and other cellular and viral proteins"
                     /codon_start=1
                     /product="serine/threonine protein kinase US3"
                     /protein_id="YP_068384.2"
                     /db_xref="GI:126802155"
                     /db_xref="GeneID:2952561"
                     /translation="MADAGIPDEILYSDISDDEIIIDGDGDSSGDEDDDDGGLTRQAA
                     ARIVTDLGFEVLQPLQSGSEGRVFVARRPGEADTVVLKVGQKPSTLMEGMLLQRLSHD
                     NVMRMKQMLARGPATCLVLPHFRCDLYSYLTMRDGPLDMRDAGCVIRAVLRGLAYLHG
                     MRIMHRDVKAENIFLEDVDTVCLGDLGAARCNVAAPNFYGLAGTIETNAPEVLARDRY
                     DTKVDVWGAGVVLFETLAYPKTITGGDEPAINGEMHLIDLIRALGVHPEEFPPDTRLR
                     SEFVRYAGTHRQPYTQYARVARLGLPETGAFLIYKMLTFDPVRRPSADEILNFGMWTV"
     gene            119332..120956
                     /gene="US4"
                     /locus_tag="SuHV1_gp67"
                     /db_xref="GeneID:2952520"
     TATA_signal     119332..119338
                     /gene="US4"
                     /locus_tag="SuHV1_gp67"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    119343..121036
                     /note="derived from strain Rice"
     misc_feature    119363
                     /gene="US4"
                     /locus_tag="SuHV1_gp67"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             119396..120892
                     /gene="US4"
                     /locus_tag="SuHV1_gp67"
                     /function="cell-to-cell spread"
                     /note="related to type 1 envelope glycoproteins D and I"
                     /codon_start=1
                     /product="type 1 envelope glycoprotein G"
                     /protein_id="YP_068386.1"
                     /db_xref="GI:51557552"
                     /db_xref="GeneID:2952520"
                     /translation="MKWATWILALGLLVVRTVVAREAPRELCYGHPVHDDRRPVGPAT
                     DAQPVNPLAPANATGTDYSRGCEMRLLDPPLDVSSRSSDPVNVTVAWFFDGGHCKVPL
                     VHREYYGCPGDAMPSVETCTGGYSYTRTRIDTLMEYALVNASLVLQPGLYDAGLYIVV
                     LVFGDDAYLGTVSLSVEANLDYPCGMKHGLTITRPGATLPPIAPTAGDHQRWRGCFPS
                     TDEGAWENVTAAEKGLSDDYADYYDVHIFRSESDDEVVHGDAPEAPEGEEVTEEEAEL
                     TSSDLDNIEIEVVGSPAAPAEGPATEEGRGAEEDEELTSSDLDNIEIEVVGSPRPPAS
                     SPPPPPPRPHPRGRDHDHDHGHHRADDRGPQRHHRLPPEPTFVSPSDIFVTPTGSPAL
                     LLGFLGSALASRPLHLTAGETAQHVREAQQKSRHIRSLGGLQLSVETETTNTTTTQTG
                     LSGDIRTSIYICVALAGLVVVGIVIMCLHMAIIRARARNDGYRHVASA"
     sig_peptide     119396..119455
                     /gene="US4"
                     /locus_tag="SuHV1_gp67"
                     /inference="ab initio prediction:SignalP:"
     mat_peptide     119456..120889
                     /gene="US4"
                     /locus_tag="SuHV1_gp67"
                     /product="type 1 envelope glycoprotein G"
                     /inference="ab initio prediction:SignalP:"
                     /protein_id="YP_068402.1"
                     /db_xref="GI:51557568"
     repeat_region   120218..120378
                     /note="1 copy of a 111 bp repeat plus a partial copy of 50
                     bp"
                     /rpt_type=direct
                     /rpt_unit_seq="gagctgacctccagcgacctcgacaacatcgagatcgaggtcg
                     tgggctctcccgccgctcccgccgagggcccggcgacggaggaggggcgcggggccga
                     ggaggacgag"
     polyA_signal    120951..120956
                     /experiment="consistent with mRNA size (sense unknown) in
                     strain Ka (US4)"
                     /experiment="consistent with mRNA size and sense in strain
                     NIA-3 (US3)"
                     /experiment="consistent with mRNA sizes and sense in
                     strain Ka"
                     /inference="ab initio prediction:PolyADQ:"
                     /note="US3, US4"
     gene            121024..123398
                     /gene="US6"
                     /locus_tag="SuHV1_gp68"
                     /db_xref="GeneID:2952521"
     TATA_signal     121024..121030
                     /gene="US6"
                     /locus_tag="SuHV1_gp68"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    121033..122622
                     /note="derived from strain Ka"
     misc_feature    121054
                     /gene="US6"
                     /locus_tag="SuHV1_gp68"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     misc_feature    121059
                     /gene="US6"
                     /locus_tag="SuHV1_gp68"
                     /experiment="approximation (+/- 10 nt) of transcriptional
                     initation site from S1 mapping in strain In-Fh"
     CDS             121075..122277
                     /gene="US6"
                     /locus_tag="SuHV1_gp68"
                     /function="cell attachment"
                     /note="binds cell surface receptors; related to type 1
                     envelope glycoproteins G and I"
                     /codon_start=1
                     /product="type 1 envelope glycoprotein D"
                     /protein_id="YP_068387.1"
                     /db_xref="GI:51557553"
                     /db_xref="GeneID:2952521"
                     /translation="MLLAALLAALVARTTLGADVDAVPAPTFPPPAYPYTESWQLTLT
                     TVPSPFVGPADVYHTRPLEDPCGVVALISDPQVDRLLNEAVAHRRPTYRAHVAWYRIA
                     DGCAHLLYFIEYADCDPRQIFGRCRRRTTPMWWTPSADYMFPTEDELGLLMVAPGRFN
                     EGQYRRLVSVDGVNILTDFMVALPEGQECPFARVDQHRTYKFGACWNDESFRRGVDVM
                     RFLTPFYQQPPHREVVNYWYRKNGRTLPRAYAAATPYAIDPARPSAGSPRPRPRPRPR
                     PKPEPAPVTPAPPGRLPEPATRDHAAGGHPTPRPPRPETPHRPFAPPAVVPSGWPQPA
                     EPFQPRTPAAPGVSRHRSVIVGTGTAMGALLVGVCVYIFFRLRGAKGYRLLGGPADTD
                     ELKAQPGP"
     sig_peptide     121075..121125
                     /gene="US6"
                     /locus_tag="SuHV1_gp68"
                     /inference="ab initio prediction:SignalP:"
     mat_peptide     121126..122274
                     /gene="US6"
                     /locus_tag="SuHV1_gp68"
                     /product="type 1 envelope glycoprotein D"
                     /inference="ab initio prediction:SignalP:"
                     /protein_id="YP_068403.1"
                     /db_xref="GI:51557569"
     gene            122253..123398
                     /gene="US7"
                     /locus_tag="SuHV1_gp69"
                     /db_xref="GeneID:2952516"
     TATA_signal     122253..122259
                     /gene="US7"
                     /locus_tag="SuHV1_gp69"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    122285
                     /gene="US7"
                     /locus_tag="SuHV1_gp69"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             122298..123398
                     /gene="US7"
                     /locus_tag="SuHV1_gp69"
                     /function="cell-to-cell spread"
                     /note="complexed with type 1 envelope glycoprotein E to
                     form an Fc-receptor; related to type 1 envelope
                     glycoproteins G and D"
                     /codon_start=1
                     /product="type 1 envelope glycoprotein I"
                     /protein_id="YP_068388.1"
                     /db_xref="GI:51557554"
                     /db_xref="GeneID:2952516"
                     /translation="MMMVARDVTRLPAGLLLAALTLAALTPRVGGVLFRGAGVSVHVA
                     GSAVLVPGDAPNLTIDGTLLFLEGPSPSNYSGRVELLRLDPKRACYTREYAAEYDLCP
                     RVHHEAFRGCLRKREPLARRASAAVEARRLLFVSRPAPPDAGSYVLRVRVNGTTDLFV
                     LTALVPPRGRPHHPTPSSADECRPVVGSWHDSLRVVDPAEDAVFTTPPPIEPEPPTTP
                     APPRGTGATPEPRSDEEEEDEEGATTAMTPVPGTLDANGTMVLNASVVSRVLLAAANA
                     TAGARGPGKIAMVLGPTIVVLLIFLGGVACAARRCARNRIYRPRPGRGPAVHAPPPRR
                     PPPSPVAGAPVPQPKMTLAELRQKLATIAEEQ"
     sig_peptide     122298..122390
                     /gene="US7"
                     /locus_tag="SuHV1_gp69"
                     /inference="ab initio prediction:SignalP:"
     mat_peptide     122391..123395
                     /gene="US7"
                     /locus_tag="SuHV1_gp69"
                     /product="type 1 envelope glycoprotein I"
                     /inference="ab initio prediction:SignalP:"
                     /protein_id="YP_068404.1"
                     /db_xref="GI:51557570"
     variation       122566..126048
                     /note="in attenuated strain Bartha"
     misc_feature    123212..123411
                     /note="derived from strain Ka"
     misc_feature    123311..125923
                     /note="derived from strain Be"
     polyA_site      123382
                     /experiment="approximation (+/- 90 nt) from S1 mapping in
                     strain In-Fh (US6)"
                     /note="US6, US7"
     polyA_signal    123394..123398
                     /inference="ab initio prediction:PolyADQ:"
                     /note="US6, US7"
     gene            123452..125732
                     /gene="US8"
                     /locus_tag="SuHV1_gp70"
                     /db_xref="GeneID:2952517"
     TATA_signal     123452..123458
                     /gene="US8"
                     /locus_tag="SuHV1_gp70"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    123469
                     /gene="US8"
                     /locus_tag="SuHV1_gp70"
                     /experiment="approximation (+/- 20 nt) of transcriptional
                     initation site from S1 mapping in strain In-Fh"
     misc_feature    123484
                     /gene="US8"
                     /locus_tag="SuHV1_gp70"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             123502..125235
                     /gene="US8"
                     /locus_tag="SuHV1_gp70"
                     /function="cell-to-cell spread"
                     /note="complexed with type 1 envelope glycoprotein I to
                     form an Fc-receptor"
                     /codon_start=1
                     /product="type 1 envelope glycoprotein E"
                     /protein_id="YP_068389.1"
                     /db_xref="GI:51557555"
                     /db_xref="GeneID:2952517"
                     /translation="MRPFLLRAAQLLALLALALSTEAPSLSAETTPGPVTEVPSPSAE
                     VWDLSTEAGDDDLDGDLNGDDRRAGFGSALASLREAPPAHLVNVSEGANFTLDARGDG
                     AVVAGIWTFLPVRGCDAVAVTMVCFETACHPDLVLGRACVPEAPERGIGDYLPPEVPR
                     LQREPPIVTPERWSPHLTVRRATPNDTGLYTLHDASGPRAVFFVAVGDRPPAPLAPVG
                     PARHEPRFHALGFHSQLFSPGDTFDLMPRVVSDMGDSRENFTATLDWYYARAPPRCLL
                     YYVYEPCIYHPRAPECLRPVDPACSFTSPARARLVARRAYASCSPLLGDRWLTACPFD
                     AFGEEVHTNATADESGLYVLVMTHNGHVATWDYTLVATAAEYVTVIKELTAPARAPGT
                     PWGPGGGDDAIYVDGVTTPAPPARPWNPYGRTTPGRLFVLALGSFVMTCVVGGAVWLC
                     VLCSRRRAASRPFRVPTRAGTRMLSPVYTSLPTHEDYYDGDDDDEEAGDARRRPSSPG
                     GDSGYEGPYVSLDAEDEFSSDEDDGLYVRPEEAPRSGFDVWFRDPEKPEVTNGPNYGV
                     TASRLLNARPA"
     sig_peptide     123502..123585
                     /gene="US8"
                     /locus_tag="SuHV1_gp70"
                     /inference="ab initio prediction:SignalP:"
     mat_peptide     123586..125232
                     /gene="US8"
                     /locus_tag="SuHV1_gp70"
                     /product="type 1 envelope glycoprotein E"
                     /inference="ab initio prediction:SignalP:"
                     /protein_id="YP_068405.1"
                     /db_xref="GI:51557571"
     gene            125231..125732
                     /gene="US9"
                     /locus_tag="SuHV1_gp71"
                     /db_xref="GeneID:2952552"
     TATA_signal     125231..125237
                     /gene="US9"
                     /locus_tag="SuHV1_gp71"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    125261
                     /gene="US9"
                     /locus_tag="SuHV1_gp71"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     CDS             125293..125589
                     /gene="US9"
                     /locus_tag="SuHV1_gp71"
                     /function="axonal transport"
                     /note="tegument-associated; localizes envelope proteins;
                     upstream ATG initiation codon is functional if predicted
                     initiation codon is mutated"
                     /codon_start=1
                     /product="type 2 membrane protein US9"
                     /protein_id="YP_068390.1"
                     /db_xref="GI:51557556"
                     /db_xref="GeneID:2952552"
                     /translation="MDTFDPSAPVPTSVSNPAADVLLAPKGPRSPLRPQDDSDCYYSE
                     SDNETPSEFLRRVGRRQAARRRRRRCLMGVAISAAALVICSLSALIGGIIARHV"
     gene            125697..126633
                     /gene="US2"
                     /locus_tag="SuHV1_gp72"
                     /db_xref="GeneID:2952553"
     TATA_signal     125697..125703
                     /gene="US2"
                     /locus_tag="SuHV1_gp72"
                     /inference="ab initio prediction:TRANSFACFind:"
     polyA_signal    125697..125702
                     /inference="ab initio prediction:PolyADQ:"
                     /note="US8, US9"
     misc_feature    125717..126608
                     /note="derived from strain NIA-3"
     misc_feature    125726
                     /experiment="approximation (+/- 10 nt) of transcriptional
                     initation site from S1 mapping in strain NIA-3"
                     /inference="ab initio prediction:NNPP:"
                     /note="US2"
     polyA_site      125732
                     /experiment="cDNA sequence in strain TNL"
                     /note="US8, US9"
     CDS             125811..126581
                     /gene="US2"
                     /locus_tag="SuHV1_gp72"
                     /function="unknown"
                     /note="possibly envelope-associated; interacts with
                     cytokeratin 18"
                     /codon_start=1
                     /product="virion protein US2"
                     /protein_id="YP_068391.1"
                     /db_xref="GI:51557557"
                     /db_xref="GeneID:2952553"
                     /translation="MGVTAITVVTLMDGSGRIPAFVGEAHPDLWKVLTEWCYASLVQQ
                     RRAADEDTPRQHVVLRSSEIAPGSLALLPRATRPVVRTRSDPTAPFYITTETHELTRR
                     PPADGSKPGEPLRISPPPRLDTEWSSVINGIQYLNSGARGTAPIHLWILGAADLCDQV
                     LLAASRSTAAGAPGAPTGARLTRRRPGLTDADALDVIVAGIPATRAMFARVHNRSWRH
                     AGEWTEALHAQIVTRGDVRRRRGGRGNGRERAPRCTIS"
     misc_feature    126409..143461
                     /note="derived from strain Ka"
     polyA_signal    126628..126633
                     /gene="US2"
                     /locus_tag="SuHV1_gp72"
                     /experiment="consistent with mRNA size and sense in strain
                     NIA-3"
                     /inference="ab initio prediction:PolyADQ:"
     polyA_site      126640
                     /experiment="approximation (+/- 12 nt) from S1 mapping in
                     strain In-Fh"
     repeat_unit     126660..143461
                     /note="TRS; inverted repeat flanking US"
     repeat_region   complement(126761..126850)
                     /note="9 copies of a 10 bp repeat"
                     /rpt_type=direct
                     /rpt_unit_seq="gggggagtcc"
     repeat_region   complement(126915..127323)
                     /note="11 copies of a 35 bp repeat plus a partial copy of
                     24 bp"
                     /rpt_type=direct
                     /rpt_unit_seq="ggggtggagacggtggagggagaggggagtgggat"
     gene            complement(127387..129391)
                     /gene="US1"
                     /locus_tag="SuHV1_gp73"
                     /db_xref="GeneID:2952551"
     polyA_site      complement(127387)
                     /gene="US1"
                     /locus_tag="SuHV1_gp73"
                     /experiment="cDNA sequence in strain TNL"
     polyA_signal    complement(127406..127411)
                     /gene="US1"
                     /locus_tag="SuHV1_gp73"
                     /experiment="consistent with mRNA size and sense in strain
                     Ka"
                     /inference="ab initio prediction:PolyADQ:"
     CDS             complement(127513..128607)
                     /gene="US1"
                     /locus_tag="SuHV1_gp73"
                     /function="gene regulation"
                     /function="cell cycle regulation"
                     /note="required for expression of a subset of late genes"
                     /codon_start=1
                     /product="regulatory protein ICP22"
                     /protein_id="YP_068392.1"
                     /db_xref="GI:51557558"
                     /db_xref="GeneID:2952551"
                     /translation="MDRVWADWYEPVPSPPFSPVDPPGPRPTTPVPGSSPPSPASTPT
                     PPKRGRYVVEHPEYGPPPDPEEVRVHGARGPGAFCAAPWRPDTRRLGADVNRLFRGIA
                     VSAADVTGDTRALRRALFDFYAMGYTRQRPSAPCWQALLQLSPEQSAPLRSALRELNE
                     RDVYDPRVLSPPVIEGPLFGEECDVDEDDAGSDTTVASEFSFRGSVCEDDGEDEDEEE
                     DGEEEDEDEEGEEEEDEEEEEGDEDGETDVYEEDDEAEDEEDEEDGDDFDGASVGDDD
                     VFEPPEDGSDGEGSGSDDGGDGEDEDEDEDEDEDEDDGEDEEDEEGEDGGEDGEDGEE
                     DEDEDGEGEEGGKDAARRGTRAPTRPAAAP"
     intron          complement(128878..129032)
                     /gene="US1"
                     /locus_tag="SuHV1_gp73"
                     /experiment="cDNA sequence in strain Ka"
     intron          complement(129086..129206)
                     /gene="US1"
                     /locus_tag="SuHV1_gp73"
                     /experiment="cDNA sequence in strain Ka"
     misc_feature    complement(129361)
                     /gene="US1"
                     /locus_tag="SuHV1_gp73"
                     /inference="ab initio prediction:NNPP:"
                     /note="transcriptional initiation site"
     TATA_signal     complement(129385..129391)
                     /gene="US1"
                     /locus_tag="SuHV1_gp73"
                     /inference="ab initio prediction:TRANSFACFind:"
     repeat_region   complement(129444..130243)
                     /note="2 copies of an imperfect 280-281 bp repeat plus a
                     partial copy of 239 bp"
                     /rpt_type=direct
     stem_loop       complement(129592..129651)
                     /note="oriS palindrome"
     protein_bind    129593..129600
                     /bound_moiety="DNA replication origin-binding helicase"
     protein_bind    complement(129643..129650)
                     /bound_moiety="DNA replication origin-binding helicase"
     stem_loop       129871..129930
                     /note="oriS palindrome"
     protein_bind    129872..129879
                     /bound_moiety="DNA replication origin-binding helicase"
     protein_bind    complement(129922..129929)
                     /bound_moiety="DNA replication origin-binding helicase"
     stem_loop       130151..130210
                     /note="oriS palindrome"
     protein_bind    130152..130159
                     /bound_moiety="DNA replication origin-binding helicase"
     protein_bind    complement(130202..130209)
                     /bound_moiety="DNA replication origin-binding helicase"
     polyA_site      complement(135484)
                     /experiment="cDNA sequence in strain Be"
                     /note="LLT; inverted duplicate of feature in IRS"
     polyA_signal    complement(135505..135510)
                     /experiment="consistent with mRNA size (sense unknown) in
                     strain Be"
                     /inference="ab initio prediction:PolyADQ:"
                     /note="LLT; inverted duplicate of feature in IRS"
     repeat_region   complement(135914..136117)
                     /note="10 copies of a 19 bp repeat plus a partial copy of
                     5 bp"
                     /rpt_type=direct
                     /rpt_unit_seq="gtggtctctgtgttgtgtg"
     gene            136798..141906
                     /gene="IE180"
                     /locus_tag="SuHV1_gp74"
                     /db_xref="GeneID:2952493"
     TATA_signal     136798..136804
                     /gene="IE180"
                     /locus_tag="SuHV1_gp74"
                     /inference="ab initio prediction:TRANSFACFind:"
     misc_feature    136829
                     /gene="IE180"
                     /locus_tag="SuHV1_gp74"
                     /experiment="approximation (+/- 1 nt) of transcriptional
                     initation site from S1 mapping in strain Ka and primer
                     extension in strain In-Fh"
                     /inference="ab initio prediction:NNPP:"
     CDS             137091..141431
                     /gene="IE180"
                     /locus_tag="SuHV1_gp74"
                     /function="gene regulation"
                     /codon_start=1
                     /product="transcriptional regulator ICP4"
                     /protein_id="YP_068393.1"
                     /db_xref="GI:51557559"
                     /db_xref="GeneID:2952493"
                     /translation="MADDLFDFIETEGNFSQLLAAAAAAEEEGIASGPDGGSQGSRRR
                     GSSGEDLLFGPGGLFSDDAAEAEAAVLAAAAGATRPPRPPSAQQQQQPRRGSGEIVVL
                     DDEDEEEDEPGSPAAGSPGRALHQGSEHGHLVLGPRSRAGSGPRPPTPAALAAAEAGA
                     PGGPGRSSPSAASPASSSGSPGPSAAPRRWSPARGDPVGEPGPAARPRTPAPPAQPAA
                     VAAAPARRGPASPASPAAGPVSAPGGGGAPSAGGDRGRHHHQHREPLLDEPAAARRLD
                     PRPLGARSPVSSNPNSNSNSTTTVAVETVARGPEKDEDGLGLAGDGGAPPQRQPRRRR
                     AGEGALRRGRGFSSSSSSGSDSDLSPARSPSAPRAPAAAARRSASSSSSSSSSSSSSS
                     SSSSSEGEEDEGVRPGAPLARAGPPPSPPAPAAAPRPSASSASSSAAASPAPAPEPAR
                     PPRRKRRSTNNHLSLMADGPPPTDGPLLTPLGEPWPGSDPPADGRVRYGGAGDSREGL
                     WDEDDVRQAAARYRAAAGPVPVFIPEMGDSRKQHEALVRLIYSGAAGEAMSWLQNPRM
                     QAPDQRFNQFCQRRVHAPHGHGSFITGSVTPPLPHIGDAMAAQDPLWALPHAVSAVAM
                     SRRYDRTQKTFILQSLRRAYADMAYPGRAADPRAGEATVEALCARVRAAFAAAQPGRV
                     PRELADACVLACRGVLERLLPCPLRLPAPARAPAALGPACLEEVTAALLALRDAIPGA
                     GPAERRQAADSVALVARTVAPLVRYSVDGARAREAAWTYAAALFAPANVAAARLAEAA
                     ARPGPAEPAPGLPPLWPEQPGLVVPAPAPAAAGAPSGLPGSGPSSPASTKSSSSTKSS
                     SSTKSGLSGSSGYASSPAAGPDPAPERRKKKRRAPGARRPGDGEEDEGLSGAALRGDG
                     HGHRDDEEDRGPRRKRRSLGLGPAPDPAPALLSSSSSSSEDDRLRRPLGPMPEHPAPD
                     GGFRRVPAGETHTPRPSEAALAAYCPPEVARALVDQEVFPELWRPALTFDPAALAHIA
                     ARRGAPLRRRAAWMRQIADPEDVRVVVLYDPLPHEELCAEPAEGAPRPAWDPRRGGLS
                     ALLAAFAHRLCTPDSHAWAGNWTGRPDIGRLNAQGVLLLSARDLGFAGAVEYLCSRLG
                     AARRRLIVLDTIEDWPADGPAVGDYHVYVRVRLDPAAQCAVRWPGCRELRAAVLDSSS
                     IVGPACFARVEASFARLHPGAEPLRLCRQDNVRYTVSTRAGPRTPVPLPPRAYRQRVL
                     PTVDGCKDMARQRSALGLGDPDFDAGAAFGHRAANRWGLGAPLRPVFVSCGRRGLAEL
                     RGPEGLPAELRAFCAAALLEPDAEAAPLVLTPGAVAAAGAPPAVLWDFAPFETSVRAA
                     AGGAVETHRPAGASGAGAGPGEDGDSVEIVGVRGGDGRPRGPLGPIKVEAISDDEEAE
                     DAGNPYLLLR"
     misc_feature    complement(137394..142595)
                     /note="originally annotated as ORF-3 CDS; not conserved
                     among strains"
     polyA_signal    141883..141888
                     /gene="IE180"
                     /locus_tag="SuHV1_gp74"
                     /experiment="consistent with mRNA size (sense unknown) in
                     strain In-Fh"
                     /inference="ab initio prediction:PolyADQ:"
     polyA_site      141906
                     /gene="IE180"
                     /locus_tag="SuHV1_gp74"
                     /experiment="from S1 mapping in strain Ka and cDNA
                     sequence in strain In-Fh"
     repeat_region   complement(142827..142952)
                     /note="2 copies of a 63 bp repeat plus a partial copy of
                     16 bp"
                     /rpt_type=direct
                     /rpt_unit_range=ccggacgtgacgccggtccccacggatctcatctgcatatcg
                     cgccggccccttccgcttccc
     repeat_region   complement(143101..143326)
                     /note="5 copies of a 22 bp repeat plus a partial copy of
                     16 bp"
                     /rpt_type=direct
                     /rpt_unit_seq="gcataacccctccccctaatct"
     misc_feature    143460..143461
                     /experiment="cloning of terminal fragments"
                     /note="complementary to 3' overhang at the other terminus"
ORIGIN      
        1 gaggcccagc tctcccccga gcgcggatct ctgaaaaaaa aatttcccgc ccccgcgttt
       61 tccattgggg tgaatgggga gggggtgggg gatgggcact cactaagaat tggcaaggtg
      121 ccaatttata ttctggcatg gtgccaaact acatacctgg ctccctgcca accccaatcc
      181 ccctcctacc ttggctccct gccaacccca atccccctcc taccctggca ccctgccaac
      241 cccaatcccc caccatcgtc gcggtcttca tccttggcac acagccaacc ctagaaggcg
      301 agccgcgatg ctgcggtcgg gcccacccgc ggcaggaggt tgtggatggc gatgggcgag
      361 ggcgggcgcg cgtgtggtgg ggacggtgtc ggtgcccgcg ccggtggcgc ccgcgagggt
      421 tcgccttggg tgcgctgggg gcccctcccc attcacccca atggaaaacg cgggggcggg
      481 aaattttttt ttcagagatc cgcgctcggg ggagagctgg gccccagacc agagagttgt
      541 gggggggccc gggggagagc tgggcccccg gccagagagt tgtgggggcc cgggggagag
      601 ctgggcccca gaccagagag ttgtgggggg ggggggcccg ggggagagct gggcccggct
      661 ctcggtgggg gacaaccccc tggggagagc ctgaccaatt gccagactag aggagagccc
      721 cgccgggacc ggagaggaga gcgcgccttc cccccaaccc cctcgttccc ccctttcccc
      781 caaccccctc gttcccccct ttcccccaac cccctcgttc ccccctttcc cccaaccccc
      841 tcgttccccc ctttccccca accccctcgt tccccccttt cccccaaccc cctcgttccc
      901 ccctttcccc caaccccctc gttcccccct ttcccccaac cccctcgttc ccccctttcc
      961 cccttccaaa gcgggcgccg cgagcgcgcg ggcccccata cggcgctcgc tctcgtcccg
     1021 gccggtctgg ccgccgggac ggggcgctcc tcgccgcgat gaccgacgcc tcgtcgcgac
     1081 ccggcgagga agagccgatg gaggtggacg agcacgtcga gcccgagtcg gagcccatgg
     1141 aggtggacga gccccctgcg ccggcgcagg catcgggcgc catcctcgcg gtgggcttca
     1201 cccagcccgc gcaggtcctg cgggcgtacc agatcggttg atgtgcgaac gatgggcggg
     1261 ggaaccaggg ggtcagatgc acccacgtgg tgccacaccc gccccacgcc gcgctctttt
     1321 tcccgggccg cccgaccgga tcccgcagag ccggacgtgg ggcgagagac cgggatggac
     1381 gtggagaggg gaacggccgc ggggcgcgtg gaggtggagc tcgatgcccg gccctccggc
     1441 accagagggc gcggcgcgag cccctcgcgt cgagcgcggg acccccgaac cggcccgtgc
     1501 cctcggggcg ggaccgaccc gcgtccccgg gacagaaccg gcgacgccac cggggcgcgc
     1561 gccccgcgcc cctccgccct gggtattaac gccccgggca ccgccgtccg ccgccagccg
     1621 ccgtgggagg cagacatgcc tccacaacga gcccgcgggg ccccgccgcg ccgccgcggc
     1681 agcgacccgc ccgatcccgg cagcctcgcc gggcggctct cgcccggggg gaggagcggc
     1741 ggaggatcgc gccggaccct ctcgcgcagc agctcgctca cgtccgtcgc ctcggccccc
     1801 gtggagacgc ccgtcgccgc ggaggctctc ggactcggcg cccccggctc cagaccgccc
     1861 tcctacgggg acgtcgttcg cgccgggccg cgcccgcacc gatcgccgga cacgccgctg
     1921 tttgcccggg gcccgccccc gtcctactcg gagacgctcc tgtttgaccc gcccgcgtac
     1981 gcggtgacca tcccggaccc gcccgcgtac gagcccaccg tcatcggacc gcagccgccg
     2041 aggccccgcg actggatctc ctcgccctcc gtggtgcagc cgtcgctgct gggccccttc
     2101 agccagtgcc tcccgcagtt gacctgcccc gactgccgct accccgaaga ccgcccgatg
     2161 gtgctcgtgg gcttcctctg gggggggctg ctcctgctgg tgggcctcgt gtttctgatc
     2221 ctgctcccgg tgctccggga gtctgtcgtg tttccctgac caataaactc ggctcgccag
     2281 tcctatcgat atccgcgtct cgcgtgtggt gttgcgacgg gggagatggg gagaggagat
     2341 ggggagatgg ggagaggaga tggggagatg gggagaggag atggggagat ggggagagga
     2401 gatggggaga tggggagagg agatggggag atggggagag gagatgggga gatggggaga
     2461 ggagatgggg agatggggag aggagatggg gagatgggga gaggagatgg ggagatgggg
     2521 agaggagatg gggagatggg gagaggagat ggggagatgg ggagaggaga tggggagatg
     2581 gggagaggag atggggagat ggggagagga gatggggaga tggggagagg agatggggag
     2641 atggggagag gagatgggga gatggggaga ggagatgggg aggacgacag actcgtgcac
     2701 accagagagg tacggttcaa cagttttatt caaaacaggt ggttgcagta aaagtacttc
     2761 ccgtgcatgt acacggggac gagggtgtag ctgcacgtca ggcggcaggt gggcgcgtcg
     2821 cagccggttt tgtgggagtc cagcgcgtcc atgatcccgc cgaggcaggc gccgggcacg
     2881 tactcctcca gcgggacggg cgagtccccc aggtcctcgg gcagcacgca gctcgagccg
     2941 cgctcgacga cgcgggcgat gcgagccagc atcaccagtg tgtaggtgac gatgcagcgc
     3001 acgtcccgca ggcggcgccg gcgcacgagc tcgtcgacgg gcgtgtcgcg gaggtagcag
     3061 cgcaggaacg gcccgagctt caggcgcagg ttctgcagca ccgcccccgc ggtggccacg
     3121 atggggtcca gcgtgcgcag cgtgagcccc ttggtgagga tgagcttgac ccacgtgagc
     3181 gtctcgtccg ccgaggcgag ggactccgtc aggccctcgt tcaggagcac catctcgcgg
     3241 agcacgcgcg ccgcctcggt ggcgtgcggc cgcacctcaa acaggcggtg caggtcggcc
     3301 ccgtggaaca tgagcgtctc ccacgtgacg cgccgcccgt ccggggtgaa ctgctcggcg
     3361 ccgaactcga ggacggcggc ccacggcgac gagcccgcgg cgcggaagcc gtcgttgaac
     3421 acggggcggg agaggtcgtg ccgcgccgag gcaaagagct cgttgacgcg ggtcgcgccg
     3481 acccgcgcgt gcgtcgcgga gacggcggcg cgcgcgctct ccgacagacg atcggggggc
     3541 gcgtcgggcc cgccgtccgg acgatccgcc tcctgtcgcc gccgctggtg ctgctgctgg
     3601 cgctgctgct gctgttgctg ccgccgccgc tgccgcaggg cctgtcgggc ggcgcgcccg
     3661 ccgcgacccc cgcgccggcg ccggatggcc cccagccgcg cccggacggg ccgccgctcg
     3721 ggggggcgcg agcccaggcg ctcgcggacc gggcgccgct cctcgctccc cgacctggac
     3781 gcctcgctgc cgctgctgtt gccgctgtcc tccatgaccg tggtgcgagc ggggccgcgg
     3841 tgtgcaggtg gcgggcggcg gggcgccttt aacccgtcgt ccccgcgccg accttcatcc
     3901 aaatatggta atgtgccgct catagtgcag aaacagcaac acgcccccta ccagcaggca
     3961 gaggtacagc gccttggcaa agatcccggc gagcacggtc gagcagcacg cgccgcagac
     4021 gccgagggcg gcgcgtccgc cgtcggagcg cgcgggcgtg gccgtcgcgc cggagacgcg
     4081 cgcgatgtgc ggcagcgtcg ccgccaggag ctccagcgcc ccgaccgcca gcacaaagat
     4141 ccacacgagg gcgcgggcgt acagcgggaa gacgagggcg cacggggcgc gcgtgacgcc
     4201 gagggtcgtg aacagcgcca tgcgcgcccc caggcggagc ccgagctcga ggaggatgag
     4261 cgcgatcagc gtgggatggc ggtgtgccag cgtgatgggg tcctcgcgga ggtcgcggct
     4321 gagcgcggcg cggcgcgtcg cgagctcggc catgtaccag gcgaacttgg tgtagctgca
     4381 gccgatgacc gtggcggcga gcacgctcgc cgcgtagttg agcgtgtact tctccggggt
     4441 caggaactcg gcggggtcgc ggaaggggcc aaacatgcgc cgctcctggc gcgcgtacac
     4501 gaaggccgcg tagaggagcc acgcgacggc cgccaggcga aagtgcacgt cccacaggta
     4561 ggcgcggcag tcgcggcgcg cgtacacgac ccgcgcgcgg tcgcgcagcg ccgggctcag
     4621 cgcgtccgtc tcgttggggg ccacgtagat ggccgtggcg ttgaaggcct cccagtccgg
     4681 cgcgcccccg gcggcgtcct cgccgagcgg cagcgccgcg tacacgacgg ggtggggcag
     4741 gcgggcgacg gtcgcgtagt acgcgcccag gccggcgtac gcgcccatca ccccgaggac
     4801 gaggaggtgc agcgggcgcc cgccgaggag catgattgcc ccacctccgc ggtgaaaatg
     4861 gtgcgcgtcg cgttgctgcc gcactttgta gcgaagcact gctgactcag cgagatacac
     4921 agccggtcgt gggcgtcgac gctcagggcc acgaaggtgc gggccggcgg gctgcgcgcg
     4981 tgccgggccc gcaggcagct gaagcgcgcg gacccgcaga gctggaagag gacccagtcg
     5041 ggcttggcca ccacccgctg cgcggtcgcg cccgcgtact cgtgcgcgcg cccgttgaag
     5101 tgcgcgtcga ggtgccgcag cacgggcgcc atggccacgt ccgccacgaa ggcctcgagc
     5161 gcgcgccggt cctccgcgtc cacggccagg ccgcgcagca tgtccgccag cggcgtgcgc
     5221 cgggcgaaga aggcctcgcg gttccgcgcc gccttgcgct cgaagaagct ctcgtactcc
     5281 cccccgaggc tgtgcagcac gcgcgtgacg gcgtgcgccg ggcgtgcgtg gaagtgaaag
     5341 ttgcgcgggt cgtcgaagcc cgggggcgcg tccccaaagg ggagcaggcg cccgtggcag
     5401 ccgccgccgt cgaccttggc gaagaagggc agccgcaggc tgcgcccgtg cgcgtacacg
     5461 cccgtgtcca cgaaggtgaa gtcctggagg tacgggccca tgggctcgat gaagtcccgc
     5521 tccagcagca cggcctgctg gagcacgcgc gccaggccgc ggaccgtgtc ggcgccggcc
     5581 accgcgtacg gcgacggcac gggcgtgcac acgcggaagc ccatcttggc gcggcagccg
     5641 cacggcgggc gctcgtccgc cgggacgggg gcgcggacga gggcggaggc gccggggtcc
     5701 ccgcccgcgc ccccgatccc gaccccgacc tcgtcgtcgt cgcacgtgta cacctcggcg
     5761 gggacgcccg cgtcccagtc cgcccagtcc tcgtcgcccg gcgcggcgcc aaagtcggcg
     5821 agggcggcgt cgtcgtccca gggcgcctcc tcgaggccgt cgtcggagga ggccgcggag
     5881 gcggaccccg cggcggcggc gagggcgccc cccggcgggc aggcgctctt gtacacgtag
     5941 caggggtgcg cggcccagtc gccgtcggcc tcggggaaga gcagcgcgag cgcgtcgagc
     6001 accgcgcggc ggaacccgcg catggccgcc tcgagcgtgc ccgcgggcac cgggcgcgcg
     6061 aggcgaaagt cgacgtcgag gacgatgttg gtcacggcca gccgggcgtt gaacacctcg
     6121 tggcggctca cgtacatctg cgccgccggc tcgtgcgcgg ccatctccgg cgccgcgtcg
     6181 cgccgcgccg tcgcgcgccc ccaggcgtcc ccggccagca ccgcgaaggc ctggcgccgg
     6241 tgcgccagct ccacgcggta caccggcgcc ggggggcacg cgtccggcag gccgagcagg
     6301 gcgcccagcg ccgtgcgcgc gcgcccgccg cccggcgcgg cggccagctc cagcaggcgg
     6361 cgcaggacgg cgccgtcggc gcccggctgc tgctgctcct cgtcgggggc gcgcacccag
     6421 ccgtggggcg cgaggcgctc ctcgacggcg gtcacgcggc gcgcgaggcc ggcggccgcg
     6481 tcgcagagcc cgcgcggcgc gtcggccgcg agcgcggcgt acgtgcggtc ctccacgtag
     6541 ccggcgccca tggccggggc gaggcgcgcg acgctcggcg tcacgttctg ggcgacgtag
     6601 tcgcggatgt tgagctgcgc ccgcacgtgg cggaagaagg cggcggccgc gcgctccccg
     6661 aggggcgagc gccccacggg cgccgcgggg tccgtgacgt tgacggcgtc caggtgctcg
     6721 cggagccgcg cgcggttgaa gctctcaaag tgggccaggt agacgtacgt cacgaactcg
     6781 cggtcgggga gcttgaggct gccccggtcg tgggagatgt agtcccggag gacgcccatc
     6841 tcggcgcggt cggcgcgcac gcgctcgtcg acgtagcgcg cggcgtgcgc cgccgcgggg
     6901 ccccgcgcgt agccgctcag gcagcagaag cgcgagagcg ccgcgaacga gagcagcccc
     6961 gcggggtcca ggccgctggg gttggggtcc acgcgcgggt tgtacgtgag cagcaggtcc
     7021 ttgagggccc gcaggtcgta ggccggccgc gggtggaaga ggtggaggcg cgtggccagc
     7081 accagcgtct tctcctcggg gccgaagcgc gccacgtacc agaagggcgt gttgtggttc
     7141 ccgtagaggc gccggaaggc ggccagcgtc tgggtctcgt ggtgcacaaa gagcgaggtc
     7201 agcccgcggc gcccgaccgc gatggagcgc agcgggcgct ccggcgcgta ctcggcgttg
     7261 ccggtgcgcg ggcgcacctg ctcgaggacc atggtcaggg ccgcgatgag gccgtcgtgg
     7321 agggcgaagg tggccgcctc gtccatggcc tcgaggacgt cccgcgccgc gaggggctcc
     7381 ccgcggcaga gcgcgcgcac gaccgccggg gtcgcggcgg cgacgaacac gggccgcacg
     7441 cggacgctgg ccacgtgccc ggtgaggcag aacgtgacgc cggggcggcg cgctaaaagc
     7501 tcggcctcgg cgcgctcgcc cggcagtgag aaggcctcgt ccagcccggc gccgtcccac
     7561 gcgtacgaga cgacgtagac cgcccccgag ggctcctggc ccgtgagcag catcagcgag
     7621 tacgtgatcg cgcagccgtc cgtggcgtac aggacgcgga tcatgctggg cggcatcttc
     7681 tccgggtggt gcgggcgccg cggccgtggg agggcttatg agccgccgga cgaactccgc
     7741 ctccgggagt cgctggccgt gctcaacgtg atcctccccg ccccgctcgc cgccgaggac
     7801 gtgatggcct cggccgaggc cgcgcgccgc ctggcccgcg cggacacgct ggcgcgcacc
     7861 taccaggcct gccagcgcaa cctggagtgc ctggcgcgcc acgaggcctc cggcgacgac
     7921 ggcctggacg ccgtggtcgc ggcgcacgcg gccaacgcgc ggcggctcgc ggacacgtgc
     7981 ctggcggcgc tcatgcacct gtacctctcg gtcggcgccg tcgacgcgga cacggacgac
     8041 ctcgtcgagc aggccctgcg catgaccgcc gagagcaacg tggtgatgtc cgacgtggcc
     8101 gtcctggagc ggacgctggg actggcccgg cggcggcagc cggcgcccgt ccgggccgcg
     8161 cccgccgggc tgggtctgcc cgtccccgcc cagcccgccc cgcgcgctac cgccgcccgc
     8221 ccggccccgc cgcccccgcc cgaggaggcg ggggaagacg aggaggggga ccgccccgag
     8281 gacgacgcgg ccccgctgct gcccccccgc gcccccgcca agacgcgccc gcccgagaag
     8341 gcccggaggc tggccgaggc ctgcaagatg tagccggaga gggcgggcgg gagggaagga
     8401 agggacggag accgccgggg ttgtctgtgc ccaataaaca tctttattga aaaatgagaa
     8461 gagcgggccc cgcgtgtgtg cgcgcgcggt cgccaccgtc cgggtccggc gcgggccgcc
     8521 gcggcctcac aggcccgtgg agccgaagcc gcgggccccg cgcgcgctgc tcggggcgac
     8581 aaagtcccgc gcgaagagcc acgcggggcg gtgctgcatc ggggcgcgcg gggtggcggg
     8641 gaacggggac cgtcccgtga tccagcccag cggctcgcgc gtcagcacca gctgggccac
     8701 gcgctggccc gactccaggg tcaccgggtg cgcgccgcgg ttctggatcc ggaagcggca
     8761 cgggccgctc tcccagggcg tggggaagac gacgatgccg cggaggttga gggacgagcg
     8821 cccgaagacg taggcccagt ggcggccgtc cgtgcggtgc accggtagcg tcacggtctc
     8881 ggcgcccccg gggggcagca ccagctcgcg cgggcagggg atgtcgtatc cggcgtcctc
     8941 gtcgcgcttc ggcgcaaaga cctcgaagaa gggcacgtcc gtggcgatgc ccggcgcgag
     9001 gcgcagcggc gtgcaataaa attgcgcccg tgggcggccc ggggctacaa tcgcctgcac
     9061 ctcgccgcga aagcccgcgt ccacgatccc gttggtggtg cgaccgcccc cgcgctgcgc
     9121 gacgagcatc gcgtatccgg tgggcagcgc caccttgagg cccaggggaa ccttataaaa
     9181 tccctccggc cccggactcc ggcacaccag cagccgccct ccgtccacgg tcacgggctc
     9241 gctcgcacac accaggatgg tctcctccgc cgggctctcg ctgacgctcg tcgccgcgct
     9301 ctgcgcgctg gtggcccccg cgctctcttc catcgtctcc accgaggggc cgctgccgct
     9361 gctgcgcgag gagtcgcgga tcaacttctg gaacgccgcc tgcgccgcca ggggagtccc
     9421 ggtggatcag cccacggccg ccgccgtgac attttatatc tgcctcctgg cggtgctcgt
     9481 cgtggccctg ggttacgcca cccggacgtg cacccggatg ctgcacgcct cccccgcggg
     9541 gcggcgcgta taaagatcga tccgcacgcg cccgacccca ctcgctcgcc atgtccagct
     9601 cgagaaagac ccgggtcgcc gccgacgaga ccgcctcggg ggcgcgccgc cgcgccggca
     9661 gcgcctctcg cacccggacc accgccccgg ccgccgcgac ccccagacgc ccctcggcct
     9721 acgacgacta tgacgacggc ttctcctacc ggtcggcgcc gtcctacgac gacgatggct
     9781 actacggcta cgatggctac ggctcctccc gcgccccccg cgccgccaag gtgacgcccg
     9841 cggccgcctc gcgggcctcg accggggcca agagcgcctc ggccgccaag acccccgcgt
     9901 ccgcggccaa gaccgcccgc tcggccccgg ccgccgcccc ggccgccacc accaccacca
     9961 ccaccaccgc cgccgcggaa ccggccgccc ggcgcgcctc gacacgggcc gcccccgggg
    10021 agaacctcga cgtgggccgc cgccggctcg ccttcagcga caggccgtgc gaggccaacg
    10081 tgccctggcg cggcgcgacg cacgccttca acaagcgcat cttctgcgcg gccgtgggac
    10141 gcgtggccga ggcccacgcc cgcgccgccg ccgagtccct ctgggacatg aaccccccga
    10201 cgacggacgc ggcgctcgac cgcttcctgc aggccgcggt ggtgcgcatc accgtgtgcg
    10261 aggggctgga cctgatcgag gcggccaacg ccgtcctgga cgagagcacc cccgggcgga
    10321 agggaaaagt gtataaataa aggcgttgca aatggcaccc cgctcagtcg tccgctgtct
    10381 tgcttgtggg ggggtcggtg aggatgcgcg acgaggagtg cgtggtcgcg ttcgacgagg
    10441 ccctgctggg gggcgcggcc ccgggccggc cgcccgtggt ggccgtcccg cgggcggcca
    10501 gcccggacgc gctgtaccag cgcctcatca gcgacctggc cttcgacgag ggcccggcgc
    10561 tgctgggcgc catggagcgc tggaacgagg acctgttctc gtgcctgccc ggcaacgagg
    10621 acctgtacgc gcgcctggtc atgctgtcgg cctccgcgga cgaggtggcg gcccaggtcc
    10681 gggcgccgac ggcggacgcg agcgtcgacc tgggggtgcc cggggcggag cccatgccgc
    10741 gagtcccggc cgtggaggag gagctgcccg cgtacgtggc ggccgtggag cgcttcttcg
    10801 tgtccacgct gcgggcgcgc gaggagcgct acgcgcgcct gctggacgcc tactgccgcg
    10861 cggtgctgcg ctacctgcac gcgcaggcgc gccgcgacga gggcaagctc cggcagctgg
    10921 tgcgcgggcg ctactaccgc gacgtcgcgc gcctggcccc ctggctcttc ctgcacctgt
    10981 acgtggccac ggcgcgcgag ctctcgtggc gcctgcacgc ggaccaggtg gtggcccagg
    11041 acgtgttcat gtccctgcgc tacgagtggg accaggcgcg gcagctgacg tgcctcttcc
    11101 acccggtgct gttcaaccac ggcgtggtgc tgctgtcggg cgcgccggtg ccggccgcgc
    11161 agctgcgcgc cgtcaaccac cgccggcgcg agctgggcct gccgctcgtg cgcgccggcc
    11221 tcatcgagga ggacggcgcc gacctggtcg aggagccgcc gttctccgcc gcgctgccgc
    11281 gcgccgccgg ctacctctcg caccaggtgc ggatcaagat ggaggcctac tcgcgcgagt
    11341 accgcgacca cacgtactgc cgcccgccct cgcccgtggc cagctacggc agcaccgcgg
    11401 aggccctgct gccgcccccg tcgccctcgg ccgtgctgcc ctgcgacccg acgccgccgg
    11461 cgcgcgtctc ggccgccccg ctcatcacca cggtgacgct agccgaggcc gaggaggatg
    11521 gcgcgctgac gacggcggcg cccgcggccg cggtcgcgac cgcgacggtc gcctcgcccg
    11581 ggcccgccac ccccgcctac cacctcatcc cccgcgacgc gctcaaccgg atgtttgaga
    11641 tgtgacgccg cgcgcggtcg gatctgcggc gcccgaccac ctgtgggtgg ggcgtataaa
    11701 gccgcgggcc ggcccggagg gggggcattt gccgcagcga ccaccatgag cgacgcgggg
    11761 cccgtgcggc gcccgaggcg ctcgcaagag cagcgcttcc agccgttccc ccgcgcgggg
    11821 ctcctggtgc acctgcagga cgtgctcgtg ggcgaggtgc ggcgcccgga cttccgcccg
    11881 ccgcccgacg aggagagcag cgaggaggag gagcccgtct ggaccgacga cgaggaggag
    11941 gaagaggggg gggcggagga ggagaggacg agcgggggcc ggcgcggggg tgaggagggg
    12001 gacgacgacg gggacgagga ggaggaggag gaggaggagg agagcgaggg gggcgcgtgg
    12061 tccgacgggg agctgtacgt ggcggccgac ggcgacgcgt gggacgcgga agaggaggag
    12121 gacgaggatg gggacgagga tggggatgat gactatgacg atgacgacga cggctatgac
    12181 ggccgcggcg ccgcggcctc ccgcgccgcg gccgggcccc ccgccgacgt ggactacctg
    12241 tcgcgcgccc tccgcggcat ggagacggcc tccggccccg acgagcggga ggccttcacc
    12301 cgctacgccg gcacgctcta ccgccgccag tttcagcccg ggcggccggg gtaccggccc
    12361 ccgcgcccgc gcgacccccc gccgcccccg cccccgcggg cccggccacc gacgacggcg
    12421 acggccgccg cctccaccgc cgccgcccac tgcggtcccg cccgcgccgc cgacggcgac
    12481 gactccgcgc cgcgcctcga gcgggacccg gacgccgcgt acgccagctg gacgcgcgac
    12541 atgcccgacg ggaccttcct ggccatgccg tcgtgggtgg cgctgcgccg cgagccgcgc
    12601 gggcccccgg gccgccccgt cgggcccccg gacatcctgc gccgcgcccc gcgggcactg
    12661 acgttcacgc cgcaggcggc ctcggcggcg ctcgtgagcc gcgaccagga cgcctgggag
    12721 gcgctggtgc cgctgcacca cctccagatg cactcgtggg gcggcagcgc gccgccctcg
    12781 cgcgggggcg tgtacgcgac gcccgcgccc gagacgcgcg gcgtgtggcg ccgcgcgctg
    12841 cggcaggcca tcgccctgca ccacgccatg tttctggcgc cgctgcagtc ctcgacggtc
    12901 ggcgcgcccg cgctcgcggg cgaggcgctg gccttcgcgc tggacgccgc ggcgcgcgcg
    12961 gccgtcaacc acgacgccgc ggcgcgcgag ctccccgagc gcgcggcgcg cgcgctccgc
    13021 gccgtcggcc ggcgcgcgcc cgcggcctcg gggccgcgcg ccggcctctt ccgcgccttc
    13081 tgcggctccc tggcctactg gccggagctg cgcgtcctca gcgggcaccc cgaggacgtc
    13141 cgcttcgcgg ccttccacct ggccgtggca gaggtgtacc tgctggcgcg cgcccacggc
    13201 cagaacccgg gcttcacggc cgaggagcgc gagctgctcg cgcccatgtt cacgctgacc
    13261 gtgctcgcga tgcaccacgc gctgcgctgg ctcacgacgg ccgtggcgcg cgccgtctcg
    13321 gacatccccg acgacgaggc cttccgcgcc gtgcgctcgc gcgtgccggc gtcgctggtg
    13381 ccgctgggca gcatcgcgct ctcggacgcc gagtacgccg tgctgaacgc gaccgaggtg
    13441 gcggcggcgc gcgacgccac gggcctgggc caggccgtgt cgctgggcta cgccgccgcg
    13501 cgctccgcgc tcacgggcct catgcgggcc cacgccggcg ggagcgacgc cctcgtcgcc
    13561 ttcgcgctgg tgctgcagcg cctcgcgggc cacgcgaacc tgctgctcaa ctgcctgctc
    13621 ggcgccgcgg tccacggcgg ccggacggtg cgcgtgtacg aggcggcgct ggacgactac
    13681 gcggagctca tggacgcgct cgacccgctg gtgcgcacgt gcccgctcgc ggagttctgg
    13741 gagcagcgcg acgccgtcat gcgccagctg cggttgacgg cggccccggg cccccccgtc
    13801 ggcggcaagc ggctcgtcat cgcgcccgcg ctgccctccg aggacctgga cgggctcgtc
    13861 ccgcccacgg ccgtgcgccc cgcccacttg gggccggacg tcgacctcgc cgaatacgcc
    13921 gcgcgccacc cagagctggt gggcgtgccg gaaccccgag cgcatttatc ggcgcgccgg
    13981 ccgccccggg gccgctaacc cgcctctgcc tccgccatgc tccgccgcgc ccgaggaacg
    14041 cgccgcgctt cgtggaagga tgcctcgcgc cgcgtcaccg aggggcgcac ccgcgccagc
    14101 tgcctgctgg cggcccccgg ggaggtgctg acggcggccg tggcggccct gcgcgacgtg
    14161 gccgagagcc agtgtgcgcc ggcgctcttt ggcgcccagc gcgcctcggc cctggcgctc
    14221 gtgcgcagca actacgcccc cgagtccgtg atcacggcgt gctcggcgga gccgcaccgc
    14281 gaggtgtacg cgcgcgcggc cgacgccgcg ctgaagggca tcacggcgga cgtggcctgg
    14341 cgcgcggtgc tggccaccta ctggcgctac ctgaaggcca gctcgggcgt ggaggtgcgc
    14401 tcggacgacg agcgcgacgc ccccaccgtc atgctgctgt ggtcgacgtt cggcaagccg
    14461 ctgtcgaagc acccgttcaa gcacaaggcc cagagcgccg cgtacggggc cacgcgcgcc
    14521 gcgctcgccg aggcgaccga ggccgtggag cggtacgcct actacatgcg cccgctcgac
    14581 cccatggtct ccagccccca gacgagcgtg cgcctgcacg agatgctggc gtacgcggcc
    14641 acgttgtacc gctggctgct gtggatgatg gacacggtcg acgcgcgcgt ggtccgccac
    14701 ctggggcgca cgccgcgggt ggcgcgcggg ccgcgcgaga cgatgtcgcc cgaggcgctc
    14761 tttgggcggc accgcgccgg cgggcccgcc gtggcctcgg gctcgggcga ggtgctcgtg
    14821 ctgacgagcc acacggcgac ggtgtttgac gccctggaga tcctcggcgc cacgtgggcc
    14881 gagacgccct ggaagagcgg cgtgtgcggc ctcacggccg ccgtcgtggc cgccgtggac
    14941 ctcgtgacct tcgtgcacca ccacgcgcag accctcatca acctgacgct ggccggctac
    15001 gtgtgctggc tcgacgacgg gatggaggac ccgtacctgc gcgcggcgct gcgcgcgcag
    15061 tgccgcttcc accacctgat cggcgacctg gcgcccacga gctcgtcgca cgcctggggc
    15121 gccatggagc gcggcacgct cgcctggttc aactacgcca tcgcgcgcag cctggcctcg
    15181 tacggcgggc ccacggagcg cttcgcgcgc gtgctggcga cgacgggcca gcgggacatg
    15241 cgcttcctgt cggtcgcccc cgcgcagccg ccgctgccgc cgctgccgcg ggcgtcgcag
    15301 acgccgtcgc cgccgccccg cgaccgcgac gcggagccgc cgcacgagta cgtggacccc
    15361 ttcgccgagt acctgaactg gcccgtgccc gtctcgccgc ccccgctccc cgaggggccc
    15421 ccgagctcgg acgacgagct ggaggtggac ggcggcgggc ggcgccccct ccggcgcagc
    15481 cgcgacgccg ccacgtacgt gaaccgcaag gacctcgcgc ccccgcgcgc ggcggcgggg
    15541 gagggggagg gcgacgacga ggaagaggag gaggatgacc ggttcccgcg ccgcgacggg
    15601 gacgccgggg cctccacgag ctcgtcgcag gagagcgccg ccgacgagga gttcccgccc
    15661 gggatcggcg tgcgcgacgg cgaggaggac gacgaagacg agggggtgga ggaggaagac
    15721 gtgtacgtcg accccgacgg ggacggcgaa cgaggcgccg gcggcggcca cgacgacgac
    15781 gccccctggg ccccgctgac gcgccacggg agcatgcgca ccagcttccg gcgcggggtc
    15841 cgcggctcgt tccgcgccgc ccagcgcttc gtgcgccgcc ggctctcgcg cacgagcgcc
    15901 gaggcgaccc cgcgggctcc cgtcgactcg gccgcggccc ccgccacccc cgcggtcccc
    15961 gcccagggcg agaccgacca cgtgtaccag cacccccgcc cgcggacccg cgcggacgac
    16021 ggcctgtacc agcacccccg acccgtcatc gacctcaccg gccaccgcgc gtcgcgccgc
    16081 aagagctggc gcgtgtgacg gccccgcgga ccccccgttg tatggtttcc ccccgttgcc
    16141 cccgtgtgtg gaaataaagt ttttttctaa ttctgtacac acggcgtgcg tgtcatcgtg
    16201 gtcgcggtcg cgggacggag gggagaggga cggaggggag agggacggag gggagaggga
    16261 cggaggggag agggacggag gggagaggga cggaggggag agggacggag gggagaggga
    16321 cggaggggag agggacggag gggagaggga cggaggggag agggacggag gggagaggga
    16381 cggaggggag agggacggag gggagaggga cggaggggag agggacggag gggagaggga
    16441 cggaggggag agggacggag gggagaggga cggaggggag agggacggag gggagaggga
    16501 cggaggggag agggacggag gggagaggga cggaggggag agggacggag gggagaggga
    16561 cggaggggag agggacggag gggagaggga cggaggggag agggacggag gggagaggga
    16621 cggaggggag agggacggag gggagaggga cggaggggag agggacggag gggagaggga
    16681 cggaggggag agggacggag gggagaggga cggaggggag agggacggag gggagaggga
    16741 cggaggggag agggacggag gggagaggga cggaggggag agggacggag gggagaggga
    16801 cgcgagacgt gttgccaaac aagcgcatct ttattgtttc ccgcgggagg gggctacagg
    16861 gcgtcggggt cctcgctctc gaggcgctgg tagtgccggc ggcgcgtggc catcgccccg
    16921 acgcggctgg ccagcagcgc gggcccgctg ttcttcttgc gcgccttgtg ctcctgctgc
    16981 tcgagggccg acacgatgga catgtaccgg atcatgtccc gggcctggtc cagcttggcc
    17041 tcgtccacgt cgccttcgtc gacgccgtcc tccttgagcg tcttcgtcgt gacggggtac
    17101 agggccttca tggggttgcg gcgcaggcgc gagatgtgcc ggtaggccag gaaggccgcg
    17161 accaggccgg ccagcaccag cagcccgatg gcgagcgccc cgaaggggtt ggacaggaag
    17221 gacaccatgc cgccgacggc cgagatcacg gcccccgtgg cacccaggac caccttgccg
    17281 acggcggcgc ccacgtcgcc gaggccctgg aagaagttgg cgatgccgcg cagcagcacc
    17341 acgttgtggt ccaccttgac cacgcggtcg atgtcgtaga acttgagcgc gtgcagctgg
    17401 ttgcggcgct ggatctcgct gtagtccagg aggcccgtgt cggcgagctc ctcgcgcgtg
    17461 tacacctcga ggggcaggaa ctcgcggtcc tccagcagcg tcaggttcag ggtcacccgc
    17521 gtgctgatcg tctcgggcac ctccaccatg cgcacgtagt tgtagtcctc gtagtacacg
    17581 tacccgctcc ccagcttaaa gtagcgccgg tggttgccgg tgcagggctc gatgaggtcg
    17641 cgcgagatga ggagctcgtt gtcgtcgccg agctggccct cgatcacgcc cgtgccgttg
    17701 tgctcgaagg tgaccagcgg gcggctgtag cacgtgccgc gctcgccggg cacgcgcatg
    17761 gagttctgca cgtacacgcc gccgcgcacc tccacgcacc gcgagatggc catcacgtcg
    17821 ccgagcatgc gcgccgagac gcgctggccg agcgcggccg tggccacggc gctggggttc
    17881 aggcgcgaca tctcgctcca cagggtgcgg tccttgttct gcagctcgca ccaggcggcc
    17941 gcgatgcggc ccagcatgtc gttcacgtgc gcctggatgt ggtcgtaggt gaactgcagg
    18001 cgcgcaaact ccgccgagcc cgtggtgatg cgcaggtgcc ccgtgccgtt gacggccggc
    18061 ggctcgggcg tccccgccgg gccgggggag cgccgggccc gacgggcggc cgcgggggcc
    18121 gcggggccca cgacgccggc gaggccgagg cgctcgagct cgcgcgcgta cagctgcgcc
    18181 agctcgttcg agatcagcgg gcggaaggcc accacgaagc ccccgcgggc gaggtacacc
    18241 tcgggcctgt cgccggccag cacgtgcgtg ctgttgtagc gccgccggta gatggcgtcg
    18301 atggcctccg aggcctcgcg gaggacgcag tcgcccaggt gcacgcgctg caggtccagc
    18361 tgcgtgacgt cgctgacgaa ggaggcgccc agggcccgcg acgtgaagcg gaaggagccg
    18421 tcgcgcgtct cgtcgcgggt catctcctcg gcctcgcgcc acttggccag gctgcacacg
    18481 cgccgcgtct tgggggccca gtcccaggcc accgtgaagt gcggcgtgcg tagaaagttg
    18541 cgcgtcacgc tctcggaggc gcggaggcgc gagtccaggt cgatggggta gtagtgctcc
    18601 acctgctgga agcgcccggg cgcgtagccg atgtgctccc cgtgggcccc ctcgcgcagg
    18661 ccgtagaagg gggacatgta cacaatgtcc cccgtggaca gggcgaagga gtcgtagggg
    18721 tacacggagc gcgcctccac ctcctcgacg atgcagttga cggaggtgcc cgtgtggtag
    18781 aagcccgcgg cgccgatctt ggtgtaggtg tcgttggtgg tgtgccagcc gcgggtgccg
    18841 agcgcgttca ggcgcgaggg gcgcaggtcc acctcgacgg ggttctcgtc gcggtcgaag
    18901 gcggtcacct tgtggttgtt gcgcacgtac tcggccttgg agacgcactt gccgcggcgg
    18961 tcgatcacgt ccgtgatctc ctgcacgggg acgggcacgc ggtctgtgaa gcggttcgtg
    19021 atggccgcgt acgtgctccc ggaccacacg gtcgtgacga tgacgttctt gtagtagatg
    19081 tgggccttga acttgtgcgg ggcgatgttc tccttgaaga gcacggcgat cccctccgtg
    19141 aagttgcgcc cctgcgagta ctcggggcag gcctgctcgg gctccagccg caccaccgtg
    19201 gagccggacg gcggcgggca gacgtagaag cggtcccgct cggtcgcggc cgcgcgcacg
    19261 gccgtccgcg cgtccaggtc gccgtactcg ccgtcggggg cctccgaggg gccgggggag
    19321 aacgcctcga tctcctcgag ggacgcctcc gcggagacgt cgttgggggt ggcgcccgtc
    19381 ccgggcgtcg gcgaggccga ggcggcccgc gtcacggccg ccgcgccgca cggcggggcc
    19441 gcggcgagcg ccagcagcag cagcgctagc gcgacggcgc cccgcgcagc tgcagcgtgg
    19501 tgtggagcag gccaaagacg tccgaggcca gcaccgccgt ggtgcccggg ccgatgcccc
    19561 cggggcccgc gccaaagacc gccaccagcg ggcatgacgc ctcgtaggtc aggtacagcc
    19621 cgtcgcgtcc ggcgaagcga tccgcgcgga ggacctcgac gtccccgcag tggaagacgg
    19681 acctgaagac tgcaaccgcc agcaccagct cgcggatata tcgccaggcc tgccgctggg
    19741 tggcggttac gccggccgtc tggaagcggt agaagccgcg gaactcgctg acgcaccaat
    19801 cgcgggccac catgaagcgc gccagctcct ccttcaggtg cggcaggagg cccacgttct
    19861 ccaccgcaaa gtagagcgcc gtgttggggg gctgggcgaa ggcgtgcgtg tcgtgcgcga
    19921 agagcggccc gttgacgagc tcgaagaact tgcgcgtgac ggccggaagg agcgcggcgt
    19981 ccacggggtg gcgctgcacc gtggccttca tgaagctgtg cgcgtcgaag cagcccgtct
    20041 cgcgctcgtc cacgacggtg cccgcgcgcg cggcggcctc gcagaacgcg cgccgtgcgc
    20101 ggaacccggc ggccaccgcc acgtacgtgt gcagcagcgc gtcgccgtac acgttcacgc
    20161 gcagggtctt ctccagctcg cgccgctgct cgcgcacgca ctgcgccagg ctcgccgccg
    20221 agcgccgcga gaggcggtcc gcgtacaggc gccgccggcg ctcggcgtcg cgcagcgccg
    20281 cggccggcag gtccgcccac gccacggcgt ccgccggcgg gggcgcgccg ggcccgtctt
    20341 cgtcgccgac gcccccgtcg ccggcgtccg cgccccccgc ggcgccgccg tcggcgtccg
    20401 cgtcgtcgcc gccctcgagg aggcgctcga gggcgtcgcg gttggcccgg tccgggtcca
    20461 gcatgcgcag catgggcgtg gacatgtggt ggtcgtagca cgcgcggatg agcgcctcga
    20521 ggcgctcgtc gggcgaggcc gcgcagccgc ccacgagcag cccgtcgatg atgtcgagct
    20581 cgcgggccgc gcgggcgcgg tcaaagtgct cgggccgccg cccgaagagc gcgagctcca
    20641 cggccgccgc gcgcacctcg gcgcggcgct cgcgccgctc caggtcgtcc aggttgtgcg
    20701 tgaacaggtc gagggcccgc accgcctggt tcgtggacgc cagccaaaac tgcagctcgc
    20761 tcacggcgta caggcgccgc gaggcgggcc ggaacacgtc gtgcgcgtcc aggagcgcgt
    20821 ccgcgcgccg gcgcgccgtc tcgcccgcgt ccccggcctc ggcgcccgcc gccgccgtgg
    20881 acgccgcctc cgcctcccgg gcctcggcgg cgtccacggc ggcgagcgcc gccagcgcgc
    20941 gcccgcggcg cgcctcgtcg agcccgtgca cgtgcggcag gttcttggcc acgtcctcgg
    21001 ggtccacgcg caccgccagc tgccgcgtga ggtggtcgca cacgcagccg agcaggcgcc
    21061 tgtgcgtggc ctcgccctgg ttggccgtca cgcacagctc ctcgaagcac accgcgcacg
    21121 gctgcgccgg gtcgtacagc tccggcggca ccacgagccc gccgccgatc gtgcgcgcga
    21181 ggaactcgtc cacggccgac aggtccaccg cgtggggcgt gatcaggtgg cagtagttga
    21241 gctgcttgag caggttctcg gcgtcgtgga ggaactgcag ctccgtctcc acgcgcccgc
    21301 cgtacgtgtc gagcgcgacg cgcgcgtgga agcggcacgc gccgcccatg gtgcgctcaa
    21361 agtaggcctc ggcgtcgtcg ccggcggcgg ccagcgcccc cagcacgcgg tccccctcgg
    21421 cccgcgcgta cgcgagcgcc aggcgcagcg cgcacgtgag cggcgtcgtc tgcgcctcca
    21481 gcggcagccg ccgcgcgagg tagcggcaca tcagcgcgtt cagcttgacg cgtggggcca
    21541 gctcgcgcac caccgcgggg tcgcagcgct tcagcatctc cagctgaaac acgtacgtct
    21601 gcacctgccc caggaccgcc acgagccgcc gctccgccat ggccgggtcg gcccgctcgc
    21661 tccccccctc cgcccgcccg tccgccgcga gagaggccac gggacgcgcg tgtgtgtctg
    21721 tcaaacgcgg tcgtctttat tgatacagcc gggcacccgc gcccgtcccc ttcccctcct
    21781 cctcccctca cagcatgtcg aaggtcagcc gcttctcggg cggggcgccc atgtcaaaca
    21841 ggtcgtcctc cgggggcggg cgcttgcccc ccagctccgc gggcaccagc gaggccggcg
    21901 cgagccccgc gacgtccccg cccgcgccgc aggccccaaa gtcgaaggcg gtctcctcgc
    21961 cgccgtccgc gcccgtctgg ccctcgaggt cgcgcaccag ctcggcggcc gcctccacgc
    22021 tccagcgccc gtcgcggtcg gccacgcgcc cgttgatctc cgccagcgcg gccgccagga
    22081 actcgtcgtc cacgatcgcc cgccagtcgt cgggctccag gtgctgcgtg cgcgccccga
    22141 gcgcgtgcag cacggccgcg tacacggccg tctgcaccag cggcccgccg tcggccagga
    22201 tggtcttgac gtgctccccg agcgagtggt cgtgcagccc ggcgccgccg cccgtctgcg
    22261 agcacgtgaa gcccacgcgc gggcaggcca gcacaaagtg ccgcgtgcgg tcaaacacca
    22321 tcagggggca cacgtgcttg ccgccgttga gcccgctcca gttccccgcc tggaagacgc
    22381 ggttgttgcc ggccatgccg tggtacttgc tgacgcccag gcccagcacc accagcgggc
    22441 gcgaggccat gacggagcgg agcaggtggc tggacgtgta cgtggccacc cacgtgtcgt
    22501 cgcgcggcgc gtccagcacc tcgcgcgcgg cgcgctccgc gtcggccgcg tccgccagcg
    22561 ggcgccgcac ccaggccatg acggcggccg ggtcccgcgg gcgcttcgac tgcatcgtga
    22621 tccccgtgag gctgttgatg aagaactgct tgtggtcgca gtagcgcagg atcaggttgg
    22681 ccaggtagaa ctgggctagc tccgccacgg tgcccggggt caggttcacg tagttgatgg
    22741 cgccgtagtc caccgagaag cgcttcacgg ccgcgatggt ctcgatgtcg tccttggtca
    22801 gcagccgcgc cggcagctgg ttgcgctgca gcagcgtcca gaaccactgc gggttggggc
    22861 tctgcccgcc gggcggcttg ccgcggggga acagcgtcgc gtggtgctgc ttcagcagga
    22921 agcccagcgg gccgttgagc acgtccacgg ccgtgtccgg gcgctggtag gcgcccgcga
    22981 gcccggccac gcgggcgcgc gcggcgtccg agaggctgcc cgagcccgtc gagaacatga
    23041 cccggctctt gacacgcagc tcccgcagca cctcgaagct cacgcgcgcc aggtccccgt
    23101 cgtggtcgcg cgccgggggc tccgcgctgc ccttggtggg gtccggggcc acgatgccgt
    23161 cggcgagcgt caccgtcacc gtcttggccg tgacgaagcc cccgttgagc atgtccacca
    23221 cgcggcggcg cagcaccggc tggaactggt tgcggaagtt gcgcccctcc acgggctgcc
    23281 cgtggagcac gccgtggcac tggctcaggg ccaggtcctg cagcaccgcc agcagcgtgc
    23341 gccgcgccag gaagctcgtc gccgggcaca gcgcgcccga gtacgggtcc agcgagaggg
    23401 acatggtgtg gttggcgtcg tagagcgcgt cgcggagctt gaagtcgcgc gtctccacga
    23461 gcgtgcgcac gaagcggtcc gccgcctgct cgaccgtgtc gcgcagagcg cgcagcgcgt
    23521 gccggaagcc ggcgtggtcc gtcaccgtct cgccgatgcg cgcgccggcc acgtccgcca
    23581 gcagccggtc cacggcggcg cggtacgtgt cctgcatgat cgccttcggg ggctcgctgt
    23641 cgttggggcg cttgagggcc ccgtacgagg cgtagttgcc gagcacgtcg cagtcgctgt
    23701 aggcgctgtt catggtcccg aagacgccca tggggctccg tcggcgcgcc gaagcgcggg
    23761 agcggtggcg caggcggtgc agggttgtgt gcgcgcaggc ggggcgcgag gcgcggtcgc
    23821 agagcgagca ggggacctcg gcgtcgaggc tgccggccac gtagcgcacg gcgtccacgt
    23881 cgccgcggcc cacgaacgtg cccgcgtcgc agcgctccag gtagaacagc acgcgcgcca
    23941 gcagctgcgg gcagaagccg cacgccatca ccaggtggtc catggcgaag tcgtggttgc
    24001 ccggggccgt cgcgggctgc gaggccgtgt gcagcagcac gcgcccgtcc ttgtccgtct
    24061 gcgggttccc ggccaggtag ggcgccgcca cctggtagaa gcggttaaac gaggggccgg
    24121 cgccctcctt gcgcgcgtcg gcggcgcccg cgtcgtccac ctccgtcagg tacagcaccg
    24181 agttggagct gaacaccagc gcccccacga ggccggccgc gcggctcacg tacgcgccga
    24241 gcgccgcggc ctgcgagacg ggcgcgcccg cggaggcggc cgcggcgccg ccgtccttgg
    24301 cgcccgcctc ggagagcacg ggccagtcgt ccagcgcggg gggctcctcg tcgtacacgc
    24361 cggcggcgac gagcgcctcc agcgacagcg ccgcgtcggc gctcatgacg gacgccatgc
    24421 ggcgctcgag gccgccggcg gccgcgtcgc cgccgcgccg ccgctgctca aagagcgtga
    24481 aggtcacgtc ggcgggcagc acggcgctct cgtggttctc gtcgaaggcc aggtgcgccg
    24541 cgccgcgcgc caccgcgtcc aggttccgca cgcgcgtggc cacggccgcc gggcccagca
    24601 cgtagccgtg cagcaggcgg cagagcgggc cgttgaagaa ggggcgcggg tacacaaact
    24661 cctcgctgat ggagcggttc ttggcgttga aggggtcggc cacgagccgg ttgacgtccg
    24721 gcatgaagag gtgcacgggg tagagcggca cgcgccacgc ctcgtgcccg ttgatggaca
    24781 ccgtgcccgc gcccccgtag tgcaggaagg cgttgcacag gtacaccgcc tccttgaagc
    24841 cgtcggccac cacgaggtag gccgcgtgcg cgtccgcggc caggccgagc cgcgcgcaca
    24901 cctccgcgcc cgtcgtctcc tcggcgttgt ccaccggcgt ccggtaggcc gagaacccga
    24961 agcgggcgcg cgccgcctcg caggcgcgcg agagggcggg cgcggcgctg ctcgggggca
    25021 cgcagtcccc gttgtggaag aagaacacgt tggggtggaa gtggttgggc gtcagcttca
    25081 gcgtgagccc gccgccgagc ccggtggtcc gggcgcccgc caccacggcc acgtgcccgg
    25141 cgaagccggc ctcgacggtc aggccgcgca ccagcggcgc caccgccgcg gcgtcgtcgg
    25201 cgctgcgcgc cacgagcagc gccagcaggt cgcggcgcag cgcctcgatc ggcgtcacgt
    25261 acacgtagcc cagcggcgcg gcgcgcacgg tcacggtctt ggccgcggcc tccatcgtcg
    25321 cgggtgagac gagacgcggc gagacgagac gggagcggga gagagaaggc gcggcggacg
    25381 gggtcgagtc tcggtcccct ctccgggcgg acgggtccgg cggcggggtg aagagagagg
    25441 cggaggtgtc ggcgccgagg ggcgaacgcg acgtcggcgg cggtggtaga gtccggcccg
    25501 ccccggccgg gtcttaaagc gtggggcccc gccccgccgg gcgtggcgcc ccgcccggag
    25561 cctatacctc ggccggcgcg ttcgcacctc cgcgtgggac gagcgatggc ggcgcggcag
    25621 ggcagctacg tgacgcgcct gagcgagttc aagttcatcg cgccgcggtg cctggacgcc
    25681 ccggagcagc gcggcgtgca cgtgggcacg ctcgcgcgcg agcccacggt ctactgcggc
    25741 ggcgccacgc ggcccatcct ccgcggggag cccttctggc cgcggcgcgt cgccgcgtgg
    25801 gagggggccc ccgagcggcc cgtgagtccg cgcttcgagc gcttccacgt gtacgacatc
    25861 gtcgagagca ccgagtacgc cagcgcggac ccgcgcttcc ccaacggcac ggtggtcacg
    25921 ctgctggggc tcagcgcctg cggcaagcgc gtggccgtgc acgtgtacgg cgtgcgccac
    25981 tacttcttcc tgggcaaggc cgaggccgac gccgccctcg gcgtggcgag cgccgagcag
    26041 ctcgcgcgcg cgctgtcggc ggcggccgcg cgcggcccgc gcctcgggcc cgccgacgtg
    26101 gacgcgcgcg tcgtcgacgc cgcgcccgtc tactactacg acgccccccg gcggcccttc
    26161 taccgcgtct cgagcaacag cgggcgcctg gtcgcgcacc tccgcgagac ggtgtgcgcc
    26221 ggcctggtga cgcacgaggc cggcgtggac gcgaccacgc gcctgctgct cgaccacgac
    26281 ctgcccagct tcggctggta ccgcctgcgg cccgggcccg cgggggagcg cgtggtgctg
    26341 cggcaccagc gcctcacgtc cagcgacgtg gaggtcaact gcacgcccct caacctggcc
    26401 cgcgacgagg acggcccgtg gcccgactac aagcttttgt gcttcgacat cgagtgcaag
    26461 gccggcgacg acgcggcctt ccccgccgcc gagaaccccg aggacctggt gatccagatc
    26521 tcgtgtctgc tctactcgct cgccacccag cggctggagc acacgctgct cttctcgctg
    26581 ggctcgtgcg actcggacga ccccgcggtg acggtcctcg agttcgacag cgagttcgag
    26641 ctgctgctcg ccttcgtgac cttcctgaag cagtacgcgc ccgagttcgc cacggggtac
    26701 aacatcatca actttgactg ggccttcgtc cacaccaagc tcacgaccgt ctacgggctg
    26761 gccctcgacg gctacgggcg cttcaaccgc ggcggccagt tccgcgtcta cgacgcgggc
    26821 cagaacagct tccagaagcg cagcaaagtc aagatcaacg gcctcgtctc cctggacatg
    26881 tacgccgtcg ccgccgacaa gctgaagctg ccgagctaca agctcaacgc cgtggccgag
    26941 gaggcgctcg gcgagcgcaa gctggacctg gactacaagg acatcccgcg gtactacgcc
    27001 gcgggcccgc gcgagcgcgg cgtcatcggg cgctactgcg tgcaggactc ggcgctcgtg
    27061 ggcaagctct tcttcaagtt cctgccgcac ctcgagctct cggccgtggc gcggctcgcc
    27121 aacatcacgc tcgcgcgcgc catctacgac ggccagcaga tccgcgtgtt cacgtgcctg
    27181 ctgaagctcg cgggctcgcg cggcttcgtg ctgcccgaca agcgccgcgc catcgccgac
    27241 gaggacgacg gcggcggcta ccagggcgcc aaggtgctcg agcccgactc gggcttccac
    27301 gtggacccgg tgctcgtgct ggactttgcc agcctgtacc cgagcatcat ccaggcgcac
    27361 aacctgtgct tcacgacgct cgcgctcgcg cgcccggcgg gcctgcgcga ggacgagttc
    27421 agcgccttcg aggtcaacgg ggagcggctc tactttgtgc acgcgggggt gcgcgagagc
    27481 ctgctctcga tcctgctgcg cgactggctg gccatgcgca aggccatccg cgcgcgcatc
    27541 ccgacgagcg cgcccgagga ggccgtgctg ctggacaagc agcaggcggc catcaaggtg
    27601 gtgtgcaact cggtgtacgg gttcacgggc gtggccaacg ggctgctccc ctgcctcccc
    27661 gtggcggcca ccgtgacgac catcggccgc gacatgctgg tggccacgcg cgactacgtg
    27721 cagacgcgct gggccacgcg cgagctgctc gagcgcgacc tgcccgcgcg cccgcccgcg
    27781 ggcgagtacg ccgtgcgcgt ggtctacggg gacacggact cggtcttcat ccgcttctcg
    27841 ggcatcgcgt acgacgacgt gtgcgagctc ggggagctca tggccgcgcg catcacgcgc
    27901 gacctcttcc gcccccccat caagctcgag tgcgagaaga ccttccggcg cctgctgctc
    27961 atcacgaaga agaagtacat cggcgtcatc aacggcggca agatgctcat gaagggcgtc
    28021 gacctggtgc gcaagaacaa ctgcgccttc atcaacgcgt acgcgcgccg cctggtggac
    28081 ctgctctttg gcgacgaggc cgtctcggcg gcagcggcca cgatcgcgcg cgcgcccgcg
    28141 gcgcgctggc tggagcgccc cctgccgcgc ggcttcgccg ccttcgggcg cgtgctggcc
    28201 gaggcgcacg cgcgcgtcgc cggcggcgcc ggcctggacg tggccgactt cgtcatgacg
    28261 gccgagctca gccgcccccc ggacgcgtac agcaacacgc gcctgccgca cctcaccgtc
    28321 taccacaagc tggccatgcg ccacggggag gtgccgagcg tcaaggagcg cgtgtcctac
    28381 gtcatcatcg cgcccacccc ggaggccgag cgcgacgccg gggccgtgcg cccgggcctc
    28441 gcgcccggga agctgctcgt cagcgacctg gccgaggacc ccgcctacgt ggtcgcgcac
    28501 ggcgtgcccc tcaacaccga gtactacttc tcccacctgc tgagcacgct cagcgtcacc
    28561 ttcaaggccc tctttggaaa tgacaccaag atcacggaaa ggttgctcaa gcgctttatt
    28621 ccggaaaccg cccccgggga cgcgcccttc gagcacgagg ccttcgcggc gctcacgggc
    28681 gaggggggcg aaagtcttca aacgctgcgt acaatctttt gtactccaac agcagctccc
    28741 cgtcgaagct gatgtcccgc atcttgcaat aaatgtcgct cgcgctgacg gcgggcacgt
    28801 cgtccgcggg tctcccgtct cccttctttc gcaccaccaa cacgaacatg gtctgccaca
    28861 cgtgcgcgac gatgcggtgg ccggcgcagg ccccgagcag gcggtccagc acgcggtggt
    28921 gcacgtgcac cgacttctcg gggaacacca cgtacatcat gagcgcgccc tgcgcgtcgg
    28981 ggtcctcgaa gaagagcacg cgcacgtcgc gcaggccccc gtcgcgcagc acgtagtagg
    29041 cgaaaaagag ctccgggtgc gcgagcacct cctcgagggc gcgctccgag gggtcccgcg
    29101 cggccaccga ggccaggaac acgcggtact cgtagatgct gttgagctgc tgcacgtagg
    29161 ccagcacgag ggccgcgcgg tcgctgcgcc cgagccgcgg ctcggcggcg gcgcacgtgg
    29221 ggcagcagcc gccgaggccc aggtagtagc ccatgcccga gagcgacagg cagttgtcgg
    29281 ccaccgcctg gccgaggtcg aagggcagcg tcacgggggc cgtcttgatg agcgggttcg
    29341 agaggccgcg cacggtggtc acctcgtccg agggctgcgc ggccgcgtag gcaaagtagg
    29401 gcgcgtagcg atcgcgggcc gcgcgcgtca gcgtcttgcg ccgcgcggcc gacgacttgc
    29461 gccgcaggag ccgccgtcgc tcaaacatag ctgccgagcg tgtgctcgag ggagacgagc
    29521 gcgaggccgt ggcgccgcag cagcgcgtgt gcgtcgcgca ggaaggcggc tcgggcagtg
    29581 ggcttcggcg ggaacagctg gtacgcttta aatacgtacg ccagggtcca cagctccccg
    29641 cacacgcgcc cctcgaagcg gttctcggcg gcgatctgcg ccttgcgcag cgcgtcgccg
    29701 cgctcaaaga gcacgcgcgg gtccgcctgg cgctcggcca cggcgcacag ggggtcgcag
    29761 aagaggtgct tgtagacggc gcgcgggccc gcggcgcgca tcagcgccag gaagcgcgcg
    29821 tccgccacga agccctcgag cacgggctcg atgcagtcaa agaggcccgc gttgttctcc
    29881 gagtagctga gcacgccgcg ccggaagcgg cgcagcgcca gccagtgcgc gcgcgtgagc
    29941 agcatgttgc agagcaggca ctcgccgtgc gtgcggttgc ggccgcgcac gtgcttcagc
    30001 gccagcgcca gcacgggccc cagcgtggcg tccaccgcgc ggtagcgcgc gtacgccgcg
    30061 gcggtgttgc gggccaggaa gccctcgtgc tccgcccagt actcgtccac ggcgcggtgc
    30121 cggcgctcct cggcggcgtc cgtctgcgcg ttgggctccc ccgtggccac gttgcccagc
    30181 agcagcatgg cgaggtcggc gtagccgggc ccggcggcgt ccgcgtccgc ggccccgccc
    30241 ccggtggcgg cggcgacggc cgcgcgctcg tacgcgtcgt cctcgcgctc cgccgccgcg
    30301 cagcacccgg cgcacgcgtc gtcgcccgtg tggtccttcc agccccccag gctcggcggc
    30361 gcgcgcgcgt ccgccacggt gaaaaacatc gcgcgcgtcg cggcctggac cagaaaggac
    30421 tggttcgaga agcggatctt gtcgccgacg gtgcggaagc agccgtgcag gaaaaagtgc
    30481 cgctgcacgt ccacgagcgt gagcacgcgc gtggcgaagg cgcgctgcag cgacgcgcgc
    30541 ccgcgaaagt gcttgtccat cacgtacacg aactcgaagg cggccacgaa gacggccgtg
    30601 gcgcacgggg ggcaggccag ggccttggcg cacagcgccg cgtagtccgc cagccagggc
    30661 ggggccagcg agcgctcgcg acggtacacg tcgatcgtgc ggcacacgcg gcagggctcg
    30721 tccagcgcca gcggcgccgc ggcggcctcc acgaagcccg cgggcgagtc ctcctcgtcc
    30781 agcatcacgt gggcggcgaa gatcagctcg cggaagaggg cgtcgttctt ggtcagcagc
    30841 gcggggtcga aggccgtgta cggcgcctcg aaggcgtcct cgctccagcc catggcgcgc
    30901 ggcggcggcg gcgcggcggt cgatctgcgc gcggcgatcc cggaggccgc gctgcgcgac
    30961 ttcgacgtgg actttctcga ggccaactac ctgcccccgc gggtgcgcgt ctggttcgag
    31021 gacgtgatgc cgcgcgagct ggaagtgatc ctccccacga cggacgccaa gctaaattat
    31081 ctggcccaca cgcagcgcct ggcggcggcg acgagcgagc gcgactgcgc ccacggggag
    31141 gcgctgcggg cgcggcgcga tcgcttcgcc gcggccgtca acaagtttct ggacctgcac
    31201 caggtcctgc gtgacggggt ggagctgggc gccctataaa gtccgccgcc cgacccgggg
    31261 agctccacca gccccaccac caccgccgcc gcccgcccgc cggccccagc tcccgccggg
    31321 aaaatcgccg ccgccgcgtc gacgtcgtag ccgcaccgct cacccccacc ctcacgctcg
    31381 cgacgacgac gacgaccatg agcggcaccc tggtccaacg cctgaagctc atcctctccg
    31441 gggggaacct gcgctgcagc gacggcgaga cggcctgcga ccccgagcgc cccccgacgc
    31501 ggtgcgtctt ccaggtccac gggcaggacg gctccaacga caccttcccg ctggagtacg
    31561 tgctgcgcct catgcgcagc tgggcccacg tcccctgcga cccctacgtg cgcgtgcaga
    31621 acacgggcgt gtcggtgctc ttccagggct tcttcttccg gcccgccgac gcccccctgg
    31681 ccgcgatcac ggccgagcac aacaacgtga tcctggcctc gacgcacagc accggcatga
    31741 gcctctcggc gctcgacgac atcaagcgcg ccgggggcgt ggacacgcgg ccgctgcgcg
    31801 ccatgatgtc ggtgagctgc ttcgtgcgca tgccgcgcgt gcagctctcg ttccgcttca
    31861 tgggccccga cgacgcctcg cagacgcagc gcctcctgga ccgcgccgag atgcggcagc
    31921 gctcggtctc ccgccccggc gggggtgccg gcggcggcga cgacggcgag gggccctcgc
    31981 cccgcgcgcc catccgcccg accgtcatct cgcccgtgcc cgggcacgcg gccgccgcgt
    32041 tcgtgggcca ggccgcgtac cccccgcccg cgcggttccc ggcctcgctg ctgcacaccc
    32101 tcctggggct gcggcgcctc gccggctacg ccgtggcgtg cgtcaccggc gctctcgcga
    32161 tagtcatcat cctgaacatg cgttaaaggc ggccgcgcgc gcgggggcgc gcacagacgc
    32221 gcgctccccg ccgagccatc atgtccttcg acccgaacaa tccccggacg atcaccgcgc
    32281 agacgctcga gggcgccctg cccgtggaca ttctgctccg gctcaaccgc gcgacggggc
    32341 tgcagatgga tgcggccgag gcgcacgcga tcgtggagga cgcccgccgg accctgttta
    32401 tcggcacctc cctggccctc gtgaacctgc ggcacgcgca cgacaagcac ctcgtggagc
    32461 gccagcccat gttcgccacc agcgactaca gcagctgggc ccggcccacg gtcggcctga
    32521 agcggacctt ctgccctcgc cccccgccct agccccgcgc gatcaataaa gcgagccgcg
    32581 ttgcaccatc ctctcgactc tagcgtgttg cgtgttgctt gggtggggtt tcccccggtc
    32641 tttccccgat ctccccaccg ccgcgtcttt gggccccaat ccccccaagt ccccccaagt
    32701 ccccccaagt ccccccaagt ccccccaagt ccccccaagt ccccccaagt ccccccaagt
    32761 ccccccaagt ccccccaagt cccccaatcc ccccaagtcc ccccaagtcc cccaagtccc
    32821 cccaagtccc cccaagtccc ccaatccccc caagtccccc aatccccccc aagtccccca
    32881 atccccgcca ccaagtcttt gggcccggac tcgggccccg agctccccca agtcccacaa
    32941 gttccccaat ccccccaatt ccccccgatc tccccacctc caagtctttg ggcccgagtc
    33001 ccccgagtcc cccgaacaca ccaccgcaga ggcaaacaag ttgggtaata aacaatttat
    33061 taaccgagaa tcaggcggac ctgaaatagg tccacgttga agcggcgggc gctgcccttg
    33121 agggtcgtcc gcgtctcccg caggcggcgc gctatcaggc ggcacgcggc gatgagcagg
    33181 gccagggccc cgagtccggt ggcgcgcatg taccgcctgt tgatgagcgt gtccgactcc
    33241 accacgcgcg gggggagcag ctcctgggcc agagagacgt cctcgtcccc gtcctcgtcc
    33301 ccctcctcgt cctccaggcc ccaggggtcc agctcgggcg cctcctcggc gggctcgcgg
    33361 gtcaagtcct cccgggtggg ccagacgcgg ccgaggccgc ccaggggaga ggccggcggc
    33421 ggaggtctct gctgctgccg ccgcggcgga ggatgggcgg gagggacgag cgccgtcagg
    33481 tcgtcgaacc acgccggggg ctggtggggg tccgccagcg gggagcgcgg ggccggcggc
    33541 gcaaactccg gcgggagctc gggggtggtg ccgggcgcct ccaacggcgg cggccacggc
    33601 atccgctcca gcggcgagcg cagcggggtc gccggggtct cggcctctcc ctcgctcgcc
    33661 catagcggct gagggggcgg cggtggcggc agcggcggct cctctcgccc ggggaactgg
    33721 accggcgggt ccgacggcgg cggggtgaag agcgcgggcg ggccggcaga gtccctcggc
    33781 tcgggccacg tccacggcgc ctccgggggg cgctgctgag acggctgcgg cggcagcggc
    33841 ggaggtgtga acatgagccg cgggggctcc ccgtgccgct ccggcgtcgg ggccggccgc
    33901 gaaggtggtg gggccggcgg tggtgcggcc ggccgcgaag gtggtggggc cggcggtggt
    33961 gcggcggggg cggaagaggt ggtggcggaa gacgaggagg tggtggtggt tgttgccgcc
    34021 gccgctgctg ccgccgaggc ggcgggccgc tcgatctcgg agggggcggc cagcgacgtc
    34081 ggggccgcca gcggagaccg cggcggctgg gtctgcgccg gggcgggagt ctctggcgag
    34141 gccggcagag gcacgacgac tccctccagc tgcacaggct gcggcggcgg gatgtggaga
    34201 cggaggtgcc cggccggcgg gcgcgggccg gcggctcgcc tcactgggcc tccggggccg
    34261 actccggggg cggggacggc tgctgtagct gctgctgctg ctgccgccgg tgggcccgtt
    34321 ggagcagtcg ccggcgcttg ggcttgggct tgaggcgggc gcggttcaag tcctccggga
    34381 ggacggccct cgggttgagc cgcgggcgga agacccccgg tctggcgcgg ggccgatacg
    34441 ggccttcgcg gaacaagagc catggatttt cggcgactgt ggtctctaat acccaccgac
    34501 gttcgcgcct tggtgcgtag aacagcggag ggaaggggct gcgccactgg ggccgcgggg
    34561 agatgtcccg caggttgatc tccacggctc gcatccgcag ccgggccacc gtctcctcgg
    34621 cgctggccac cactcccggg ggctccagga ggtgctcggg ccgccgctcc ggctgctgag
    34681 gggggacctc cgcgggcgcc atcgctcggt gttccggccg gggaagaaga ggatgaggcg
    34741 gcttctcggg acggggtcga ggcggcggag gaggacgcgg acgcgggctc ggagtccgat
    34801 gtccccggag gagagcgggt ccgatgctgg tctggtccga ccgtgtgttc gcacttgtct
    34861 gcgcgccccg ctttataccg ttcgtcatcg agggggcggc ccggggaggc ggctcccgcc
    34921 accttcccac caaatttggc gtcgcggacg tccggcggtg caccggcctt cggctctacg
    34981 atgcggtcac catcggattt cttggccgat ggggcgggcc cgggcgcggg gggcgtgggg
    35041 gtcgccgccg gggcagacgg tggtggaggg gcgggcctgg ggagcgtagt ctgagcagac
    35101 ggtggtggag gggcgggcgg tgcggcgggc ctggggagcg tagtctgagc agacggtggt
    35161 gggggggcgg gcggggcggg gggagcaccc cgcggcttgg cggccggttg ggacgacggg
    35221 ggctgagggg ggacctgcgc ggccgcggtc gcggcggatg gtggaggggg ggcggtctgc
    35281 gtctgggccc gggtcggcgg ctgagtctgg ggggtggcct tgggcgcggt ggtggcggcg
    35341 gcggtggcgg gctgcgccgg gggcttctgg gcaggggggg cctgggccga cgggggctgc
    35401 ggcggcggtg ggggaccctg gggttggggg gtcggcttgg ccgcggcggg cggctgggcc
    35461 tggggggcct ccgggggggc cgtctcgggc gccggggccg tcgccgggta gggcgggttg
    35521 atgaccggcg gcgggggctc gatgcgcgcc ttgagcgatg gctggatctt tcgcggcgac
    35581 gagtgcggct tgggggcggg ctcccggggc tgctgcttgg gggccgcggc ggccttggtg
    35641 ccggcggcgg gcttcttgtg ggcggcgggg ggcccctgct gcggctgcgg ctgcggcttg
    35701 gtgagcgggg tcgtctccac gggcttggcg ggcggcggcg ccggcggggc cagcttggcg
    35761 gcgggagtca gctccgcggg cttggcgggc ggcggcgccg gcggggccgc cggggccaac
    35821 ggcgggagcg tgggcgggtc gaccggcggc gacgggggca gcggcagcgc gctggccacc
    35881 aggtcgtcgc cgagcaggtc cagccacggg ttggcgccaa agtcgtcgtc cgggacgaac
    35941 ccgtcgtcct cccccgccaa ctcggggggc agcccgggga tcggggccgc gggccgggtg
    36001 ggcgtcgccg acacggcgta tgggaacggg tcgcccaggt tgcggaagct cggccggccg
    36061 tacagctcct ccgaggtggc cgggtccacg cgggcgtcgc ccatgatgat ggaggtgaac
    36121 agcgggtccg cggggtccat ctccggcagc tggtcctccg tcgtctccag gaaggggatc
    36181 tcccgcagca gcgggtcgtc ctcgagcgtg aagcccgggc gtcgcggcgg ctcgggcggc
    36241 gcccagagca cgcgcgacac cgccagctgc gagtccacca gcacgaggca ggccggctcg
    36301 ccggccaggg gccgcgccgc gatcagcgcc gagagccgct ccagctgcgg cgccaggcac
    36361 gcgttctcga tggggttgtc gtcgagcgcc agcaggcgct cgccccagga gctgaggtcc
    36421 gtggacacgc cgcggtgcag cgcggggtcg cgcaggtcgc acagcgtcac ggccagggtc
    36481 aggcccgagc cgggcgagta cacgtccagg ttctccatgg cgatcaccag cggggccccg
    36541 acgagcaccg ccgccgcggc caggtccatg gcgctcacgc gcgtcgcgct gctcggcggc
    36601 gagcccgtga cggtgaacgt catgcccgtg cccacgggcg cgtacaggtc gccggcgccc
    36661 ggcgcgccga gcgccgcggc ctcgcgcacg tgcgccgcgg cgtccaggcg ctcggtgacc
    36721 gcggcgtcgt acgcggcgtt cgcctccggc tgcagggcgg accacagcgc cgagagcagc
    36781 cgcgggggga tgcacatgcg cgccagcacg gtgaaggtgg ccagcgcgcc cggcacggcg
    36841 cgcgccagcc gctggcccgt ctccgtgtgc gcccagggcg cccacagctc cgtctccgag
    36901 aagcggccct cggtccagtc ggcgacgcgc agcgtgaaca gcgcctgccc gtcgcgcagc
    36961 gggcgccgcg gcgggcgcgc gcccgcgtcc agcgtgtcca ccgcgtccag cgcgcggtcc
    37021 agcaccgcgt ccagcgtctt ggccatgtac tcgtgctgcc cggccaggtc cacgcgcgta
    37081 aagttgaaca ggtgcgtcgg ctcgccggcc accgcggcca ccatcaggtc ggggagggcg
    37141 agccgcaccg ccggctccag cggcgggtgc gcgacgcggt ccagcgcccc gaaggtgcgc
    37201 gagagcgtcg tggccagcac ggccgcgtac gtctccgcgg cggccttggc cgccgagtcc
    37261 cagtcggcgc ggcggtggcg cacgaagcgc gcgaaggtgg cgaagcccgt gtcgcgcgcc
    37321 ttctcgtagt tgagccgcag gtggatgatc tcgttcatga ggcgcatgcc cgccacggtc
    37381 gccgtctcca tgagcccctc ggtgagcggc gggcgcagct cggcgccctc gtcggtgcac
    37441 agcatggccg ccagcttgtc gccgaccgcg cggtagcaca cctggtactc cacgggcacg
    37501 ttgttgtcgt ccaggaagac cgtggggaac accgcgtccg cgtcgctccg cgcctcgcgc
    37561 accgtgcaga tgacgtcgcg gtcgcccagg cgcgccgcca cgcgctgctt caggcgcgcg
    37621 cacggcgccg tcgaggcgcg cggccgcgcc ggcgtcggcc ccgcgccgcc gtaggccgcg
    37681 tagaactgca ggcgcagcgt gagcagctcg cggtaggcgg cgtacttggg cgggatccac
    37741 cgcggcagcc gctccgcgcg cgcgtcgaag gcggccgcca gcgcgcgcag ggcgtcgtgc
    37801 cgcagctcgg gcccgatgcg cgccgccatg cggtcgagct cgcgcacgtc ctcctcgacg
    37861 gcaccggcgt cgcggaagaa gtcgcccagg gccccggcgc gcgccgagta cttgctctcg
    37921 atgcgcccca cgaacttggc gggcaggcgc gggtagacgg cgtcgctgcg cagcgccagc
    37981 acctccatgg tcgccgtctg cagcgcgcgc gcgcgggcct cggccagggg ggcctcgtcc
    38041 tcggaggcgc cggcgcggcc gcgcgcgcgc ccaaagtcct cccaggcctc gtcccaggcg
    38101 acctcggcgg ccgtcagccg ctgccgcagc gtgtccgcct cctggcgcag cgtctgcagc
    38161 gcctcgatgc gctcggcgaa ctcgtccatg ggcccgcggc cgtcgacgcg cgtcgtcagc
    38221 gggtgcgtgt cgatgatgag ccgcgcctgg tgcagccact cgacggcctg cacgtccagc
    38281 tcgggcgcct cctcgacggc gccgagcagc agcgccgcct gcgtcaccag ctcctccgcg
    38341 gaggcggccc ggtcgatgtt gagcgaggcc ggcggcggcg tcacccgcag caggttcttg
    38401 aggttggcca gctcgagggc cccgtcgcgg tcgcgcgccg ccgccgcgtc caccacctcg
    38461 cgcagcaggc gcgtggcgcg ctccgtcgcc gcggcctggt ccgcctccgc cgcggcgagg
    38521 ccgtcgcgcg ccgccgccag gtcgcggcgc acgagcgcgc gcatggcctc cgcgtacgcc
    38581 gtgcgctcga agcgcgcaaa gtcgaagcgc tccaggtagg tcacggcgcc gcgcagcagc
    38641 tcggtgctcg gcacgtgcag gtgcaccccc tcgtcgagcg cgcgcgccgc gtcggcggcc
    38701 gcgcgcacgt acgtcacctc ctcgagcgcg cggcagatct cggcgccgcg gctgccgccg
    38761 gcctgcagca cgtccgcgcg ccgcgcgccc agggcggcca gctcggcctc gtactcgggg
    38821 aagccgcggc ggtaaaagtc cacgtacttg gccaggcggg gcacgtgcgc catgtccgcc
    38881 ccgacgaagc ccacggcgtc gtagtagctg aagcgcccca tgccggcggc ggcgcgggcc
    38941 agcacgccgc cggcgatgcg ggccagccgc gagagcggct ccgtgtcggc gccgaagagc
    39001 gacccgatga cgggcgccgc gacggcgtag tcgtcgagcc acgtcagccg ctgcagcgcc
    39061 tgcagcggcg ggcccgccgc cgcgccggcg ttctcgggca ggtgcgggtt gaaggcgaac
    39121 acggcgtcca gcgccgtggt cacggtctcg gcgttggcgc cgagcgcgcg ctcggcggcg
    39181 gggcgcagct ccgcggcgtc gtagccgcgg tcggccgcca cgtcgcgcag gcgcacgaac
    39241 tcggccgcgt cgaaggcgtg ctgctcggcg cggcgcagcg ccgcgtcggc cgcgcgcgcc
    39301 cagagctggc gctgcgcgcg ctccacctcc gccgcgcggc gcgcctccac ggccgccacg
    39361 gccgcctcca gctcgccgac gcgctggcgc gccgcgagcg ccatcttctg cagctgcggc
    39421 tcctccacgg cggccgcgcg cgccacctcc agcgccaggt ggcgcgcctc gaccagcgtc
    39481 ccctcgtcgg gctgcgcgcg cagccgcccg agcatctcca cggccgccgc cacggccgcc
    39541 gacagcgcgg cctgcagcgc cgccacgcgc tccgactcgc gcagcgccgc ggcgcgctcc
    39601 tcgcactgcc gcgccagcgg ctccaggaag cccagctccg ggtgctccac ggcggcgcgc
    39661 agcacccccg ccgcgcgcgc cgccttctcc gccgtgtccg cgtccgccag cgccgccgcc
    39721 accgcgtcgg cgtgcgcgag gaagaagcgc gtgatgggcg ggttgtccgc gagcgcgttg
    39781 accagcgccc cgagcggctg cccggcgccc accagcgcgc cggggtcgga cgtcagcagc
    39841 tcgcggtagc gcgccaccag gcgccacagc gccgcgagca ccgtgcccgg cacgggcgtg
    39901 gccgtgatgt gcgcgagcag gtccaccgcc gggcccagcg tggcaaagtc gcccagcagc
    39961 gcgcgcagcc gcatgtagag gtcgttctgc tcggcggcgc gctgctgcgc cgcctgcacc
    40021 agcgtgcgca gctcggcgtc gcgccgcgcg agccgcgcgc gcgtctcctg gctcagcacg
    40081 tggccgccca tggcgcggat gtgccgcagc aggtcctcca tcgcgcgcac gcgcgtctcc
    40141 tcgtccgggg cggccgccag ggcggcgtcc atggcgtcga agcgcgccag gtcggcgtcg
    40201 gccgaggcgc gcttggccgc gcgctcgttg atctgggtca cgtcgcgcgt gagcgtgtcc
    40261 agctcgcgcc gctccaggtg cccgtgcgcc tgcgcctcgg ccagcagcgc gaaccaggcc
    40321 ccgaggcgct cgtccgtgct cacgtcctcg cccgcctcca gcagctgcgc cagcagcgcg
    40381 ccgtcgtggg cggcgggcgc cgcgtccagc gcgcgcagcc gctcctcggc ggccgccagc
    40441 gagtcgacga ggcggcgcag gcccgccacc gcggcgttgg ccacgcggaa gcgctgcgcg
    40501 ccgttgcggt ccatcagcat ggccttggcg ctgtactgcg cgccgcgcag aaagtactcg
    40561 cggatggcgt cgccgaccat cagcgccagc ttgcgcggca gcttggccgc gcgctccttg
    40621 acgtcgcgcg tgttcggctc ggccgcgccg cccgcgccgg gcgcccccgc gtccacggcg
    40681 tcaaagttgg cgtgggcggc ctcgagcgcc gcctcgagcg cgctcacgtc gcgcgcccgc
    40741 tcgagcgccc gctgcgactc gcgggactcg cgcgcgcggg cgcgcgcaaa cagggcccgc
    40801 gcgcgcgcca ccaccgtctg gtcgtagacg ccgccggggt cccgcgccgc ggcgtccatg
    40861 aagcacgccg agagctgcgc gtaggagccc ccggactcga gcgcgtccag cgcccggtgc
    40921 atggcctcgt tcgcgggccg cgcgacgcgc gccgcgacca gcgccagctt ggccacgggc
    40981 gcggacgcgt cgtcgccggc cacgtccagc agcgcgcgcg cctccgtcag caccatgtgc
    41041 gtggcggcca caaagtcccc ggccgggccg cgctccggca gcgcgcccag gatgggctcg
    41101 aagagcgcgg cgacggcgca cggcgcctcc ccgtgggtgc gggcgccgtt ctccaccaga
    41161 aagtcctgca ggtgcccgaa gaggagctcg gcgaagcgct ccagcagccc ggcgcgcccg
    41221 gggaacaggc tccggcccgc gcacgcgacc acgtgctcct cgagctcgtc ggcgtgggcc
    41281 tgcagcgggc ccaggtcgag cggggccagc tccagctccc ggacggcgaa gcccatgggc
    41341 tcgcgggtgc gcgggcggaa cttgcgcgac ggccgcccgc cgaccgtgtg cgtgctgctc
    41401 aggtcctcct ggctcgccgg ccacgggggc cggcgccgct tgggcatgct cggccgcttc
    41461 tggacccgcg gcggcggcgg gagcggtgcg ccgccgggtg ccggggcggg ggcggcggcc
    41521 gccgagacgg ggacggcggg gacgggggcg acggcgagga cggggatggc cccggggccc
    41581 cgcgtcggcg gcgcggcggc cgccgggtcc ggcggcaggg ccatcgggtg cacggagggc
    41641 accgcccgct ccacgtacgg ctcgtccacg aggtacgtct cgcccacgcc gtagagcgcg
    41701 ggcacggcgg cgaactggtc gtggggcagg aagaacacga aggccccggc ccaccggagc
    41761 tcgctggcgg cgtagcccgc gacgtgcgcg tacacgtccg ccgggcgcag gcgcgccacg
    41821 aaggcctggg tgatctgccc gtggccgtgc gggtcgaaga cgtacacgac gtcgccgcgg
    41881 cggtagaggc ccaggcccac ggcgccgacc acgaccagcg tgaaggactc ggcgcgctgc
    41941 gcccagaggc cgtcgaagaa ggcgcgcgcc gtgatctgcg tgctctggaa accctcggcg
    42001 ggcggcgtga aaaagttgca ctcgccgtgc acccgcgaga agacgcagtg cagcgcggcg
    42061 ccgcccgcgc cctcgtagac gatcttgttc gggagctcgc tgatggcgca catgcccccg
    42121 ccgggccccg tccacgcctg gccctcgcgc aggcacgcgt ccacggcgtc ggccgtcagg
    42181 gcggcctcca cgccgttcgt gaagaccagg cgcaggaagg agagggagga gcgcaggcac
    42241 gagacgcccg acccgggccc caggtcgggg tcatactgat tacgatagcc gacgaccacc
    42301 gcgtcggccg tcatggctga aataacacac gcgcgtgggg gaaaaatctt tttatttgga
    42361 cacggcgtcg acctcggcca ggagccgatc cacgggcacc cacgtttgcg cgagcagggg
    42421 cacgcccgcg ctcgcgtcgt cgggcgcgcg cgcgccgcgg cgcagcacct ccaggttcac
    42481 ggcggcccag tcgcgcacgt tgacgctcgc cgagagcggc acggcgtcgg ggcccgcctc
    42541 gccgtcgccc gccacctcgt ggtagtcgcc caggacgcgg tccgcggcct cgcgcagctc
    42601 ctcgggcgtg aaggcgggcg cgggcggcgc ctgctcctcg cgcgcctcgg tccaggtctc
    42661 gcggagcgtc gcgacgagcg ccagcacgcc gcgctcgtcg acggcgcggc gcagcgcggc
    42721 gctgaccagg tcccagcgcg ccaggaagcg ctccacgggc cgcaggacgg tggcggcctg
    42781 caggcggccg gccgtgaggg cggcgctcgt ctgcagcttg ctcaggcgcg cgtggtcggc
    42841 gcacagcgtc cggaacacgg gcgcctgcag gcccagcgcc tcgcactcgc gcagcgcctc
    42901 cgtcgtctgc gccatcacgc cgcgcagcgc ccccgcgtcg gcgcgcatgt ccgagcggtg
    42961 cgtgttgacc tcggcgcgga aggcgcccac ggcgtccacg acgtccgcca gacgccacgt
    43021 gcccaggcag ggcccaccct ccccgggcgc gaagacggag gccgtgcgcc cgcggaagac
    43081 gaagcggcag gtgaagaggc gctcgagcgc caccacgcgc tcggccacgg cgcccgcggc
    43141 cgtggccatc gagtccagca ggtcgcccgt gtgggtggcc atgtcctcca ggcggcgccg
    43201 gagggcgcgt gccagcaggt ccccgaggaa ggcgctggcc gccagcgagg gcggcgccgg
    43261 cgccggcgcc tcgagcacct cggcggccgc gcgcacgacc ccgtgcagct cgtgcgcgag
    43321 cgcctcgacg ttgcgcgcgt gcgccaccgt caggtcctcg cgcgccagcg ccgccacgag
    43381 cgcggcgagc ttggtgcggt agccgctgac gttggggatg aggccggcgc cgtagtcgcg
    43441 cgcccacgtc agcacctgcg ccaggtccgc gcggcggtcg taggaggccg tcaggaggca
    43501 gttgtaggcg tcggccacgg ccgtcacgac gaagaagggc gcgaaggacg ggtcggccat
    43561 ggcctcgagg tgcaccatgg acgggtagtt cacgaggtcc gcggcggcgg cgaggtcgac
    43621 gagcgccgcg ctcgtcggcg cctccatggg cgtctccccg gcgccgtcgg cgcgcaggcc
    43681 ccagcggctc tgcgcgcgga aggcgagcca cgtgttgagg gcctcgcgcg cggcgctgtg
    43741 cgccagcccg gcgcggcgct cggccgccgc cacctcgcgc agcagcgccg cgcgcgccgc
    43801 gcccacgtgc tccgtgggcg ggcgcggcgc catgcagtgg cgcaccacgt gctccacgcc
    43861 cttctcgggg agccccagcg ccgccgtcac gtccccgtag aggggctcca gcgtgtccgc
    43921 gacgtccgtg taggcgcgca cgtagtccag cccgggcccg tagtcgtcga ggaggcggtg
    43981 cacgacgccg ccgacgaccg ccgtgcagcc gacggcgcgc tgcgcgtccg tcaggcgggg
    44041 cgcgcggtcc agcacggcgc gctcgaggag gtcgcagtgg cggcgcgtga agcccgcggt
    44101 cacgagcgcc tccacgacct gcagcggcga ggcgctggcc tgcaccgcct cccacacgcc
    44161 cgtggcgtcc acctgcgtgt ggtcgaggtc cgcggcggcg gccacgtgca cggcctgcgc
    44221 cccggggtcc agcagcgcca gcacgccctg gtccgtgcgc aggcgccgcg ccacggtgcc
    44281 cgggcgcagc tcgcgcacgt acgcgtcccc gtgcgcgagg gccgcggaga cgcgcacctc
    44341 gacggccgtg cgcggcgtgg cgttgacctc gcccacgggc accagcgccg cctcgtccac
    44401 ggcccgcgcc gcctcggcga actgctcgcg cagcgtcggg ttctggcggt cgtggaagaa
    44461 ctcgtcggcg atcgtgaggg caaagagcgc gcgcgtcagc ggcttcaggc cctcgttctg
    44521 catctggcgc accgccaacg ccagcggcag cgcccagttg gtgtgctgcg ccacgtagcg
    44581 caggccgtcc tgcacaaagt ccatgtcgta gagcgtcgcg aagcggggct gcacgagcgc
    44641 gcgcgccgtc tgctccgggg gcacgacgcg gggcgcggcc aggacgtcgt cggcggagcg
    44701 cgcgcccgcc agggcctcgt cgaaggcggc gcaccactcg ctcacgaggc ggaacatggc
    44761 gtcggggccg aactcggccg aggtgcgcag cccggcctcg gtgagggcgg ccgtggtgtc
    44821 gtcgccgttg acgaccccca ggagctccag cagcggggcc gtgccctcgt cccagtcgtg
    44881 gcgcaggcgc cacagcgcca ggccggccag gttctcggcg agcacggccg cctcgcaggt
    44941 gcccgtctcg acgtaggcgc ggcaggccag gcgcagcgcg cgcgcccaga gcccgcgcac
    45001 gcccgcgggc gtctcgcggc ccgcggccat gaagaactcc aggatgcgcg actgcaccac
    45061 cgtggcgacg gcgtggtcgg cctcctcgag cgcgcgcacg agcgcctcca ttataagagg
    45121 gtccgcgcgc gggcgccgcc gcgcactcga ccccgcgcgg cgcgacgatg agcgtgcaga
    45181 tcggcaacgg gctgctgatg gtggtcgcgc cgggcacact aaccgtgggc tcggcgcgcg
    45241 cgcgccttat acgccaggtg acgctggcgg acttttgcga gccccaggcc gagcgcccgg
    45301 ggctggtggt gctcgcgctg cgccaccccg cggacctggc cggcgccgcc tacgcggcca
    45361 cgccgcccgg caagaaccac cgcgacctgg aggaggcgtg gctcgccctc gacgagggcg
    45421 ggcgcggcct cggcggcgac ggcatccgcg cctccgtcgt ctcgctcaac ttcctggtgg
    45481 cggccgccga gaacgcggac gacgcgctgc gcgcgcacgt gacgaccaac taccgcgacc
    45541 ggcgcacggc cgcgcgcctc gagcgcttcg cgaccgtgct gcgcgccatg atccggagcc
    45601 acgtgttccc gcaccgcgcg ctgcacgtcc tcggggggct cctgggccac gtgacgcaag
    45661 accggctggc cagcgtcacg tgcgtggccc gcggcgacca ggaggcggcg cgcaccaacg
    45721 acatggccgc gcgccgctcg caggtgcacg tgcccgcgtg cgcgctgatg gacgtggacc
    45781 gcgagctgcg cctcggcggc gacgacggcc tccgcttcgc gtacctggtc tttgtctaca
    45841 cgcagcgcca ccgccgcgag gcgctgcgcg tccacgtggc ggtgagccgc ctgcccgagc
    45901 tcggcgacgc cctcagcttc ctcctggccg gcacgcgcgt cgacaacgcg atccacggca
    45961 cggacgaggc cgacgccccc gccgcgcccg ccgccgccgc ggccttcccc gcgtacctgt
    46021 tcaacgaccc gcgcagcgcg cgctgcccga cgggccggct caacacgccc gccgccgagg
    46081 cgctgcccgt gtgggccccc gacatgcgcg gccgcgccac ccggaactcg tgcatgtacg
    46141 ccgcctacgt gcgcctcggc accgtcgagc gcgtcgtgcg ccgggccgag cgctgcggct
    46201 cggtggacct gccgctggcc cacatggagc gcttcacctg ggacgtgggg gcgtgggagg
    46261 agtgtttctt ctgaaaaaac cgggggcggg tgtgtgagac ggatgtgatg ttgctgacga
    46321 ggctaataaa aaggcgggca cacgcgcgcg tgtccccccg ctgaccctcc gtgccgcgtc
    46381 cgcgtcgtgt gtgactcacc ccatcgtctc tcccgcccgc gatcccggcc cgtcccggct
    46441 tgtcccgccc cgcccagaca catcccatca tgcccccgcg cgcgccgcgc ccggcgggcg
    46501 cggtttcccc gccctttccc ccattggcgg gcccgccgct aaaagcccgc gcgccccgag
    46561 ctcgggactc tccgctcacc tccccgtgtc gagcacacgc cgccatggcc tccgtcgtcg
    46621 cgcccgccgc ctcctcgtcc gccgccgccc ccggcgcgga cgcattcctc gacgccgcct
    46681 gccccgagga cgtcgcccgg gccctcgccg ccgagctcga ggcgctgcgc gccctcgggc
    46741 acgacgtcgg cgcgcccgcg cccggcgcct cgcgccgcga ggcggcgctg tttatcacgc
    46801 gcgccgtgga cgggctcaag gccttctccc gggtggacga gcgcgtgtac gtggcctgcg
    46861 gcaagctggt gcacctgcgc gtgcggagcc gcgaggcgga cctggacgcc tggctcgcct
    46921 cgccggagct cgcgctgatc cccgcggtgg cggccgccgt gcgccggcac cgcgcgcgcg
    46981 tggaggcggc cctccgctgg ttctggcggg aggcctaccc ggcgctctac gcgcgcggcc
    47041 tgcagtcggc gctcaagtac gaggagatgt acctggcccg cctcgagcac gggcgctgcg
    47101 aggccatgga ccagttcttt gtgcgcctcg ccgcggccgc cgccacggcg acgcggcgcc
    47161 ccatggcgct cgtgctctgc ggctcggacg cgtggcccga ggtctttgac gcgtactttc
    47221 gcgcgctggc cacgcaggcg atcgtgcccg caaccccgct catgctcttc gccggccgcg
    47281 cgcgcggctc gctcgccagc tgctacctgc tgaaccccct gccgcgcacc accgaggagg
    47341 cggtgcgcgc catcacggac gaggtggccc ccatcctgct gcgccgcggc ggcgtcgggc
    47401 tctcgctgca gagcttcaac cgcacgccct cgggcgactg cacgcgcggc atcatggccg
    47461 tgctcaaggc gctggactcg atgacggcgg ccatcaacag cgacagcgag cgccccacgg
    47521 gcgtgtgcgt gtacgtcgag ccgtggcacg cggacgtgcg cgccgtgctg aacatgcgcg
    47581 gcatgctcgc cgccgacgag agcctccgct gcgacaacat cttcagctgc ctctggacgc
    47641 cggacctgtt cttccagcgc taccagcggc acctggacgg cgagcgcgcc gtcaagtgga
    47701 cgctctttga cgaccgcgcc tcgcacctgg cctcgctgca cgggcccgac tttgcgcgcg
    47761 agtacgagcg cctggagcgc ctcggcctcg gcgtcgagtc cctgcccatc caggacatgg
    47821 ccttcctcat cgtccgcagc gccgtcatga cgggcagccc cttcctcatg atgaaggacg
    47881 cgtgcaaccg gcacttccac acggacacgc gcggcgccgc cctcgccacg tccaacctct
    47941 gcacggagat cgtgcagcgg gccacgcccg gcgagaacgg cgtctgcaac ctggccagcg
    48001 tgaacctgcc cgcgtgcctg gcgggcggcg ccttcgactt tgccgcgctg cgccgggccg
    48061 cgcgcgtcgc cgccgtcttc gtcaacgcca tgatgcgcat cgggaactac ccgacgggcg
    48121 cctcggtcga gggcgtgcgg cgcagccgct cgctgggcat cggcctgcag ggcctgcaca
    48181 cgaccgtgct ggcgctggac atggacatgg ccgacccggc ggcgcggcgc ctcaacgccg
    48241 ccatcgccga ggagctgctc tacggcgtca tggacgccag cgtggagctc tgcgagcgcg
    48301 gcctgcgccc cttcgacggc ttcgagcaca gccgctacgc gcgcggggtc atgccctttg
    48361 acgcctacga gcgcgtctcg ctccgcgagc cgatgcgctg ggacgcgctg cgcgtccgca
    48421 tcgcggagca cggcgtgtac aacgcgcagt ttgtggcgct gatgcccacc gtgtcctcgt
    48481 cgcaggtcac cgagagcagc gagggcttct cgcccacctt caccaacatg ttcagcaagg
    48541 tcaccatctc gggggagctc ctgcgcccca acctgccgct catggagacg ctgcggcgcc
    48601 tgtttccgcg cgagtgcgcg cgccgggacg ccgtggcgcg gctggagcgc gcgcagtggt
    48661 ccgtggccgc ggccttcggg gagctgcccg ccgggcaccc gctggccaag ttcaagacgg
    48721 ccttcgagta cgaccaggag ctgctcatcg acatgtgcgc ggaccgcgcc ccctttgtgg
    48781 accacagcca gtccatgtcc ctcttcctga ccgagcccgc cgacgggaag ttacacgcct
    48841 cccgcgtcat gggcctcctc atgcgggcat ataacctggg cctcaagacg ggcatgtact
    48901 actgcaagat caggaaggcc accaacaacg gggtgttcac cggcggggac ctggtctgca
    48961 cgagctgcca cctgtgagcg cgcgccatgg agtactttta cacgtcccag tgccccgaca
    49021 tggaccacct ccgctcgctg agcgtggcca accgctggct cgagacggac ctgccgctgg
    49081 gcgacgacgc caaggacgtg gccgcgctca gcgagcccga gctcgagttc taccgcttcc
    49141 tcttcgcctt cctctccgcc gcggacgacc tcgtcaacgt caacctgggc agcctctcgg
    49201 agctcttcac gcagaaggac atcctgcact actacatcga gcaggagtgc atcgaggtgg
    49261 tgcactcgcg cgtgtacagc gccatccagc tgatgctgtt ccgcggcgac gccgcggcgc
    49321 gcgagcgcta cgtgcgcgcg gcgctgcggg acgaggccat ccgccgcaag gtggagtggc
    49381 tcgactcgcg cgtcgccgag tgcgcctccg tcgcggaaaa gtacctgctc atgatcctca
    49441 tcgagggcat cttcttcgcc tcctcgttcg cctccatctc gtacctccgc acgcacaacc
    49501 tctttgtggt gacctgccag tccaacgact tcatcagccg cgacgaggcc atccacacct
    49561 cggcctcgtg ctgcatctac aacaactacc tgggggacgc cccgcgcccc gacgaggccc
    49621 gcatccacca gctgtttgcc gaggcggtgg agatcgagtg cgagtttctg cgggcgcgcg
    49681 ccccgcgcga cagcctcctg ctggacctgc cggccatcat ctcgtacgtg cgctacagcg
    49741 cggaccggct gctgcaggcc atcggcgcga gcccgctctt tggcgcgccc gcccccgcgg
    49801 cggactttcc catggcgctg atggtcgccg agaagcacac caactttttc gagcggcgca
    49861 gcaccaacta cacggggacc gtcgtgaacg acctgtagcg ccccgcggcg gcgacccccg
    49921 ctcgcccccc tcctcctctc tctctgcggc aaaacactaa taaagcgttg agacactagc
    49981 gcgcgcctcc ggccgtcatc cttggggcga gggtgggacg ggaacgggga tgggagagtg
    50041 ggatggggaa atgggggatg gtgacggccg aagggagatg gggccggcgg gggtggactt
    50101 ggactgggga aggatggtgg cggccggcgc agagtgggag gcggtgaggt ggacgggggg
    50161 acggagggga ggaccgatgt gggacggcgg ggggacggcg gggggacggc ggggggacgg
    50221 cggggggacg gcggggggac ggcgggggga cggcgggggg acggcggggg gacggcagag
    50281 gtgagacgga gcccgcggac ggagtggccc gcggggggga ggcgacgacg gagagagaag
    50341 gtgggggaga gggcgagcat cacacgggcc gcacaaccga ggattttttt caagtttttt
    50401 ttattttctc ctatgggcgt tacagtcgtc ccagtacgcc atgaggacgg cctggtagtt
    50461 cgggggcggg ggtatgtgtt tccaaaacag gcccgccagc tccttcgccc gcgtctcgtt
    50521 cttcacgtgc cgcagcagcg agccaaagac cttgttcacg tccgagggct cctgcacgat
    50581 ggggacgcgc cgcagcacgc tcaggtgccc gtgccgcgcc ggcgtgagca tggccaccac
    50641 gtgctggatg aactcgcgct cggcgcgcgg cgagcgcgcg tccccggccg ccggcagcag
    50701 ggcgagcgcc ttgccggcgt cgcgcatgat gtcggggcag cgggaggcgt acttgagctt
    50761 gacgtcctcg ggggccacct cgcggccctc cagcgactcg gccacctgct gcaccgagtc
    50821 cacgtccggc gcccggtgca ggtccgtgtg gcagcgcacg aacgcggcca ggaactccga
    50881 gtagtccacc cccaggctcg cgaggacgtc gcggcagcgc agcaccagcg ggaacacggg
    50941 cgcgatgtcg aggatcatgt cgcacccggt gaggatcatg tccgtgtccg tcgtgtgcac
    51001 ctgcgcgacc gtgttggtgt ggtagaggtt ggcgcagacg tcgtccgcct ccatgtccga
    51061 cacgtccacg taggcgtagc ccatgtggcg gatgaggttg acgcagaggc ggtggacgat
    51121 gcgcggcgcg tgcagcatcg tgctccagcg cggccgcggc ggcgcgtcgg cggccccgtc
    51181 gccgtcggcg cgcacggccg cggccatgat ggccttggcg ccgcgcgcga tgcggccgtt
    51241 cccgaagatg ccgcggtccg agacgaagat ggggaagtag gtgcgcttgt gcagcatgcg
    51301 cagcaggcgc agcaggcagc gggcggtcgt ggtcgcgttg tcctcggtcg tctcctggta
    51361 gtgcttctcc atgagggtgt acatgacgtt ccacaggtcg atggcgattg gcgtgaggac
    51421 ccccggcggc gtggagatgg cctccgagcg caccagacgg tggcggtgtg cgtactttaa
    51481 aaggccaaag agccccatgt ctccgctcgc acaccgaggc gccggtctaa aatacgcatg
    51541 tggcggggcg gggccatccc gcgcatataa gccgggcggt gattggtctg gcgcacaccg
    51601 cccgcccgag cccgctcgcc cgccgcgatg tcgctgttcg acgacggcct cgaggacctg
    51661 gaccgccacc ccacccacgc gcaccacccg gcgcaggtga tccacgacgg gcccttcgtg
    51721 ctggaggacg gcgagcccct gcagcgcacc ggcatgctgg tgctcagcga cgagcacctg
    51781 gagcacgcgc gcgccgccat cgccccgctg gccgcgcacc tcgcgcacgc cttcctcgtc
    51841 ttcagcgagg ccgggctgct ggtgcacgcc agcgtgcgcg gcgagcaggt ctacgtgacc
    51901 ctggccccgg accagttcag cacgttcgtg tggagcgggc cccaggccgt gttcctgggc
    51961 aacgtcgacg gcagcggcgg cgtgctcgac gcgctcaagg tcgaccggcg gcggaccgtc
    52021 ttcaacgtca ccttcgaggt gtacggcgcc ttcccggcgc ggctgctgac gcggcgcgcg
    52081 tactttgcgg acgcgggcgt cctcgcgacg gggcccggct ccccgagcgt cgcctgcgtc
    52141 tacaagcacg agttcaacga ctactgcatc atgctcccct cgcgggcgcc cgacgtgagc
    52201 ctgacgctct cgcgccccca ggtggccaag ctcgccgccg tggcgaaggg cgccgcggcc
    52261 gggacgacct tcgcgctcgc ccgcggcctc gacttctccg tctcctccag cgccggggtc
    52321 gtgaccttcc cggcgcgcga ccgcgacggg accgccgtgc tggagcgcgc cagccagcgg
    52381 cgccagggcg tcgacgcggt cggcgcgacg gagcccttcg ccatgacgct cgagacggcg
    52441 cacgggctgc tgacgctgct gcagcggctg cgggccggga acgccgagct cacgttcaac
    52501 tttttcacga cgccgcggca ggcgcccctg ttcagcgtga ccacctgcgg cccggtgcgg
    52561 gcgaccacct tcttcttctg cgcgcccgcc gaccccgcca ccgtgcccgc cgcccccgag
    52621 ggcgccgccg ccaccgtcgc cgccgcctgc ggggcgggcg cgtccgccgc ccccgccgcg
    52681 ggggacaagc ggcccgccgc cccgcgcatg tacacgccca tcgccaagcg cccgcgggcc
    52741 gcctcggggg aagggggcca cgcctacgga gatttattct aataaagtgt gcaggtgtat
    52801 aaaagagagg tcgcacctcc gcgtctttac tcgccgtcgc gatgatctcc caggggaacg
    52861 gagggggttg ccgccccggc gagccatgct ggcgctgcgc gctcgagtcc acccgctgca
    52921 tcacgctgat gggcgtgctc gtcgcgctcc tcgccgcctg catgctgtcc gtcccgcccg
    52981 cggcgtcgac gatgctgctc ggcgtcgcca gcctcatggc catgctgcgc ctgcccatgc
    53041 ccctcgtgga ccggttcatc cccgcgtgca tgggcctcca gctcgtcggc gccgccgtct
    53101 tcgccgcggg ctgggcgctg gccagccgcg acgcgatctc ggccggcgtc ctgctgtggg
    53161 ccgtctgcgc gctcatctcg cacatgtaca acgtcgtctg cgtcgccagc gggcccgacg
    53221 cgcactaccg ccccgcctgc ctcgtcatgg gcgtcgccgc ggcctgcggc gcggcggggg
    53281 ccctcgtgaa cgtgcgcacc gaggcgcgcc tcggcatcgc cctggggctg gccgtcacgt
    53341 gcgccacgaa caacgtcgcc cgcagcctgc gcggcacgtg cacctacgtc gccagccgcg
    53401 cccggttcct ggccgcgccc gcggacctgg ggcgcggcta cagcgtggag aacgcggacg
    53461 ccgaccccac cgccgagccc gagcggcgcg tctacgaggc gaccgtcccg cacacccacg
    53521 cctacgccgg cagcatcgcg ctcttcgccc tcgtcttctc ggccgcctcc tccctccagt
    53581 ggatggtctc ccagatggtg ggccgcggca accagctcgt ctcgcccacc accgcggccg
    53641 cggccggcgc cgccgggttc ctggacgcgg cggccgtctc gctctttgtg cgcccgagca
    53701 cgcgccacct ctcggtggcc gtcaagggcg cgcacacgct cctcatcctc gcggccatcg
    53761 tcctcacggc cgccggcgag cccatgggcg tgcccatcag cctcgcggcc tccaccggcc
    53821 tcggcgctgc tcgaggcgga ccacgtccgc tgcgccacac ccgcgcgtac cggctcgccg
    53881 ccgcgcacgt gacgcgggcc ctgctggtgc aggcgtacgt gaccgtcgcc atgtgcgcca
    53941 ctagcattaa atccgtttcc tgattcacgc ccacgctcgc gcgtttttaa aaccgcgatg
    54001 gggggacggg gggccattcg cacgcgccat ggcctcgctc gcgcgtgcga tgctcgctct
    54061 gctggcgctc tacgcggcgg ccatcgccgc ggcgccgtcg accacgacgg cgctcgacac
    54121 gacgcccaac gggggcggcg gcggcaacag cagcgaggga gaactctcgc cctctccgcc
    54181 cccgaccccc gcgcccgcct cgcccgaggc gggcgcggtc tcgacgcccc cggtcccgcc
    54241 gccctcggtc tcgcgcagga agcccccgcg gaacaacaac cggacgcgcg tccacggcga
    54301 caaggccacc gcgcacgggc gcaagcgcat cgtgtgccgg gagcggctgt tctcggcgcg
    54361 ggtgggggac gcggtcagct tcgggtgcgc cgtcttcccg cgcgccgggg agaccttcga
    54421 ggtccgcttc taccgccgcg ggcgcttccg ctcgcccgac gccgaccccg agtactttga
    54481 cgagcccccg cgcccggagc tcccgcggga gcggctcctc ttcagctccg ccaacgcctc
    54541 cctcgcccac gcggacgcgc tcgcgcccgt cgtcgtcgag ggcgagcgcg cgaccgtcgc
    54601 caacgtctcg ggcgaggtgt ccgtgcgcgt ggccgcggcg gacgccgaga ccgagggcgt
    54661 ctacacgtgg cgcgtgctgt ccgccaacgg caccgaggtc cggagcgcca acgtctcgct
    54721 cctcctgtac agccagcccg agttcggcct gagcgcgccg cccgtcctct tcggtgagcc
    54781 cttccgggcg gtgtgcgtcg tccgcgacta ctacccgcgg cgcagcgtgc gcctgcgctg
    54841 gttcgcggac gagcacccgg tggacgccgc cttcgtgacc aacagcaccg tggccgacga
    54901 gctcgggcgc cgcacgcgcg tctccgtggt gaacgtgacg cgcgcggacg tcccgggcct
    54961 cgcggccgcg gacgccgcgg acgcgctcgc gccgagcctg cgctgcgagg ccgtgtggta
    55021 ccgcgacagc gtggcctcgc agcgcttctc cgaggccctg cgcccccacg tctaccaccc
    55081 ggcggcggtc tcggtgcgct tcgtcgaggg cttcgccgtc tgcgacggcc tctgcgtgcc
    55141 cccggaggcg cgcctcgcct ggtccgacca cgccgccgac accgtctacc acctcggcgc
    55201 ctgcgcggag caccccggcc tgctcaacgt gcggagcgcc cgcccgctgt cggacctcga
    55261 cgggcccgtc gactacacct gccgcctcga gggcctgccc tcgcagctgc ccgtcttcga
    55321 ggacacgcag cgctacgacg cctcccccgc gtccgtgagc tggcccgtcg tgagcagcat
    55381 gatcgtcgtc atcgccggca tcgggatcct ggccatcgtg ctggtcatca tggcgacgtg
    55441 cgtctactac cgccgggcgg ggccgtgacg ccccgcgcgt tcccccccca cgtcgaatca
    55501 ataaacgaca gcgagtccga cccgagccct cgcgtcttgt gtgtgttcgc gcgcgccctc
    55561 tcccaccctc tcccacccac actctctccc gccccaccac accccgcaat aaaccacacg
    55621 agacgacggc gtgtacagcg cgaccgggca atctttattg gtcgtcgggg cgggcgggaa
    55681 gggagcgggg cggcctcctc atcgctggga catcatctgc gagacgaaga tgtcggcgcc
    55741 gcgctggcag gccacggcgg ccgagctggc gtcgatggtg ccggcggaga cgtccgccgg
    55801 ggccgagacc gaggcctgga cgggcggctg gggggccgag gcgggcgcgg ccggggcggc
    55861 ggcctgaacg ggggcggccg cggcggctgc cgctgctgga gccggagcgg gggcggccgc
    55921 ggcggcggcg ggcacggcca ccggctgggc ctgcaccacc accggctgct gcgggaccac
    55981 ctgggcgggg acgtgcgcga cgggggccgc caggccctgg aggcccggca ggcccgggag
    56041 cgccggcacg gcgtgcgcca cgggcgaggg gggcggcgcg tgcagccccg gctggggggc
    56101 gtacatcggc gggtacagcg ccccggctgc gtggtgcggg tgcgggtgtc ccacgacggc
    56161 cccgggcggc agcagctgcg gcggcgccgc gggcgcgtag tacggcgtcg ggtagcggag
    56221 ctgctgggcg cgcaggtggc tgatctcgcg ctggagcgac gagaccacgg cggcgaggtc
    56281 gctcgcgggg ggcggcgcct ccccggggta gtacgcgttg tcctgggcgt agtcgtcgta
    56341 gcggcgcttc ctggcggggg gccggggctc gggcgagggc gagcggcggt ggcggcggtc
    56401 catggcggcc gagacgatgg cgccgagctg ggactccagg ctgggcgccg ggcgctggtt
    56461 gaccaccagc tggttgtact gcgccgcggg cacgaagatg tagtcgccgg gcgctgcgct
    56521 cggcggggct gccatggccg cactgggccc gggcgccggg gaggccccgc ttttaggcag
    56581 aagccccgcc cacatcgtcg cctgcaggta ggtgtgtccg cgcacgccgg cctcgcggcg
    56641 gcgcgccgcg accagctccc agcggtcgcg cagcagcatg ttgttcacgg ccgtcgagag
    56701 cagcgcgcgc gtgagcgcct cctcgctcat gtgccacacg cgctcgcggt ccggcgactc
    56761 ggcggcgcgc gccagcagct cggagcgcgc ccgcgccgag agctgccgga acggcgccac
    56821 ggcggcctcg ggcgaggcgt cgtacaccac gatggtgccc acgcgccgcc cgatcacgca
    56881 gagcgccacg tgcgcaaaga gcgtctcgtc gggggcctcg ccgggcgcca ggcgccgcga
    56941 ggacagggac gccgagggca ggtagttgct cagcaggtac agcagccgct cctcgtccga
    57001 gagccgcatg tccccgaaga agtccgggcc cacggcgcgg gcgagcacgg cccccagctg
    57061 cgggcagttg acgacgccga ggaagaaggg gccgcggtcg tcgtcgacca cggccagcac
    57121 ggcgccgatg tcgcagcgcg ggcggtggtc gatgttgatg ggcagcgggc ccgccggggg
    57181 cagcgcggcg gccacgatct cgcgcgtcag cgcgagctcc ccgccgtccc tatcgtacag
    57241 ggccaggtag ccggacacgt acacgggccc catggcggcg gcggcgcgcg cgcggagact
    57301 gcgggctcag gcggcggcga actgcgggat atagcccagg cagagaaagt acaggaggtc
    57361 gtagtcgctg gagacgccaa actgcccgag gcgcttgtcc gccgcgttgc gcaggtgcgg
    57421 ctgctgcagc agcaggccca gcccctcctc gtactgcacg gccacggcgt cgtgcgccgc
    57481 gatgacctcg ttgacggggg ccgtcacgcg ctggcggttc tgcagctcca gcgccaccag
    57541 gcgcaccagg ttgagctggt ggcgctgcac gcgcgcgcgg atcgagtgcg cgtccagcgc
    57601 cagcgcggcc agcccgggga agagctgcgt gagctccgtg cgctcgtccg cgcggtaggc
    57661 cacgacgacg tagtgggcca gcaggaagcg caggttgccg tcgccgctgc gcgaggcggg
    57721 cgcgtccccg ctggcgccgc gcggcggcgg cgcgttgggc acgagcgcgc cgagctggaa
    57781 gttgttgcgc aggcggtccc cgtacacgtt gccgttgtgc agcaggcgcc gcagcagcag
    57841 caggcccgtg atggtgttca ccgtggcgcg cagcagcggc gcgtcctcgc cgaggaagag
    57901 gttctggccg cggcccagga aggcggccgc ggcgcggttg acctcgtcca cgaagcccgc
    57961 gccgtcgacc tcgttggcgc cgacgttcgc gccggggacc acgcgcaggc gcgccagcgc
    58021 ggcgagcacg ctgtggccct ccagcgcgta gcgcccgtgg agctgctcgc gcggcacgcg
    58081 cgggtagttg tagcggtacg agatgcgccc gccctcggcc agcgcctggc tcagcgcgtc
    58141 caggtactcg gggacccgct ccagcaggtc cgcgatgccc agcggggcgg cggcgcccgc
    58201 ggcgccggcc ccctgccgca cgcggtgcac caggtgcagg cacagcgcgg cgctctcgag
    58261 cgccgagtag tgccggttgc ccacgtacag gcgcccgcag gcctgcagcg ccgtggtcgt
    58321 cacgcccatg aaggtgcgcg acatgcggcc gtcgcgcgag tcgatggcgc gcgagacctg
    58381 cgggcgctcc gcgacgagcg tggcctggag cgtggcgtac cacgtgccga agagcacgcc
    58441 ggaggcggcg ccgcgcgcgg cgtacaccat ggccaggaag tccagcgaga ggttggcgtc
    58501 gtaggcgagc gccacgtcgt tcttggcgat ctgcacctcg cggccctcgt ccgcggccgc
    58561 ggtcgcctcg ggcgcctcct cggcggcgcg cgccgcgtcc gcctcctcgg cggcgcgcgc
    58621 cgtctcctcg agcaccacga gcgcctcggc cacgcgctcc acctgccgct ccagcggccg
    58681 cagctgctcg tccacctcgg cctcgaggcg cgcgcccgcg gccatggcgt tgtccagcgc
    58741 cgcggcggcc gcgcggcggc gcgcgttcgc gtgcgccagc gcgaggcgcg cgtcgaggcc
    58801 ctcgctgaag cccgggcggg cccagaagcc cacggggaac gggggcgcga tgaagtggcg
    58861 cgcgctgccc gggatcgcag cggcctcgaa ggcgaaccac gcgcggtcca tggcgcgggg
    58921 ggacatgggc cgcgcgccgc cgcgcgccgc cttatcaccg cgcccacccg ctccccgccc
    58981 gtccccgcgc gccgcgatcg cgatcaccgc cgcgggccgg cgacgtactc ggcgaggccg
    59041 cgcacggtcg cggccatcgc gctcgcgttg ccgcgcgtct gggtgcaggg caggcgcgtc
    59101 acgtcgagca cgcgcatgct ccgctgggcc acgaacacca gcaggggcac gagcgtgatc
    59161 tcctcgccgc ccgggggcac ggcggcggcg aggaggcgcg ccgagtcgcg cagctggcac
    59221 agcccctcgt gccgctgccc gcgcttgctg ggcgtgttga ggttccgggg gaagcggcac
    59281 gtcttgagct cgatgacgaa gcacaggtgc ggccccaccc ccagccgcac cacgcacacg
    59341 cagtcggggc ggcgcacccc gaggttgact tcaaaggcca gggtcaagga cgccttctta
    59401 agcgtctcgc ggggaagccc gaagagactc tcgccgtacg cggacgggtc gcggcgcagg
    59461 cgttcgtaga agcggttgtg gcagcggatc cccgcccgga agcgcgccgg gatgcgcatc
    59521 ctccggatct acctcgacgg cgcctacggc accggcaaga gcaccactgc ccgggtgatg
    59581 gcgctcggcg gggcgctgta cgtgcccgag ccgatggcgt actggcgcac tctgttcgac
    59641 acggacacgg tggccggtat ttacgatgcg cagacccgga agcagaacgg cagcctgagc
    59701 gaggaggacg cggccctcgt cacggcgcag caccaggccg ccttcgcgac gccgtacctg
    59761 ctgctgcaca cgcgcctggt cccgctcttc gggcccgcgg tcgagggccc gcccgagatg
    59821 acggtcgtct ttgaccgcca cccggtggcc gcgacggtgt gcttcccgct ggcgcgcttc
    59881 atcgtcgggg acatcagcgc ggcggccttc gtgggcctgg cggccacgct gcccggggag
    59941 ccccccggcg gcaacctggt ggtggcctcg ctggacccgg acgagcacct gcggcgcctg
    60001 cgcgcccgcg cgcgcgccgg ggagcacgtg gacgcgcgcc tgctcacggc cctgcgcaac
    60061 gtctacgcca tgctggtcaa cacgtcgcgc tacctgagct cggggcgccg ctggcgcgac
    60121 gactgggggc gcgcgccgcg cttcgaccag accacgcggg actgcctcgc gctcaacgag
    60181 ctctgccgcc cgcgcgacga ccccgagctc caggacaccc tctttggcgc gtacaaggcg
    60241 cccgagctct gcgaccggcg cgggcgcccg ctcgaggtgc acgcgtgggc gatggacgcg
    60301 ctcgtggcca agctgctgcc gctgcgcgtc tccaccgtcg acctggggcc ctcgccgcgc
    60361 gtctgcgccg cggccgtggc ggcgcagacg cgcggcatgg aggtgacgga gtccgcgtac
    60421 ggcgaccaca tccggcagtg cgtgtgcgcc ttcacgtcgg agatgggggt gtgaccctcg
    60481 cccctcccac ccgcgccgcg gccagatgga gaccgcgacg gaggcaacga cgacggcgtg
    60541 ggagggggct cggggcgcgt ataaagctat gtgtatgtca tcccaataaa gtttgccgtg
    60601 cccgtcacca tgcccgcgtc gtccgtgcgc ctcccgctgc gcctcctgac cctcgcgggc
    60661 ctcctggccc tcgcgggggc cgccgccctc gcccgcggcg cgccgcaggg tgggccgccc
    60721 tcgccgcagg ggggtcccgc gcccaccgcg gcgcccgcgc gcgggcccac cctgttcgtc
    60781 ctggtcggcg acggctccgc gtggttcgtc ttccagctcg gcgggctggg ggcgctcaac
    60841 gacacgcgca tccgcgggca cctgctcggc cggtacctcg tctcgtacca ggtggtgccc
    60901 ccgcccgtct ccgcgtggta ctttgtgcag cgcccgcgcg agcgcccgcg cctctcgggg
    60961 ccgccctcgg gcgcggagct cgtggccttc gacgcgcccg gcgtccggcg cacgtacacc
    61021 acggcggcgg tgtggcccgc ggaggtggcc gtcctcgcgg acgcggaggc gcgctgcccc
    61081 gcggccgtct tcaacgtgac gctgggcgag gccttcctcg gcctgcgcgt cgcgctgcgc
    61141 tccttcctgc cgctggaggt catcatctcc gccgagcgga tgcgcatgat cgcgcccccg
    61201 gcgctcggct cggacctgga gccgccgggc ccgcccgcgg gccgcttcca cgtgtacacg
    61261 ctcggcttcc tctccgacgg ggccatgcac cagacgatgc gcgacgtggc cgcctacgtg
    61321 cacgagagcg acgactacct cgcccagctg tcggcggcgc acgcggccgc cctggccgcc
    61381 gtggtgcagc ccgggccgta ctacttttac cgcgcggcgg tgcgcctcgg cgtggccgcc
    61441 ttcgtcttct ccgaggcggc gcgccgcgac cggcgcgcct cggcgccggc gctcctgcgc
    61501 gtcgagagcg acgcgcgcct gctctcgcgc ctgctcatgc gcgcggccgg ctgccccgcg
    61561 ggcttcgccg ggctcttcga cgggcgcgcc gagcgcgtcc cggtggcgcc cgcggaccag
    61621 ctccgcgccg cctggacctt cggcgaggac ccggcgcccc ggctggacct cgcgcgggcg
    61681 accgtcgccg aggcgtaccg ccgctccgtg cgggggaagc ccttcgacca gcaggcgctc
    61741 ttcttcgccg tcgccctgct gctgcgcgcc ggcggccccg gcgacgcgcg cgagaccctg
    61801 ctccgcacca cggccatgtg caccgcggag cgcgccgccg cggccgccga gctcacgcgg
    61861 gccgcgctct cgccgacggc cgcgtggaac gagcccttca gcctgctcga cgtcctctcg
    61921 ccgtgcgccg tctcgctgcg ccgcgacctc ggcggggacg ccaccctggc caacctgggc
    61981 gccgcggcgc ggctcgcgct ggcgcccgcc ggggccccgg gcgcggcggc ggcgacggac
    62041 gagggggcgg aggaggagga ggaggacccc gtcgcgcgcg ccgcgcccga gatccccgcc
    62101 gaggcgctgc tcgccctgcc cctgcgcggg ggcgccagct tcgtgttcac gcgccggcgc
    62161 ccggactgcg gcccggcgta cacgctcggc ggcgtggaca tcgccaaccc gctcgtgctc
    62221 gccatcgtca gcaacgacag cgccgcgtgc gactacacgg atcgcatgcc cgagtcccag
    62281 cacctgccgg cgacggacaa cccgtccgtg tgcgtgtact gcgactgcgt gttcgtgcgc
    62341 tactcctccg cgggcacgat cctggagacc gtcctcatcg agtccaagga catggaggag
    62401 cagctcatgg ccggcgccaa ctccaccatc cccagcttca acccgacgct gcacggcggc
    62461 gacgtcaagg ccctgatgct cttccccaac ggcaccgtgg tcgacctgct gtcgttcacg
    62521 tcgacgcggc tcgcgcccgt gtccccggcc tacgtggtgg cctccgtcgt gggggcggcc
    62581 atcaccgtgg ggatcctgta cgccctattc aagatgctct gcagcttctc ctccgagggc
    62641 tattctcggt taataaacgc caggtcgtga ggcccgcgcc gggccgcgaa cccagactct
    62701 ctgcgtgcgc gtgtttttcc ttgtcgggcg cgggggagac ggggggggag agacgggaga
    62761 cgggaggggg gagagggacg gcacgggcgc cgtccgtcgg ggagacggcg ggatgacatc
    62821 acgagagtcg ggtggagggg atgcggggag cgccatccac gggggaaggc tgctggatga
    62881 cataactaga gccagggatg aggatccccc ttcccccgtt ccccgagtat acaccactct
    62941 ctccccgcac acatttccca ccgggcgcct aacgtggatt gcaccccggt ccgcgctacc
    63001 cggttgtgtg tgagacgggc ggagagccgc cctcgccccg gtccccccaa aactcctgcg
    63061 gatgtgtggt ccgacgaagc ctccgcggat gtgtccgccg taccctcgtc gccctctctc
    63121 ccaccgccct ctctcccacc gccctctctc ccaccgccct ctctcccacc gccctctctc
    63181 ccaccgccct ctctcccacc gccctctctc ccaccgccct ctctcccacc gccctctctc
    63241 ccaccgccct ctctcccacc gccctctctc ccaccgccct ctctcccacc gccctctctc
    63301 ccaccgccct ctctcccaca gccagactcc cgcctccccc gtccccgatc gccgaacgcg
    63361 ttcaagaatt ttttacccgc cccgaggaag gggtctctaa ggggtctcta aggggtctct
    63421 aaggggtctc taaggggtct ctaaggggtc tctaaggggg aaccagagag taaagaccgg
    63481 agagtaaaga ccagagacac attttacaat ttcgttgtac ccgggtttat tgaaaacttt
    63541 gttcaagagt taaagtgtct gccgcttgcc ggtgtgccgc gccgaggccg cgatccggcc
    63601 gccgtggacc ggggacccgc gggcctggat tcgacgggac ggcgggtccg agcgacggcg
    63661 gtccggcggc gtttcggctg cggtccccgc ggcggcgacg atccggcggt cccacgacga
    63721 tcctggtccg ggggatccag cggcgacggc ggcgctccgg gttgtggcgc cgggctccgg
    63781 ctccccggtc ttttataccc acacctcatg aatattcatg aatggttggt atgtgcgaat
    63841 ttttcggcgt tcgcacttgt tgtatataaa atattatatc ctatatatat tagcaattgg
    63901 tgcgaacgtg acgtggccca atcattttcc ttggatttgc ccatgtgacc gagtttccaa
    63961 tagctccgcc cagatcgatc gcggggccga tattttgccg ataatccatc aatattttct
    64021 tcggccgacg cgggtttcac ccggccgtcc cgccggggag gcccgtcccg gggcgcggga
    64081 ctctcctctc cggacgccgc gcggcgtcga gaccgcgccg ggacgatggt gtctgcgcat
    64141 gcgcggctgg ggccgagcga ccgggaatcc cctctcatga ccagctccac ccatcgtcac
    64201 atgcccgctc gctcaccccc ttctcccgcg accggcgacg atggggcggc cgtggcccag
    64261 ccacgacgga ggggcgctcg ctcgcgcgcg cgggggcggt gggggttggg ttctcgggct
    64321 tcggggcgga tgtgtgtgtt gtgcgtcggg ggactggggg cgagcgagcg gggggtgttg
    64381 tggacggggg acgatccggg gggggcaccg agaccgaggc gggcgggcgc gcgcgtgtgt
    64441 gcgtgtcgcg gacagagaat ggacgggggc gcggacgtgg tgtttggtta acggttttta
    64501 ttgaggacga tggagatgtt ggcgcgggtc aggcgcgccc gaaacagctg aaacaggtac
    64561 tgggccccgc ggagggccgc gggcgagtcg ccgaaggcgg tcaggagcgc cgcctcggcg
    64621 cagacggcgg acgtgggccg cagcgcgcgc cccacgggcg ccgtcgcggc gacgaggccc
    64681 cggccggcgt agagcccgtc cagcacccgc gccccggccg cctccaccag ctcgcacgcg
    64741 tcggcgtccg gcgcgttcgt ctccgcgtcg ctcatcatga ccgccagctc caggcccgtc
    64801 gccgcgtcct cccgggcgtg cttcgtcgtc ggcggcgagg cccccgccgg gtccgcgatc
    64861 gcgggggcgt gcaccacggc ggcgttcacg agcatccgca tcacctcgcc gaagacggtc
    64921 gcctcgcgca gcacgcggtt gacggcgtgg gccacggcgc tcgcggcccg agagccgccg
    64981 tggccgcccc ctcctccccc ttctcctccg tcgtcgtcgt cgtcgtcgcc cgcgcccgcc
    65041 ccggggcgct cgtccagcct gtcgagcatg ccctccagcg cggcgtagca gctcggcagg
    65101 tgccagcggg ccaggatgaa ctggtacagc gcgaaccgct gcgcgcccgt gagcgacgtg
    65161 gagcccgtcc cgaagaaggg gtccgccgcg acggcggaca cggcctcgac cacggcggcc
    65221 gaggcgtcgt ccgaggcgcc cgcggcccgc cgcaggatgg cgtccgcccc ggccacgagg
    65281 tcgcagagca tctgcaggga caggctcccg ccgcgcgtcg cccagatgcg ccgcgtcgcc
    65341 gggatgtagc gcacctgcac aaagtcgctg accaccgtcg cgcgcagcgc gcgctcggcg
    65401 taccggcgcg ggcgcacgct cagcgtgggg gccgcgcgcc cgcccttcac caccacggcc
    65461 gtgggccgcg tctcgccgct gagcgggggg cgcacgccgg ggatgccgtc aaagagcccc
    65521 tccgtcagca cctgcagcga gctgggcagc tcggagaggt acgcctgcac cagcgcgaag
    65581 caggcctcgt tcacggcgta cacgaagccc gaggaggggt gcacgatggc gggctcggcc
    65641 aggagctcca ggacgcggtc ctgctggcgg tcgtgcacga gcgtcagcga gagcgccgac
    65701 gccggcagcg agaccatgca ctcgacgagg taggggtcgt acacgtccag ctccgcgcgg
    65761 ccgcagaggt ccagctccgt cagcggcagc agcagcccca gggcgtccac gaagacgtcg
    65821 tcgctcccct gcggggcggc ccacgcgcgg ccgaggcgcg ccagctccgt gcgcacgtag
    65881 ttggcgacga cgcggttccc gggcgcgttc ccgcgcagcg tgagcccgaa cttgccgatc
    65941 tcccgcgagc gccggtgcac ggacacgatg cagcccccgt gcacaaagta cgcgcggtcc
    66001 ccgccgtcgg cgacgtagaa cagcaccccc tggtgcacga tcgtgctctg gtactcaaac
    66061 tccatggcgg cgggcacacg cggcgcggca aatgggtgag cgaggcggcg cgaccactcc
    66121 tttaaacccg ccggggggcg cctcccggcg cacacacgcg gcggcgcggg gatggaggac
    66181 gcggcggcgg acgtggacgc ggcggcggac gcgaagatga cgggggagaa cgacgcgctg
    66241 ctgagctcgg cctttgtggg cgcgcgcccg ccgcgcccgc gcttcagctc gcacgtggtg
    66301 agcctcctgg ccctggcgct cgcgctccgg cccgcgtgct gcctcgtcct ggcgctccac
    66361 ggctcgcggg ccaccctcgc ggcgctcctc accgcgctgg ccttctacgc gcgcgcggcc
    66421 gtctgcgccg tcctcgtggc gcggaacgtg gcccgggacc ggatgccgct ctcgccggcg
    66481 cagcaggcgg cgctggggct cctggcggcg gcgcggctgg ccttcctgta cgtcgccctg
    66541 gacgcgggcc gccactacgc gcccgccctc gccggggcgc tgtacggcgc cgactgcgtc
    66601 tgcgacgcgc tcgccttcct gctgccgcgc gcgtacgcgc gctccatcat gcattaaaag
    66661 gcggccgcgg cgcgcccgcg ccactctccc ccctgctccc cagcgaccgc gcacacgcgc
    66721 ccgcacgcgg tcgtcgccac acgatggagc gcccggccat cctgccgtcg gggcagatcc
    66781 tgtccaacat cgaggtgcac tcgcaccgcg cgctgttcga catcttcaag cgcttccgct
    66841 cggacgacaa caacctctac ggtgccgagt tcgacgcgct gctcggcacc tactgcagca
    66901 cgctctcgct cgtgcgcttc ctggagctcg ggctctcggt ggcctgcgtg tgcaccaagt
    66961 tcccggagct cagctacgtg gccgagggca ccatccagtt tgaggtgcag cagccgatga
    67021 tcgcgcgcga cgggccgcac ccggccgacc agcccgtgca caactacatg atcaagcgcc
    67081 tcgatcgccg ctccctcaac gccgccttct cgatcgccgt cgaggccctc gggctcatct
    67141 cgggcgagaa cctcgacggc acgcacatct cgtcggccat gcggctgcgc gccatccagc
    67201 agctcgcgcg caacgtgcag gcggtgctgg actcgttcga gcgcggcacg gccgaccaga
    67261 tgctgcgcgt cctgatggag aaggcgccgc ccctgtcgct gctggcgccc ttcacgctct
    67321 acgagggccg gctcgcggac cgcgtggcct gcgccgcgct cgtgtcggag ctgaagcgcc
    67381 gcgtgcgcga cgacaccttc ttcctcacga agcacgagcg caacaaggac gcggtcctgg
    67441 accggctctc ggacctggtg aactgcaccg cgccctcggt ggccgtcgcg cgcatgaccc
    67501 acgcggacac gcaggggcgc cccgtcgacg gggtgctggt gaccacggcc ggcgtgcgcc
    67561 agcggctcct gcaccacgtg ctgacgctgg cggacacgca cgcggacgtg cccgtgacct
    67621 acggcgagat ggtgatcgcc aacaccaacc tcgtgacggc gctggtgatg ggcaaggccg
    67681 tcagcaacat ggacgacgtg gcgcgctacc tgctcggcgg cgagccggcc cccgacgacg
    67741 gcaagcccgt gggctcggcg cgcgtgcgcg ccgacctcgt cgtcgtcggc gaccgcctgg
    67801 tgttcctcga ggccctcgag aagcgcgtgt accaggccac gcaggtgccg tacccgctgg
    67861 tgggcaacct ggacgtgacc ttcgtcatgc ccctgggggt cttcaagccg gccgccgacc
    67921 gctacgcgcg ccacgccggc agcttcgcgc ccacgccggg cctcccggac ccgcgcacgc
    67981 acccgccccg cgccgtgcac ttcttcaaca aggacggcgt gccctgccac gtgaccttcg
    68041 agcacgccat gggcaccctc tgccacccct ccttcctgga cgtggacgcc acgctggcgg
    68101 cgctgcgcca ggagcccgcg gaggtgcagt gcgccttcgg cgcctacgtg gccgacgcgc
    68161 gccccgacgc cctcgtcggg ctcatgcagc gcttcctcga ggagtggccc ggcatgatgc
    68221 ccgtgcgccc gcgctgggcc gcgccgccgg ccgccgacca gctgctggcg cccggcaacg
    68281 ccgacctgcg cctggagctg cacccggcct ttgacttctt cgtcgcgccc gaggtggacg
    68341 tccccgggcc cttcgccgtg ccccaggtga tggggcaggt gcgcgcgatg ccgcgcatca
    68401 tcaacggcaa catcccgctg gccctgtgcc ccgtggactt tagggacgcg cgcggcttcg
    68461 agctcagcgt ggaccggcat cggctggccc cggccacggt ggccgcggtg cgcggcgcct
    68521 tccgcgacgc caactacccc atggtgttct acatcatcga ggccgtgatc cacgggagcg
    68581 agcgcacctt ctgcgcgctc gcgcggctcg tggcgcagtg catccagagc tactggcgca
    68641 acacgcacaa cgccgccttc gtgaacaact tctacatggt catgtacatc aacacctacc
    68701 tgggcaacgg ggagctgccc gaggactgcg ccgccgtgta caaggacctg ctggagcacg
    68761 tgcacgccct gcggcgcctc atcggcgagt tcacgctgcc cggggacccg ctgggcaacc
    68821 agccccagga ggagctcaac cacgcgctgg cggacgccac gctgctgccc ccgctcatct
    68881 gggactgcga ccccatcctg taccgcgacg ggctcgccga gcgcctgccg gagctgcgcg
    68941 tcaacggcgc gcactttcag cacatcctgt gggtcgagat ggcccaggtg aactttcgca
    69001 acgtcggcgg cggcctggtg cacaaccggc ccgtgcggaa cgagaaccag cccctgcacc
    69061 cgcaccacga cgccgagtgg tcggtgctgt ccaagatcta ctactacgcc gtggtgcccg
    69121 ccttctcgcg cggcaactgc tgcaccatgg gcgtgcgcta cgaccgcgtg taccagctgg
    69181 tgcagacgat ggtggtgccc gagacggacg aggaggtggg cacggacgac ccccggcacc
    69241 cgctgcaccc gcgcaacctc gtgcccaact cgctgaacgt gctcttccac aacgcctgcg
    69301 tcgccgtgga cgcggacgcc atgctgatcc tgcaggagac ggtgacgaac atggccgagc
    69361 gcacgacgcc cctcctggcc tcggtggcgc cggacgcggg catggccacg gtggccacgc
    69421 gggacatgcg cacgcacgac ggctcgctgc accacggcct gctcatgatg gcctaccagc
    69481 ccaacgacgc cacgctgctc gagggggcct tcttctaccc ggcgcccgtg aacgcgctct
    69541 ttgcctgcgc cgaccacctc ggcgccatgc gcgacgtggg cgccgaggtg cgcgccgccg
    69601 cccagcacgt gccctgcgtg ccccactttc tcggggccaa ctactacgcc acggtgcgcc
    69661 agcccgtggc ccagcacgcg gcgcagagcc gcgccgacga gaacacgctc tcgtacgcgc
    69721 tcatggcggg ctacttcaag atgagccccg tggccttcac ccaccagctg cggcgccagc
    69781 tgcaccccgg cttcgccctg acggtggtgc gccaggaccg cttcgccacg gagaacgtgc
    69841 tctttgcgga gaaggccagc gagtcgtact ttatgggcca gatgcaggtg gcgcgcaccg
    69901 agagcggcgg cgggctgcac ctgcagctca cgcagccccg cgccaacgtg gacctgggcg
    69961 tgggcttcac ggccgcgtac gcggcggccg cgctgcgcgc ccccgtgacg gacatgggca
    70021 acctgccgca gaacctcttc gccacgcgcg gcgccccgcc catgctggac gcggacgcgg
    70081 acgactacct gcgccgcacg gtcaacgccg gcaaccgcct ggcgcccgtg cccgtcttcg
    70141 gccagatgct gccccaggtg cccgcgggcc tggcccgcgg gcagcagtcg gtgtgcgagt
    70201 tcatcgccac gcccgtctcg gtcgacctgg cctactttcg gcgcgcgtgc aacccgcgcg
    70261 ggcgcgccgc cggcgaggtg cacggcgagg aggggctgat gttcgaccac agccacgcgg
    70321 accccgcgca cccccaccgc gccaccgcca atccctgggc ctcgcagcgg cactcgtacg
    70381 cggaccggct ctacaacggc cagtacaaca tgagcggccc ggcctacagc ccctgcttca
    70441 agttcttcac gcccgccgag gcggtcgcca agagccgggg gctggcgcgg ctcatcgccg
    70501 acacgggcgc cgccgcctcg ccgacgagca acggcgagta ccagttcaag cggcccgtgg
    70561 gcgccggcga gctcgtcgag gacccgtgcg cgctcttcca ggaggcgtac ccgccgctgt
    70621 gcgccagcga ctcggcgctg ctgcggacgc ccctcggggc cgaggagcac tttgcgcagt
    70681 acctcatccg cgacgagtcc ccgctgaagg gctgcttcca gcacgcgagc gcctgagccg
    70741 cgggaccgcg ggaccgccgg accgtcgtct ccgccctgcc ccccccctca ccccgactct
    70801 gtcacccgcc cccaccctcc cgcgcggccg cgcgtgtata taaactgtgt acacggcacc
    70861 cgcccgcgtc agtgtcttct ttcgctcgcg ccgccatgga ggtggacatt gcgctgccta
    70921 cgctgtcccc cggggatctg tcggccctgc agaggtgcga gggccgcgtg gtgtttctgg
    70981 agacgctgcg gcggcacgcg acgctgcgcg aggtcgcgct gccctgcggc ggcgacgtgc
    71041 tcgcggccat ggctgaccgg cggcgcttcg cggccgtcat cacgcgcgtg acgccgcacc
    71101 gcatgctggc cacgccgctc ggcgtcggcg gccgcgggca gtcgctggtg ctgcagaaca
    71161 cgggcccctt cgacctgacc aacggggacc acgtgtgcct cgtcccgccg ctgctcggcg
    71221 acgagtgcct gcggctcacg tcggccaacc tggagctgcg cttccccatg acgctgccgc
    71281 tcgcccaggc ccgcgagctg acggcgcggg tggtggcgcg cgccgccgag acgctgcgcg
    71341 gcggggcgcc cgcgcggggc gccgacgtgg tcttcagcaa cggccggcgc taccagctgc
    71401 ccccgccgca ccgcgacaac gccgaggcgg ccacgcgctc gctggtgctg aacatgatct
    71461 tcctgctcaa cgagggcgcc gtgatcctgc tgtcgctcat cccgaacctg ctgacgctgg
    71521 gggcgcagga cggctacgcc aacgccgtga tccagctggg cagcgccacg cgcgagctcg
    71581 gccagctggt gcggcagccc ccgccgccgc tgccgcagga ccacgcgcgg cgcttctgcg
    71641 tgttcgaggc gctggaggcc tggatcgcct cggcctcgcg gctgggcgac acgctcggca
    71701 cgcggcccgt ggcgcgcgtg tgcatcttcg acggcccccc gaccgtcccc cccggcgaga
    71761 aggccgcggt ggtggaggtg tgacgacgcg gcgcccgcgg aggatgcccg cccgtccccc
    71821 tcgccccccc ctccctcgca aataaacccg tgaaggaaaa aacgagagaa acgagtcgtg
    71881 cgtgtctggc gtttattttc cgggccgggg tggcgaggcg gagcgaggga ggaggggggg
    71941 cgggtggccc cgggaggggg ggggcgcccg tcctcccctc aggcaaacag cccgtcgggc
    72001 agcgtgctca ggtgcacggc catgacgagg gccacggcga ggtcgtcggc gcagccgccg
    72061 cgcttgccgg tgaagacgcg gtgctcgccg gcccccgagg ccgtctccac gaggttcccg
    72121 agctgggcgt tcaggtactc gacggggtcg gcgcgcgcgc ccacggtcac ggacacgagc
    72181 tcctgcgagg ccatgacggc gcccgagttg aactgcttga cgaaaaagtc gaaggcgggg
    72241 gtcttttgct tctgcagcag gaagaagggg tagcgcacgg cgcccgcgcc cgcggcgccg
    72301 tggtggtaga agaccacggc cgggtcggcg acgacgcgcg cggcgcgcag ctccgcgagc
    72361 tcgcggcgca tggcgcccac gatggccacg gccgagtcct ggctgctgtt gccctcgacg
    72421 gccacgcgca ccgccgagaa ggcgccgtcg tgcagcgcca gcacgcgcgc caggcagcgc
    72481 acgacgcagc gcgcgatctc gtcggcggag gcgcccgtga gcgcgcgcag gaaaaagtgc
    72541 tccaggccga gcacgatcca gctgcgccgg tagctgccca cgacggccac gccggtgccg
    72601 gaggcgcgcg cgttggccgt gaaggccggg tccacgtaca cgtgcagcgt gccggccagc
    72661 aggcggcggt tggccaccga ggaggggcgg tagagcagga agcgctcgcc ggcggcgcgc
    72721 gtgaggacgg gcgcctcgcg cgcggccacg gcgccgccga ggatctcctg catgaaggag
    72781 tccgggagca gccgctcggc cgtggtgcgc gtggcggcgt ccatggtgat gaagacgggc
    72841 ttgttgagca cgtagcacga gcaggcggtg gcgtcggtgt gcgccaccac gcggcgcatg
    72901 tgctcgtcgc agacgtacgt gaccacgttg agcatgtcgg tgccgcggag gttggtgagg
    72961 aagctggtgc tggccttgcc ggtgttggtg gaggagacga agatgatctt gcagctggcc
    73021 tggttcatga agccgaggat ggtctgcacg gcatcggggc gtataaagtt ggcctcgtcg
    73081 acaaagagca ggttaaagtc ctgtccgcgg atcccctgta acgacacgcg gggagagaga
    73141 gggggggacg gtgagcggcg ccgcgatgga cgcccacatc gccaacgaga ccaagcagca
    73201 gatgacgcgc ttcgcgcccg cgctcgtgca cgtcatcgtc ccggaccccc tcctgcggcg
    73261 cgcgggcgtg gacccgctcg cgcccttcgc cgcccacgcg cagacgcgct accacggctc
    73321 gggcgtctgc gagccgtggg tctccgtgtt cgcgggccac gtgcagacgg gcgccgtcga
    73381 gagcgtgctg acgctgccgc cgctgcagcg cccgcgcggc cccggggggc tgttcgtctc
    73441 gctgcccctg gcgctcggcg cccactttga cggcttcacg acggcggcgc tgcgcgtggg
    73501 cgcgcgcgag ctggtcttca cctacgacga gctcctgccg gcccgcacgc gctacaacgt
    73561 ggacggcgag cgcctggagc gcctgtgccg ccagttcgcc aactacgcgc gcgcgcggcg
    73621 cgtggccccg gcggtcgcgg ccgcgggggg ccacatcgac gcgctgctgc ccccggcggc
    73681 ggccaccatc gacggcgagg cgcagctgac gcgcgggggc ttcgacgacc cggcggcgcc
    73741 gcacgcgcgg gacgccgacc gcgagatcct gtcgctggtg cgccgcgcgg ccgagctcgt
    73801 cgcggcgcgg cacccggtgc gcagccacgt ggcgagcggg ctgatgcagg gcgccctcgc
    73861 gcggcgcggc ggcggaggag gcggcgcggg ggcgctcgag gcggcggcga cggtgccggc
    73921 gcccgcggcg cgcgaggacg cgaacggcgg cggcgccgcc tggcgcgacg agctcctgct
    73981 cacgccccag gacccccggc cgctgacggc gctcgactgg ctggacgcgg gctacgccgc
    74041 gctcgcgggc ggcgacgcgc ccgcgcacgt gtggcgccgg cggcccgtgt ccctggtggc
    74101 gcgccgccac taccagaccg gcgagacgtt cgtcgtcgtc gcctacgagc actccaccgc
    74161 ctggggcggc cggcgcgggc cccggagcga gcccctggcg cgcgtgctcg ccgaggagtg
    74221 cgagcggcac ggcgtcgagc acccgcgcgc cctgcccgcg gaggcgcggc gggagctggt
    74281 gcggcggcac gccgagctgg ccgtgccgct gggggacgag gagccgccgc tgccggtctt
    74341 tgacgccacc gcggagctgg tgctgctgga gcgcttccgc aacgcctgcg tgcgcgcgct
    74401 gctggccggc gtccgcgagt ccgtgcgccg cgagccgcgc atgcgccaga tcatcgagtt
    74461 cgcgatccgc ccgcgcgacc gcgaggccgt cctcgacgtg gccgggcgcg ccccggcgct
    74521 gctggacgcg ttcgcgcggc gcctcgagca cacgccggcg cgggagatgg tcgactcggg
    74581 cctgatgacg gccgcggcgg cgcacctcgc cgcgcgcgcc accgccggct acgtgacctt
    74641 cgagagcggc ccgctgctgg gcggcgtttt cctcttcgac tactacagcg ccggcgggga
    74701 ggttataagg gtgacgcggg ccccgccggc cgtggcagtg gagccggcga cgcgcgggca
    74761 gttcgcgtgt cgcttccgag gcgcgtcgca tcgctgtctc ccgggcgaga gctacgcgta
    74821 cctctgcgtc ggcgtgtcgc gggacctgcg cgcgctggtg gtgctgcccg gcggcttcgg
    74881 cttcttcgcg accctccggc tggagtggcc cgccgcgctg gtggaccccg tgctcgagcg
    74941 cctgtgccgc cgcgtgtagc ggggcgaggg gggcgggcgc gcgccatgga ggtggccgcg
    75001 gccctgacgg aggactttgc cgcctggcgg ctgctgcgct ccgactcgcg cgtcaaggtc
    75061 tacgccgccc tcgccgtcgt gggcgcgcgc ctggccgccg tggcgcccgg cgccgcgacc
    75121 gtcgccgcgc gcgtctacct gacgcgcccg cgggcgctgc gcctggcgca gggccgcttc
    75181 cacgtcgtgg tcctgctcaa cgacgccgcc tacgcgctgg tggcggccgt gaccacgacc
    75241 acgctccgcg ggagcggcgg cgagctcgtg cgcctgacgc tgggcgacgc gagcctcgag
    75301 gcgctgcccg ccgacctgcc cgtcgccgag cccgtgcccg ccgcgccggc gggccgcctg
    75361 gacctggacg ccgccgagcc cgtggccgcg gcgccggcgg gccgccgcga ctgcgtggtc
    75421 ctggcccccg gcgcgtggtg ggcgcgcggc cgcgtctact tcctgcagat ggacccgagg
    75481 ctgctggcgc tgtgccccgc gggctggcgc gcgcgccacc tcggcgccgt gctcgccggg
    75541 ctgctgagcc cccgcgacga cgacggcggc agctgctgcc gcgagtgccg cgtggagcac
    75601 gtggacgccc tcaacgcgac gccgcacccc gacggggccg ccgcgccgtg cctgtgcgcc
    75661 gcgccgtgcc tgtggcgcca ggcggacaag cgggagctgc gcgcgagcga ctcgggcctc
    75721 ttccgcgtgc tgttcctgga cgccgtgcgg ttcgtgcgca tgctcccccg ccgcaagatc
    75781 gtcgacgtcg cctccgagct catcggcggg ctggacgccc gcgggcgcca cgtggtggtc
    75841 aacgacgccg gctggcgcct ggtggccctg gacccggacg cgagccgcgc gctcgtgtgc
    75901 gggtgcccgc tgctgcgcgc gctctgcgac ccccccgccc gcgccatccc cgagctaata
    75961 aacgattatt gaaatgaaaa aaatgggtac ttgcgtttgt attgtggctg gaggcgaaca
    76021 cgatggtgct gcgcgcgccg tcggggaagg tgacggtgat gttctcgccc ttgacgtggt
    76081 ccacgcgcgc gtcgcggcac cagcggcgca ggcgcgcgtg gatctcctcg aacacgggct
    76141 ccgtggcctt gcggatgtgg gccgtgtagc cgacgcggat gccgcggaag gtggccagcg
    76201 cgagggcgat gagcgggacc aggaaccagg tcttgccgtg gcgccgcggc acgaggaaga
    76261 ccgtgacgcg ctggcgaaag tggcgcaccg cgtcctcgga gaagagcggc gtgtcgaagg
    76321 ccgccagcag gtaggcggtg gcgcgctcgg cgtggtcccc gagcagcacc gtggccagaa
    76381 agtacaccgc gtgcatgagg atcatcttct ggaagagctc cagcgtgccg cgcccgccgc
    76441 cgcctttgcc ctcgcccccg cctccatcgt ggccctcctc ggcggcgtcc tccggcgcgg
    76501 ggccgggcgc gcccttcgcg ccgccccggg ccctctcgtc cttctcctct tcccccccat
    76561 cctcctcgtc gccgtcgtcg tccccgggcc ccgccgccgc cgccgccgtc ccgagggcgg
    76621 ccgtcgcggc gtcgcggaag gagcgccgcg acaggagcgc gaagcggttg acgaagcgcc
    76681 ggagctggcg gaaggccccg gacgtccgca tggcgtccac cgccgccatg gcgctcgtgt
    76741 acgcgttgcg gtggaaggcc aggcgctcgc cgtcgtaggc ggcgaagtcg agcgcctcgg
    76801 ccgcgcgcgc gagcgccggg tccacggcgg cgcggccgcg cgcgcccccg aagagcgcgg
    76861 cgcgcgcgag cccggcgaag atccgcgcgc tctcgcagca gttgtgcagc gtgccgaccg
    76921 ccgggaccac cgtctggtgg cactgtgggg cggcgatggc aaagttgaaa aagcgggcct
    76981 cctcggcgca gtcgcgctca ctggcctcgc gcttgcgctt gaggtccgcg tagtagcgcc
    77041 gcgtcgcgtc gcccaggccg aacatgctcg cctcggaccg ccgggagcgc cgcgtgcgcc
    77101 tcgaggaggc ctttcagcgc gagagcgtct tcaaggcgcg caccgtcgag cttctgcgcg
    77161 ggcgcgccga caagaaaaac cccgagttcg tccgggcctt tatggcggcc aaacaggccc
    77221 ggcgggatgt agagcgccac ctgcggctgg ccgcccgggt ggagtctgtg gaacaaaaag
    77281 cgcgcgcgct gcaggcccgc gtggaagccc aggcggccgt ccgcggggtc ctggacaggc
    77341 accggcggtt cacgcgggcg gactttgcgg aggcgctcga cgccgcggag gacgcgctcg
    77401 cggccggcga ggaccggctc gacgacgcgg ccgcgctcga cgaggactgg gccggcggcg
    77461 gggcgcccga cgaggacgag ggggaggagg cggacgaggc cctgctgacc caatggctgc
    77521 tggaggaggc ggaggaggcg tgagccgggc cgcgctggcg cggccgccca tccaccgcgg
    77581 cacgtccgcg ccgggcggcg ccatcgccgc cgccggcggc gacggggacg gggacgaggc
    77641 ctcccggctc ctgggccgcg cgcagccgcg cgaggccccc tacctgatcc cgcgcccgga
    77701 cggggacctc gccgtgccgg acgacctgca gtacgcgacc ctcgacctca cgggcgaccc
    77761 cgtggccgtc ggggccggat cgtacggcag cgtgctcgtg tacggctcgg tggccgtgaa
    77821 gacgctccgc gccggcttcg gccacgaggc cgtcatgacg ctgctggccg cggaggaggc
    77881 gcgctccgcc ggcgtccgcg gcgtggtgcg cctgatggga ctctcggcgc cgctgcgcca
    77941 gctcatgttc ccggcctacg agatggacat ggacgcgtac cgccgctcgc tcacggcgcg
    78001 cccggggcac gtggtgcacg ccctggggcg cgtcttcacc gagctcggcc gcgcgctcgt
    78061 gttcctcaac ggccgcgggc tcagccacct ggacgtcaag ggcggcaaca tctttgtgcg
    78121 cacgtgcggc aacatggtcg tgacggccgt catcggggac tttagcctca tggccctcaa
    78181 ctcgcgcagc gcgctcgcgg acccgcgctt ccgcctcgcg cgccgcaagg cgctgaagat
    78241 cacgtcgctg gcgcggagcc cgccgacggg cgtcctcctg gggcatgcgc gcgaccggcc
    78301 cacgcgggtg ctgatggact ttattaacgg gcgcccgccg ccgccgggcc ccctgccgta
    78361 cgaggtgggc ctggcgatcg acctgtgcgc gctgggccac gtgctgctgg acgtggcgct
    78421 cggcctgcgc ccgcagcgcg gccaggcgct gacgcgcgag tacgccgtgg aggtgctcgc
    78481 gcgccgctgc gtgctcttcg cggccctgct cccgccgggc agcggcccct ccgccgaggc
    78541 cctcgccggg gacatcctcg aggaggagct ggccgccggc ttccgcgagg gcgtggccag
    78601 ctcgcgcccc ggcaaccagc ccccgcgcac ggtggccccg ctgctcgagc tcgtggcccg
    78661 gttctgcggc gaggatggcg gcgctcgttt tgccgaactc gctgcctgag gagctggccg
    78721 cgcgcacctt cctgcggttc ctgcgcgggg cgccgcgccc cgcggccggc ggcgcggcgc
    78781 cgctggcgta ccgcctggcg tacgtgcacg acctgctcgt cgagctggcg cgccacggcc
    78841 tcgccgcccc cgacgcggcc gcggcggcct ttggcggcgc gcgcccgccg cccgcgcccg
    78901 cgggcgtccc cgccgcggcg gcgcgcgccg ccatcctgac ggtggaggcg gccacgcgcg
    78961 cgcagagcga gagcgacctg tggacgctgc tgcgccgcgg gctggccacg gcctcgaccg
    79021 tgcgctgggg ggccgacggc ccgcgcttcc cgccgacgtg gtgcgaggcc agcacggcgc
    79081 gctgcggcac gcccgacaac gcggcgctca tctttggccg cgtcaacgag agcgtggccc
    79141 gcgccgccgt cgcggccctg tacgccgagg cgcccacgcc ggacctgccc ggggcgatcg
    79201 cgggcggcga cgggggcggg gacggggcga aggaggagat gttcaccttc gacgagacgg
    79261 gcgcgccacc gccgggccac gacctcttct cgtgcgggct gctgctggac ccgcgcaccg
    79321 gcatggtcgg ggcctcgctg gacctgctgg tctgcgatcg cgacgcgatc gggcgcctgg
    79381 cgccgcaccg cacgcagacg gagatgcgct tcttcgagat caagtgccgc gccaagtacc
    79441 tgttctcggc ggacgacgcg agccccacgg cgcgcgcgta cgcgcgcctg ctcgagcgcc
    79501 ccgacgcgga cacgctgcgc gggttcctgt actccatcgc ccggccgggc gtggagttct
    79561 tcgagggcgc cccggggccc ggcgaggcgc tggcgacggc cgaccccgcc tggcgacgcg
    79621 ggggcgccga ggacgccccg ccgacgcgcc ggaggtgtgg cgccttcgac gggcgccacg
    79681 tcgccgcgaa cgcgcacgcc cagtcggagg tctggctatt tagcgacccg gtggacggcc
    79741 gtcaggacat tgtgccctgg gcctcgggcg agcgcgcgct gagggtgccc gtgttcgcga
    79801 acccgcgcca cgccaacttt cggcagatcc tggtgcagag ctacgtggtc gccggcgtct
    79861 tccccgaccg ccccgcgcgc ccccacctgg ccaccttctt cgggcgccgc cgccgcccct
    79921 gcgagcagaa ccggacgctc gacctggcct cgctgtgcga cgtgccgccc gcctgcgccg
    79981 tgcccgtgct gctgatcgtc acgcccgtct ccgtgtgcga ggaggcgttc gaggacctgc
    80041 gggcgcgcgc cgaggaggcc tttcgcgtca ccgcgtcgcg gacatgggac agtgttgctg
    80101 ccgattctcc agcaaccgcg tcgtgacgag ctccggcgag gtgctgacct tcgacgcgga
    80161 cgcgttcgag gactttgagc tcgagcccat ggtcggcgag cccggccccg tgcgccccaa
    80221 ggccccgtac cgcgtgtcgc gcgggaacct ccgcgaagcc tcgcgggcgt actgactgca
    80281 ataaacccgt ttgtcatact atcgcatcgt tcccgtctgg tgtctggggg agaggatggg
    80341 ggagaggatg ggggagagga tgggggagag gatgggggag aggatggggg agaggatggg
    80401 ggagaggatg ggggagagga tgggggagag gatgggggag aggatggggg agaggatggg
    80461 ggagaggatg ggggagagga tgggggagag gatgggggag aggatggggg agaggatggg
    80521 ggagaggatg ggggagagga tggggcatgt ggcgggttgg gtgtgagacg atggccgagg
    80581 acgggggaag agagccgtgg ggtggggcga gatggaatgg cacacgggcc gcaaagtggg
    80641 acgatgggga cgggcctcaa cgcgggacga gggcggcggg gcgggaccgg ggacaaggga
    80701 caggggcggc gagagacgga cacgagagga ccatgtgcga tcgaaacgaa cgtttattca
    80761 aagccgaggt tctcgtacac gacctcgtcg ccgtcgtcaa actcgtcgtc gcccgacccg
    80821 ggggccagca ggtactcgtc gttgccccgg ccgtgcaggc gcttctgcag gtaccgccgg
    80881 gccgtcgtcc gcgccttgtc cacgttggcg tagaaccggc tgccccgggc gcggtgggcg
    80941 atgcaggcgc ggaccaggcg cacgacgatc atcgccaggg cgatcagcga caggaccgcc
    81001 aggacggcgc gcgtcccgat gacgacgccg tgcgtctccc cgagggcctc gctgaacttg
    81061 gcgaagtagc ggtgggcgga cacgccgaag gccgcgctgg ccacgagcac gcagaaggcc
    81121 ggcgtgggga gcacctgcac gtagccggac acgacgacct cgacgaacac catcagcgcc
    81181 agcgccagca gcgtgaacac ggccagggcg gcctccgccg tcttccagag gctgatgtgg
    81241 aagctgttgg ccaggagcac gccgagcatc agcccgacca cggccgcgcc caggccgacc
    81301 gcgccgagga cgacgttcgt cacgacggcg cgcgcgtgca ccgccacgcg gcgcagcggg
    81361 gggctggccg ccagggcggc gcgcacgtca cccgtgccct tgcaggcgtg gcacgcccca
    81421 aagagggcga gaaacacaaa atgggtgatg taggcggcgg cggccagacc cgcctgcttg
    81481 tgggccatca gcagcaccac ggcctggagg gtccaggcgc agagcgcgcc gagcatcagg
    81541 gtccccgggg cggccaccgt cgacgccgcg tagagcacca cgctgggctg gaacgccagc
    81601 cggccggcct cgcgccgcag caccacggcc cccgcgaccg cgtacagggc gtgcgccagc
    81661 agcacggtgg ccgtgaagcc gaagaagctg gtcacggtgg gcgtttccag aaacagggcg
    81721 ggggccacga gcggctggcg cgtccacacg ccgccggagg tgtcgttgag cgtgtcgtag
    81781 tcggccacgg tcgcgtaaaa gcacgggaac cccatttccg ggagcgaggc gaagataagg
    81841 gtgaggacca gcgtcagggc ggccagggcg aacccgcaga cctctatcag ccaggagcgc
    81901 cagctcacgg cctcggcgtt gcgcggcccg cacatggcgg cggacgcggg cgggcgccgc
    81961 ggcggggccg aggaggacgg cggggcgttc gcctcgagcg tgtcgctcgc gcggatgcta
    82021 tacggttgcg acctcccggc cgtggtgcgc agccgctggc cgggcgtctc cctggacctg
    82081 cagcgcgacg cgcccgtcga gcttccgtcc ccgcacgata ccgcctgccg ccgcgtcctc
    82141 gtggcgcgcg ctccgatggg ctcgggcaag acgacggcgc tgctgaaatg gctctccgcg
    82201 gcgctggcgg ccactgatat gagcgcgctg gtcctgtcct gccgacgcag cttcacccgc
    82261 accctggcga gacgaatgga cgacgcgggc ctgggatttg tgacgtactt tgactcggac
    82321 gcatacgtca tgacgggccg gccctaccgc cggctgctgg tgcagatcga gagcctgcac
    82381 cgcgtggacg agcacctgat caacaactac gacgtgctcg tcgtcgacga ggtcatgtcc
    82441 acgctggggc agctctactc gcccaccatg gcgcgactgg cccgcgtgga cgccctgctc
    82501 gcgcggctgc tgcgcggctg cccgcgggtc ctcgtcatgg acgccacgat caacgcgcag
    82561 ctcgtggagc tgctcgtgga gctgcgcggc gagcccagcg tgcacgtggt ggtgagcgac
    82621 tacgccacga ccgccttcgc gagccgccgc tgcctcgtgc tccggcacct cggggccgag
    82681 gtcgcggcgg gcgcggcggg cgcgcgggag gacggcggcg gcgacgggag cgaggacgcg
    82741 gcgcgggccg ggagccccgc cccgacgacg gcggcggcga cgacggcggt ggaggcggcg
    82801 ggggcggcgg gggacagctt cttcggcctc ctgggcgcgc gcctcgccgc gggggacaac
    82861 gtctgcgtct tctcgtcgac gctggccttc tccgagctcg tggcgcgctt ctgcgcgcgc
    82921 ttcacgccct ccgtgctggt gctcaactcg cagcggcccc ccgaggacgt gggccgctgg
    82981 gccgtgcgcg ccctcgtcta caccaccgtg gtcaccgtcg ggctcagctt cgacgcgccg
    83041 cactttcaca gcatgttcgc ctacgtgaag ccgatggcgc acggcccgga catggcctcc
    83101 gtctaccagt ccacggggcg cgtgcggcgg ctgctgcgcg acgagctctt cgtgtacgtg
    83161 gacggctccg gcgcgcgcgg cgagcccatc ttcacgcccg tgctgctgaa ccacgtcgtg
    83221 ggctcgggct ggccggcgcg cctgtcgcag gtgacgaacc tcgtgtgcgc gcagttccag
    83281 cgccgctgcc gcccggcgtt cgcggcggcg cgcgggatgc gcctcttctc ccgcttcaag
    83341 ttcaagcacc tgttcgagcg ctgcacgctg acgagcgtca acgacagcct caacatcctg
    83401 cacgcgctgc tggagaacaa ccgcctgcgg gtggcgctcg agggctgcga gccgccgctg
    83461 acggcgcgcg ccttctgcga ctttctgcgc gacgcgcgcc tggacgcctt cgccagccag
    83521 caggtgctgc ggcagctgcg ccccccggac cggccggtgg cggccgacat cgcggacagc
    83581 ggcgaggtgg ccaccttcgt ggagaagtac ctcgtggccg acgtgcccga ggacgagctg
    83641 caggagctgc tgcgcgcgct cgccaacccc gtgacgcggg agcagtttgt gggcctggcc
    83701 gtgctcggcg cgtgcgcgcg cgtccccgag gcgctgcgca gcgagcgcgt cttcggggcc
    83761 gtgtacgggc actacgcctc cggggccgtg cccgtggtgg ccgacgggcg gctggagctg
    83821 gcggcgctgg cccccgactt caacgtgccc gcgcgctggg ccctcacgcg gcgctgcgcg
    83881 cgcgtcgcgg aggccgccgg gctcttcgag ggcgcctcgc cggaggtgga ctcggccgcg
    83941 gtcgcggcgg cggcggccga cgccgagctg gcgccgctgc tgctcgaggt gctgcggtgc
    84001 cacgtgctgg acgcgacgac ggccgcgcgg cgccccgtgc gcgcggccct gagcgcgctg
    84061 ggggcgggcg ggggcgcggg cccgctgagc cgcgggcgcc acgccgcgct cgtgttcaag
    84121 gtgatgtggg aggaggcctt cggcgtgcgc gtcggccgca gccggcagac gttcccgggg
    84181 cccacgcgcg tgaagaacct gcgcaaggcc gagatcgccg cgctgctgcg cgacgccggc
    84241 ctggacccgc ccgcgggcgc cacccaccgg cagctgtacg ccctgctgat ggaacgccgg
    84301 ggggactttg cgggggagag gtataaactg cgcctgcccg cctggagccg gctcatgtac
    84361 ctgacccagg gcggcttcga cgcgccgctg gacgccgcgc tctcgctcgt gcccgcggag
    84421 gcgtggccgc gcaccgaggg ggccgtggac tttgcggcgc tatgacggcc gcggcggggg
    84481 agcgcgtgtg cgcggccggg atctacacgg cctggacgga gcccggcgcg ccgggcgagc
    84541 tccacgcgct ggcgcacctg ctgtgccgcg acggggccgg cgcgtacgcg gcgcgcttcg
    84601 tccacgtgac ggcggcgccg tggacgggct cggcggccgc ggtggccgcg gcgctgcgcg
    84661 acgcgagcgg cacgggggcg ctggcggacc cggcgctgtg gcgcggcgcg cacggcgcgg
    84721 tcatggcggc cctgcgccgc gccctcccgg cgctggcctt ctacgagccg ctgcgcttcg
    84781 agacggaccc ggccacgaac ctggtcacgg ccgcgacgcc ggcgggcggc ggcggcgaag
    84841 aggagacgac cggggagggc ggcgaggagg acgaggacga ggccggcccg cgcgcgggca
    84901 tcatccacgt ggacgccgac gtcgtcgtgg accgcgacgc cgcgcgcgcg cacgccaccg
    84961 aggcgtggct gccgcacgcc cagctgcgcg ccatggccgg ctgcgccgcg ctctccgtcg
    85021 agatcacgac gcggcggacc agcttcgcgc gcgcctacgc ggaggccggc gcgccgccgc
    85081 tgaaacgccg gggcgagatg agcgacccct ttgacgtgcg cgagacggtg ctgcggcccg
    85141 cgggccggcg cgtggcggcg cgcgtgctcg tcccgcgcgg cttcgactgc ctggtggccc
    85201 acggcgtgag caacgcggcg ctggtggcgc tctaccgccg gtggcacgcg gccgcgtacg
    85261 gcgcgggcga cgcgaccccg cccgtcttcg ccttcctggg gcccgagctc gcccgcgagg
    85321 gcgcggacga ggactactac tgcgcgctgg gcttccccct gtttgcgacg atcaaggtgg
    85381 ccgcggccgc gccggaggcg gtccgcggcg cgctcgccgc ccaccggctc acggacgggc
    85441 tgtggcccgc gctcggcttc cgcgccttcc acgccctcgg gcccgtgagc tgcggcctgc
    85501 gcctgcgctg cgacgtctgg ccggcggggc gcgcgaccag cgccgtggag cacccgtgcg
    85561 ccctccgcgg ggcctggctg gccaagtttg acttcgcggc cttcttcccc aacctgtttc
    85621 tggccctgtg cccgggccac gagcggctgc ggcgcgccgt gcgggcgcgc gcggtcaagc
    85681 cggcgctcgt ggccttcttc ggcgggctca agcacacgtg cccggaggcg taccacagcg
    85741 tcatcgcgct ggccaacggg gtctcgcgcg ccgtcgaggc ggccgcggcc gaggccggcc
    85801 tggtcacgtg cgcctacgtc aaggacggct tctggggcgt gctcggcgac gtgcccgcgg
    85861 ccgcgccgga ggcggccgcc gccgccgcgg ccgagcgcgt gcgcgtcgcc tgcgaggccg
    85921 ccgcggcgcg gcacctggcc gacgcggggg ccgccgcgac ggacgtgacg ctgcgctgcg
    85981 agggcgtctt cgacgcggcc ctggcctggt cctgccacgc ctactggctg cggcggcgcg
    86041 agggccccgc ggactttgtc ggcttcccgt cgcgcagcgg cttcggccgc gccgccaagg
    86101 ccgcgctgga cgccctgctg cgcgaggccg tcgagggccg cgcggacgcc gaggccgcgc
    86161 gcgccgcctg cgacggcctc gtcgagcggg ccttcgcctc gcgccacgac cccgacttct
    86221 gggccgcgcc gggggacgcc ctcgcccccg ccgcgtgcgc aggggcgacc gccgggcgcg
    86281 gcggcgcgcg ctgctcgcgg cgctgcgtgc gcctgcgcgg cgccggcccg gtgccctacg
    86341 agcagctgcg ccccccgctg atcctgccct ggatagactg tctggcccac atggagccca
    86401 tcttcgccgc cctcgtcggc atgtacaacc gcgcgctcga ggcgctgagc gccggcgacg
    86461 ccccgccgcc atttgtgttt acatacacgc cggacgcgtt tctgtttggg taaacaataa
    86521 agtctgttta ttgtcagaac gagccacggg gtcccgcgtc ttgctctcgt ccgcggtcgg
    86581 gggggagcga gagaggggga gaggggggga ggggtgaggg aagagaggga tggggaaggg
    86641 gaagagggag aggagggtgg ggggaggagg ggcgcgcttc actcgtagcg cacaaacatg
    86701 gtcttctcgg tgagcgcgcg cggcgccgtc gtccaccagc ggtacacggc ctcggccatc
    86761 tcgggcgtgc gcaggggcgc ggtgagcgcg ccgccggggc gcgtccgcac cagcccgtcg
    86821 ggcggcggcg cgtcgcccgg caggccgagc aggggcccga acccggcggc gaagagggcg
    86881 tccacgacgg gcggggcccg gggggccgac agcaggcgct gggcgatggg gtagtggggc
    86941 agcacgcgcg tctcgtcgag cgggctgagg tgggccgcga acatgagcgt gttgagcgcg
    87001 cgcgtggcgc cgacgtgcag caggcgccgt agcttccgcg ccggcggggc gcgcgcgcgc
    87061 tccagccacc ggcccaggct caggcaccgc gcggcgtccg cctccgccgc ggggcaggtc
    87121 tccaggaaca tctgcagcac gcagagcgcg aactccgtcg ggtcctcggg gcgcaccagg
    87181 gccaggcggt gcggcagcgc caccggcggc acggccagcg agagcacgcg gtcctcggcg
    87241 gccgtgacca ccgcgaaggc gaacccgcgg aaggcctccc cggcgaggca gcggcggcgg
    87301 tactcgtcgc aggacaccgt ctcgccgctc tcgaggcgca gcgtcagcgc gccgccctcg
    87361 acgcgcgcgt cagtcaccga ggcgctcgtg aagaccggga tcagcccggg cacctcgcgc
    87421 acctcgcaca ccagccgcgg gagggcgtgc caggtcagct cgtccatcac ggcctccatc
    87481 gcggagccgc tcggtcgccc ggcgcacgtc cgccgcgaac agcgccgcga tctcggtcag
    87541 gtaggcctcg aggcgcgtct tcttaaacac cacgccgcac aggtcctcct ccgagcggta
    87601 cacctcctgg ctggtgatga ggaagccgag gtggcgcacg cgcaggatgg agaagaagta
    87661 cggcgcgagg atgagcgaga tggagctgtt ggagtacgag acggacacct cctggccctg
    87721 gttgttggcc acgcgcgtca gcttgaagca gcggatcagc tcctgctccc agagccgcga
    87781 gaggcgctcc acgtccgact cgtacggcgg cacgtagcgc gactggaagc tgttggccac
    87841 gtaggcgtcg tcgcccatgg cgcgcgtgat gtcgatgacc tcgtggccga ggtcccgcgg
    87901 cggctggccg tccgcggcgc cgggcgcgcg ccccccggcg gggccggcgg cgccggtccc
    87961 gtccgcgccc gcctgcgcgg cgcgcagggc ctgctcgcgc aggcgccgca cctcctgctc
    88021 gcgctcgcgc acctgctcgc ggaggccccc gttgtccgcc ttcaggctct cgatggtctt
    88081 gaagaggttg ttgacgtagc cctcgagcat gccgttgatg ctgttgacca cggaggtgcg
    88141 gaaggcgtcc tgcaccggct gcgcgccggc gccgtggtgc ccgaagcccg gctgcgacgt
    88201 gtccacgctg tccaggatgc gcgccccggt ctcgtcgagg tacgagcgca ccgtctccgt
    88261 gatgtcgccg atgtggcgca tgcccttcat gttcacgatg aggcgcacga ggcgcgccgc
    88321 ggccgagccc gccgggtcct cgccgagcat cttctccacg gcgccggccg ggtgcccctc
    88381 ggcgggcttg cgcccgacga gcaccttcac cggcgccgtg ttgagcagct ggcagaggcg
    88441 cgcgtgctcg cgcagcgcgt ggcacgccag cacctcgccg tgcacgcgct gcgccggcga
    88501 gtcaaagagc agctcgccgt cgcgccacag cggctgccag agcaccaggc actccccgcg
    88561 ctcgcccgtg agcgcgtcgc gcgccagcac gcgccggtgc cggggctcgt agtacagctg
    88621 cacgcggtcg tagtccatga tggtgacgcc gcgcatggcc tcggcgagct cggccacctc
    88681 gtccaggccc tggcccagca cgctgccggc gacgcgcagg tgcccggcca ggtcgtgctc
    88741 gtccacgcag cgctcgcgcc gccgcttccc cccggggcgc gcccggcgca ccgggaccac
    88801 gccgaggcac acgatccagt cgatgtactt ggcgaagctg gccgtgccgt tggactcgct
    88861 ggccgagaag caggccgcga tgccgcgcac aaagtccagg agggccatct gcagcgtgcg
    88921 gtaccaggtg tcgaagaggc gctcggccac ggcgggcgcc tcgtcgccga agcgccgcgc
    88981 cagcgcctcg gcgccgaggc cgcgcgcgcg caggtgcgcc atccagtccc gggccacgtc
    89041 ctcgtagcgc gccgcgttga gcgtgcgcgt gagcagcgtg gactggatct gccgcacggc
    89101 ggcctcggtg gagcgcaccg agttgtagat gccctggccc tcggtgtagc ccaggttgcc
    89161 catgaggatc tccttgaaga ccatggtgcg cggcgtgggg tggatgagga tccgcgaggg
    89221 ggcgcccaac aggttattag cctcctccgc ggcgccgccg gggcagagcc cgtccgcagc
    89281 cgccgccgtc gcagccgaca tggccgccgc cgccgccgca gagggtccgc gcgccaccaa
    89341 cgccacctat ctgaacttta cgtccatgca cggcgtcgag ccgatcgtgg agcgcgtccg
    89401 ggagctcgcc gcgacgcccg cggaggcgcc gccgccgctg gcgtggttca agtccctcgc
    89461 cgcggcggac aacccggtgg atatagaggc gctggagctg cccttcgccg cgtacctgat
    89521 cagcggcaat gccggctccg gcaagagcac gtgcatccag accctcaacg agaccatgga
    89581 ctgcgtcatc acgggctcga cgcgcgtcgc cgcccagaac gtctacgcca agctctcggc
    89641 ggcgtactcg agccgctacg tgaacaccat cttccaggag ttcggcttcc gcgggaacca
    89701 cgtgcaggcg cagctcgggc gctacagcta cgcgtgcccc acgagcccgc cgacggtgcg
    89761 cgagctgcag aagcgcgacc tggtgtacta ctgggaggtg ctgcaggaca tctcgcggcg
    89821 cgtgctcgcg gggagccacg aggagtttgc gcgcctgcgc gccctggagc ggctcacggg
    89881 gcgcgcggcg gagcacctgg ccttcgcgtg ccacggctcg ctgccggcgt tcgcgcgcag
    89941 caacgtcatc gtgatcgacg aggccgggct gctcgggcgg cacctgctca cggccgtcgt
    90001 ctactgctgg tggctgatca acgccgcgta cgacacgacg cagtacgcgg cgcgcgcgcg
    90061 ccccgtgctc gtctgtgtgg gctcgcccac gcagacggac tcgctcgagt cgcgcttcga
    90121 gcacgcgcgg cagctgtgcc gcgtgcgcgc cagcgagaac ctgctcacgt acctgatcac
    90181 caaccgcgcg ctgcgcgagt acacggacct ctcgcgcaac tgggccatct tcatcaacaa
    90241 caagcgctgc caggagtacg agttcggcga gctcatgaag gcgctcgagt acggcctccc
    90301 gctgacggac gagcacctgc gcctcgtcga cagcttcgtg gtgcccgagg cctacatcaa
    90361 caacccggcg aacctgcagg gctggacgcg cctgtactcg tcgcaccgcg aggtcagcgc
    90421 gtacatgagc cgcctgcacg cgcacctcaa ggtggcgggc gacgcgcagt ttgtggtctt
    90481 cacgctcccg gcctacacca tcgtgcgcac ggcggccttc gaccggtacc gcgaggccac
    90541 gcagcagccg cacctgacgc tggaccgctg gctcgcggcc aacgccggcc gcatcaccaa
    90601 ctactcgcag agccgcgacc aggacgccgc ggcgctgcgc tgcgaggcgc gcgcgcagca
    90661 gggcgtcgtg ctcgcccgct gcgaggtcac gtacgtgctc aacagccagg tggccgtcac
    90721 cacgcgcctc aagaagctgg tcatcggctt cagcggcacc ttcgaggcct tcgcggccgt
    90781 cctgcgcgac gacgccttcg tccacgcgca gggcggcagc gccgagtaca cgtaccgctt
    90841 cctgtcgagc ctgctgttta gcggcatgat cgccttctac aacttcctgc agcgccccgg
    90901 gctggcgccc gaggccgtca cggcggccta ccggcgcctg gccgccgtca cggcggcggc
    90961 gctgcgcgtg cccgaggagc actttgactt ctcgggcgcg gcggcgcccg ccgcccccgc
    91021 gggccccggg ggcgcgccgg cggacgacga cgacgacctc tttgcggcgc tcagcgagaa
    91081 catgctggac atgctctact gccactacga ctttgcgcgc cccgagacca cgagcgaggt
    91141 gtacgcgcag ttcctgatgc tcaagacgct cttcgccgac cgctacgcgg cgctctccga
    91201 gctcttcggg gccgcgttcg cgcgcgcgcc cttcgagacg cacgtggaca gcgtctcggt
    91261 gcgcgggtgc gaggtgttta tgggggggct gcgcggcgcg ctgctctcga cggcgctgca
    91321 gacggacagc tacacgctcg tgggctacac gcacgcgacg gcgccggcct tcgccgagga
    91381 gctggcgcgg cgcaagctgc acgccggcac cgcggagctg ctcgcctcgc tggacacgcc
    91441 gcgcgtggtg ctgcgcgacc agagcggctt cctgtccatc ctcaacgtca acctcagcga
    91501 ctttgtcgag tcgctggacg acctggagct ggacatggcc acctacgtcg actacggcat
    91561 cagctccaag ctggccatga ccatcgcgcg gtcgcagggc ctgagcctgg agcgggtggc
    91621 cgtgtgcttc acgcgcgcca acctgcgcat gaacagcgtc tacgtggcca tgtcccgcgt
    91681 gatctcgtcg cgcttcctgc gcatgaacat gaacccgctg cgcgaggagc ccgagcggga
    91741 caacggcatc agcgagcata tattggccgc gctgcgcgac ggcgcggtgc acatcgtgta
    91801 ctgacccgcc gtccacccgc ccgagggggg ccgagggacc aagggaccga gcgagaccga
    91861 ccatgacggc gctggtggcc tactcgtttt acgaaataaa gctgcccggc ggctgggcgc
    91921 agtcgggctg tgggcagacc gtgtgcgagt acgagcgcgg cgtccgcgtc atggccacgg
    91981 acgggtgcac gcgctgcgac gcgctcgccc cgggccgcgt cacgatccag cacgggccgg
    92041 tgctcacggt cctggccgtg gacggggagc cggagcggtg ctcgtacgtg ttcgcgcgga
    92101 cctggccggc ggcccccgag ggcgcgctcg tgatgccctt ctcgacctgg agctgcgccg
    92161 agcgctcgcg ccgcctgcgc gggcccgcgg gcggcctgct ggccaccctc gtcgtggagc
    92221 gggccctgca cgtcaccatc accgcgtacc ggcccgacgt gctccgggac gccctgcgcg
    92281 aggcccgcat cctggagtga gaggcggaga ggggcgggcg agcggaggag gccgccgcca
    92341 tcaccatcgc caccaccgtc accatcccca tcccaccccc atcccacccc gacaataaac
    92401 gacgacggcc gcgcgtgcgc ggaaagagag accgaaccgg ttgtgtcttt tgtctggtcc
    92461 gtgggcatcc gccctttatt gatcgcggta gcaacaggag gcggggggcg cgcgccggcc
    92521 ccgggacggg gtccgggggc gcgggagggc ggccgccgag gggacggcgg cgcgggccga
    92581 ggcgtggacg ctgcgctggc ggggtctcgg cagctggggc gtcggggcgg ccgtcgtcga
    92641 ggcgttgatg ctccgttgcc ggggccgggg cagctggacc gccggggcgg ccgtcgccga
    92701 ggcgtggacg ctgccgcggc ggcgcggggg tgcggccgcg cacgactcgg gtccgcccgc
    92761 ggccgtcgcc gaggcgtgca cgctgccgcg gcggcgcggg gcccgctgct gttgttgctg
    92821 ctgctgctgc tgctgcggat gctgagagcg gtggtggtgc tgctgctggt ggtggtggtg
    92881 ggtaggctgg acgacggtgg cgtagacggg gtccggctcg gtcgcgccgc gctggcgcga
    92941 gcgcccgcgg gcggtgccca ggccgccggc gcgcaggggc gcctcctcgt cgggggggcc
    93001 gcgcgaggac cgcggggccc gcgtctcgcc cccgccggcg gagacgcggc gggaggccgc
    93061 ggccaggcgc cgggcggccg tctcgttggc ctgcaggaac cggtggtagt catcgaccgt
    93121 ggccacggac gcgcgtccga aggtgctcat ggcgccgcaa acacgttgtc ccggtgcagc
    93181 cgcaccggct cgggggtgat gaactcgtgg atgaacaccg gcgcggccgg ccgcgctcgt
    93241 ccgctcgtcg ggcgcgcgcg gggctcgcgt gggcgtcggg cgcgcaccgc ggaccggagc
    93301 tgatcgcgta cgcgcgccgc gtgggctctg cggcacagga taaacatctg caggctttta
    93361 tggccgcgcc cgggggcgcc gcgcgggccg cgcgcgcggc gcgcaaacgc ggacgtcttg
    93421 gtgcaggcga cggggaggcc ggccagggcc gcggccaggt cccggcggat cgtgtccgtc
    93481 agccgccggc gcccgagctc gtccacggac gcgaccataa acagcgtgtc aaactccacg
    93541 tgctgcgccc agcgcgggcc cgccgccgcc gtcgtcgtcc cttcgtcccc cccgtcttcc
    93601 tcgtcttccg tctcctcctt ctccgtcgcc ttcccctcct cgccgtcttc cacgtccccc
    93661 tctccgtctt cgctcccgag caccccctcc cggggagggg gtgcgctctc cgggggcgcg
    93721 tccgcgtcct ccgggcgcgg cccggagggc tcgacctcct ccacggccca cccccactcg
    93781 cgcagcaccg ccaggaccgg cagcgcgctg gccggggcgc cggcgagcgc gggctccatc
    93841 atccgctctc ctccgtccat cccacccccc tcccccctcc tcgtcctccg ccggcggtgt
    93901 gcgcgcacgc ccgactcagt ccacgctcca gtcgacgggg gcccggcccg tctggacgag
    93961 gtacgcgttc gcctctccaa agtgcgggca ggtcctgaag ggcgtgcggg ccagcggcga
    94021 cggatggctg aaggtgagca ccttgtggcg gcgcgggtcc ggcgcgcagg ccttttgagc
    94081 gtgggcgccc cagagcatga acaccagctt ggggcgggtc tcgcagagcc gctggacgac
    94141 ggcgcgcacg agccgcgccc agccgagcgg ggcgtgggag ccggggaccc cgcgccgcac
    94201 ggtcagcgtc gtgttcagca gcagcacccc gcggcgcgcc caggcctcca ggcagccgtg
    94261 ggcgggcgcg ggcagcgtcg ggtacgtcgc ccggaccgcc gcgaagatgt tggccaggct
    94321 cggggggatc ggcaccccgc gccggacgct gaaggccagc ccgtgggcct ggcccggccc
    94381 gtggtacggg tcctggccga tgatgaccac cttgacgtcc tcgggcgccg tgaggcgcgt
    94441 ccaggcgaac acgtcctcgc gcgcgggcag cacctcctcg gtcaggcagc ggccgcggta
    94501 ctcggccagc agcaggcgcg cgtacggctt ggcgatctcg ggctccagca gcgcgcgcca
    94561 cgagggggcc acgtcgaact cggcggcgaa ggcgtcccac gtgggcgccc cggggtcggg
    94621 gggcggggcg gaggcgtcgg cccccgtggc tgttgttgcc gccgacgccg cgggcgtgcc
    94681 cttcgcgggc cgggcggcgg cggagggtcg ggccggcttc gaggccccgg cccctgcccc
    94741 ggcgggggct gctgctgcag cggcggtggc ggcgttagag gcagaagcgg cggcggcggc
    94801 aggcacgacg aggcgcaccc cgggcggcag gccgcagggt ctcttactcg gcggggggcc
    94861 ctccattata gcgcagcggc ggcagggagt ccttgtgcac ggccacctct ccgagctcct
    94921 tcagggccgc ctcatttaag ggctctccga tggccagggc ctggatggcg acaaaggggt
    94981 tgaccaggta ggcggtgccc gacgcccaca ggatgacctc cggtggcgag cagtagggct
    95041 tcacgaccac gctcgtgacg gcggtcatgt ccggcggcag cgagtacgcg atgtaggggt
    95101 ggcagcgcga tcccacgggc ggctcgaggc ccagcagcgg gtggtcttca tcgtcccatt
    95161 ccagctcctc gcgccgggga gcgcgggtgg ggggcgcggg cgtgaccggc ggctcgaaga
    95221 tggcatcgag cccatggggg tttcccgcga cgccggtgcc aggaaccccc agcgccgccg
    95281 aaaaaaacac cagcaccgcc acgagcggcg acatcgcggc tggtgtatcc tttttcggcg
    95341 cgggggtccc ggcttttatc tccggaaaga ggaaattgag acataaacta gacgtccgca
    95401 taatccctct tgatttacgg ggggaaaata cgtgccacgt gccggggggc ggggcaactg
    95461 gagcgtggcg aagcggaacg gggcgcgatg gggcgcatcg aggcgcggac gcgtcccggg
    95521 gggagtctgg ggggagtctg gggggagtct ggggggagtc tggggggagt ctggggggag
    95581 tctgggggga gtctgggggg agtctggggg gagtctgggg ggattccagc tcggcgcgat
    95641 cgccgcatcg cgcaaagtcc ggctgcagta aatttactgc ggatgcagtt cccgggacgc
    95701 cgcaccggcc aaatggcgct gcagtataga tactgcggct gcagtttact acagttgcag
    95761 taccgcgcgc cgccgccaaa tactacagta gatttcctgc ggccgccgcg tactgcagtt
    95821 taccgcggct gcagtaaact gcagtatcgc gcggtaaatt gtagtctggc agccgcgcgt
    95881 tactgcaatt agcggtggct cccgacactc tggccaattg gtgctaatgg gccgtgatgg
    95941 tccatgtggg ggtgatgtaa ccgccgggcc ccggttgggc actcagatgg tggccgggcg
    96001 ccaggccaaa gtgctgtctg agtgccactt tatgactttg tttttctcaa acaacatcaa
    96061 ttatggatgc acatcgtgta tataatcccc ggtccgcgct ccgcccaccc atcacagcag
    96121 ccgcggacgc tgcgcgccgg agcggtccat ctcgccagcc agccaaccag ccgagccgcc
    96181 cagccgaccc gagagccccg agagccagac tccctcagcc atagaagaca ccgggcggga
    96241 gagacggact gaaaaaatat atcttttttt attttgtctg ggcctggaga cccgcagcag
    96301 gagcggaggt gagtgcgggg ccgggagccg gagcaggacc gggaacagga acaggaacag
    96361 gaacaggaac aggagtgggg ccgggagcag gagcaggagc gggagccgaa gtgggggcag
    96421 gagcggcggc ggccgcagca gcaacagggt cgccccagtc cgcggcgagg aagagggagc
    96481 tcagtcgtcg tcctgggtga ggtcgatgaa gatggtagcg gagcgggggg atcccgacga
    96541 gctagacgcc ggaggcccgc cccggggggc ggcggtctcg ggggcagagg cagagggcga
    96601 cgggcgccgc atcgaggagg agggtgaaga cgagggggag gagcgagccg aagcggcggt
    96661 gttcgccgac cccgggccgg ccccggcccc cgaggcacca tgctgcgcag aggacccctc
    96721 gccggacgat ggcgcctccg gagtctcgcc ctgggcctgt ccgcccgtcc ggccgcgtcg
    96781 caggcaccgg gtccgtctct gctcgcgcct cagcacggcc gcccgtcggg ccctgcgcgg
    96841 ggagcgcctg ggcgccggcc tctggtcgtc cgcggactcg gaggcctccg tcagatcctc
    96901 cgtgtgcacc ccgctgctcg aggcgcccga gtcttcctcg tcgggggaag acacctcaga
    96961 gtcagagtgt gcctcggact cggacgtgtc gatatagttc acaccctggt ggctcatcgg
    97021 ggctcgcctc tgcatccgcc gcatccactg cgccgatatg tcaaacagcg tatcgacgag
    97081 ggcgtgggtg tttgccccaa acatggggag catggcctcg gtcacgcgct ggcggttcat
    97141 cccgtgctcc tggataatct cgacgatgtt gtccactacg gcctcgcgga tggggtcgct
    97201 ctcgatgacc gtcgagacct gcccataaag ccagttgaag acggggactc tggggcgggc
    97261 gcgagaccca gacccggagc cctgcccttc ggcctcctcg tggcgcacct cctcggtata
    97321 gtcttcaccc cagatgaccg cgaagccccc ccctaccggc tcatcctctt ccccgtcgac
    97381 atccgtcgcc ccctccacgg gcgtctccac aaacgaagcg tcgctgtcca cgtggtggag
    97441 gatggaggtg acgcgggcat tgcacagcgg gcaggcggtg ctcgtcaggg tccagcgctg
    97501 gatgcagtcc agacagaact tgtgcatgca cggcagcgtc tgcgcctcgg tggccgcgac
    97561 gtccaggcag atggggcagt ccatgacggt gagtggcagt gacaggcgct gcggcggtgg
    97621 cgaggggctt ctggggcggt agaagccaaa gatcccccag gcgctggaag cctcggcggt
    97681 ggtcgtccgt ctccgagaga ccgtgcagcc catggtgtcg agggccccgt tttttaaccg
    97741 ggtgcccggc ccctttgttt gtcttcgccc ggggcgtcca cgcccccttc cgcccgcccc
    97801 gtcggggctc cccccgcccc ctcgggccgt cccgggacga tggcccgggc gcgccgtcgt
    97861 gggaagcggg ccctcccgcg gtgggtcgac ggctcctggg gctgaaagcg gcgctgcgga
    97921 tcccccgctc tcacccctgg gtccgtcgcc gccccgcggt gcgtgcgacg cccgcgaacc
    97981 cccggcccac aacacaccgg caccaccacc accaccatca tcgtcccccc tctccacata
    98041 cacgctcaca ctcgggccac acgctcccgt cctccaccgc caccctccca gcctcccggc
    98101 ctcgcgggtc ctcgggacga ccgccgctca ccccgacggg ggactgggac agggagcaag
    98161 gggggaggag gacggggggg gaggggaacg cgagcgcggc gcaccccgtc gccgtccgtg
    98221 gtggcgggca cgccaccccg tccgtccatc cagccgtcca tccaaccccc ttctcctttt
    98281 tccgcctccc gtcccacggc acgaccccat cgacgccaca ccgcgcggtg cgcgctctcc
    98341 agccgtccca tccccccaca ccccccacgc ttcccccatt cgcttctcat cccgtcagac
    98401 ctgcgccatg gagttcgagg acgggcgcgg ggcaacggtg gtgagaggcg agccgggggg
    98461 gtcgagtggg cctcgcactt tacgcgcaca cgcccctctc gcgcaccaca caccaccgca
    98521 caccgccgag gtcgggcgag agagggcgcc ccccctccac gaccccgctc gccccggtcc
    98581 cgacgccctc gcacccccat agcaccccct ttcacccccc gcttctcccc gctctctccg
    98641 cgcgatcgca cacacaacac ccgcgcgcat gctcggcttc ttcacacgga ggacaccatg
    98701 ggcagcagat ggtacggtca gccgccggcc gccgtgcgca tgtgtcgggc tgccgcggcc
    98761 aagagtatca gcgtggcttt tttgttggtc agggtgtgaa aaaggcacgc tgatgcgtcc
    98821 gccgctgcag cggagctcct cggcagcgag atcatcgacc accaccacca ccacatcgct
    98881 cttctcgccc gcgcttcccc accgccaccc cacaccatcc cccacccccc ccgtccaccc
    98941 tcacccccca tcgcgtcgcg agagctctca acacatgctt acatgcacat gcacacgcgc
    99001 ccctccctcc tcggcgcccc cgcggcggga ccgtcgcaac cctctccccc gccgtcccac
    99061 ccgtccgcgg ccctcctctc cttttcccct tcccctcccc ttcgcatccc cgttcccccc
    99121 tgttccgcat ttccccgctc cctccaccat cgactctcat cgacgggctt ctccgccatc
    99181 atcaccacca accaccatca ccatctcccg ccgccgcccg gacggcgacc cgcggtgctc
    99241 ccaggggcac gttcccactc acaacccggt ggtttcgatg gccgcccccg gggggttgat
    99301 ggggatgggc gctcgggggt gatcgtctgc taccaaaccg caccaccgtc cccctgtccc
    99361 tcatccactt ctcgacggcc ggctccccgc ggggcggggg ctgcgggggg gggtgggtgg
    99421 gtgggtgata gagcaggcgg gcgggtcggg gcggccgggg agggcccccg gcccctctcc
    99481 ctcctctctc ttcccccctc ccctaccccc tctccgcgcc gactcgacga gcgggggcga
    99541 ggcagggtgc gtaccgaccc gcctaccagg caggctagaa gcctcacgct gctgcttggc
    99601 agcgggtggg tacccaaccc ctcccctcag gacgcgaccg accggtgtga agagagaaag
    99661 atgcccgtct cccccgcccc caccgtcccc gatttttcgg ttcctctccc cgtcgcgccg
    99721 gcgggcccct cgtcgccagg gggtttttgg tggaaggccc gccggggtaa gggggggtgg
    99781 gtggtgtgtg tgcgacggaa cgggccgcag aggatcggga tgtatgcacg gtcgtccccg
    99841 tctcaaactt cctcgtgtcc cctgttcccc atccttccac ccatgcattc atccgtgcgg
    99901 tggtggggat gagtggatgg atggaggcga gggacgcggt ggaccatgcc aggcaagacc
    99961 tgcatcactc gaagaaaggg tgcctggatt ggccttcgca tctttgccgg ccacgagcga
   100021 cggccaccac cgcccccgac ggtctctctc cccccccccc tcccgcttct cctctttcct
   100081 ctccggcgcg tacccccccg ttttcccgac gaggttcgag gacccccccc ccaaagcaga
   100141 gcgagagcac cccacacccg cacgcactcc ccggtgtcgc cccttttccc ccccggcagc
   100201 gccggaaccg ggtgcaggcg gtgggggcga agattgggtt gggtgagaga ctagaaccgg
   100261 tgttctcaac ccttctggag ccctaccctc tgtgcctgga ctttccagcg cgcgacacgg
   100321 gggggagcgg acacgcggcg gtggcgatgg tggcgacggc ggtggctggg cgcgatcgag
   100381 gagatgtgga ggggtgccaa gcgcccgccg ccctcccccg catctcttct ctctcgcaca
   100441 cgcacacgac ccgcggatgg cgaggatgtg gggggagagg tctcccggcg ttagtgggtg
   100501 ctatttgatt ctcctctaac cccctctccc tcgcggcccc ctcgaccatc gtcgtgcagc
   100561 ggcgacggcg gctcccaccc cgtctctctc ccccacacga cctcgacgcg tcccgccacc
   100621 ccgcccagtc acgtcccacc ccccggggag aggggagagg gatgcacggg ggtgggggtc
   100681 cccgccccct ctctctgatt ccaagacggt gattgtctcc gtctccggct cgcacgcaca
   100741 catccccgcg gcggggatgc ccggccagac aaaccgaggg gggaggagag ggggaggagg
   100801 aggaagtaat aggcctctcg gggacgggcg gcgcgtggcg ccggagaggg gggtggcggg
   100861 gaagagggaa acctagaagg cggcccatcc cccgagatga cgagagagga gagaggcgct
   100921 aaacggcgcc cggggagttg ggggaggagg agacggcgcg cgaggagctg ggggaggagg
   100981 aggagacggc gcgcgaggag gaagacgacc ggtccaaccc ttgggacgag aggtctcgaa
   101041 tcttgacacc atttcccctc ccctccgctc cactcccgtc gcagcttcgc gcggggagga
   101101 aaataatccg atccgacccc cggggcgaga ggctcgcgat cccacccccc gctccccggg
   101161 ggccgcgaaa aaagggggcg gggcttaaag ggggggggct aatttgcata aatttgcata
   101221 catttgcata gccccgcccc ctcatttgca taaattagca tggcccctcc ccctcatttg
   101281 catgcatttg cataacccct ccccctgatc tgcataaccc caccccctca tttgcataca
   101341 tttgcatagc cccgcccctt catttgcata aattagcata acccctcccc ctaatctgca
   101401 taacccctcc ccctaatctg cataacccct ccccctaatc tgcataaccc ctccccctaa
   101461 tctgcataac ccctccccct aatctgcata acccctcccc cctcatttaa atatgaccgc
   101521 ttccccggac gtgacgccgg gctcctcccc ccccccccca tttgcatatg acgcttcccg
   101581 gacgtgacgt ttttgccgat gacgacttcc gcctcatttg cgtatgacgc ttcccgcgcg
   101641 caacttccgc cggacgtgac gccggtcccc acggatctca tctgcatatc gcgccggccc
   101701 cttccgcttc ccccggacgt gacgccggtc cccacggatc tcatctgcat atcgcgccgg
   101761 ccccttccgc ttcccccgga cgtgacgccg gcttccgggg cgcggccggg gcgggctccg
   101821 cggatcgcat cggcgcgccg agcctgcccc ttccgtcgca ccgggggtcc gcgggcgggg
   101881 gcttccgctc cgcggcgccc gccccattgg ctcccctcgc gccacgcggt cgccgtcgtc
   101941 atcgtcccgc cggccaatcg gtggcagcgg gggaggctgg gagtggggac ggaagacgga
   102001 agccagatga acctgttccg cccgctctcc caccgccttt ccctcccctc cacgacgacc
   102061 acccgggacc accaccacca acaacaccac caccaccccc cccccccccc ctcacgcaca
   102121 cactttacta ctatcaccac cagtgggcga tggttgcaac ggcagttccc tgtactgacc
   102181 accaccgtgt ttttttctct ctttctctct ttcccccccc acccccctcg accaccgcag
   102241 gaccaccatc gtccaactcc cgcccgggac caccgggacc ctcgggacca tctacctccc
   102301 accaggaccc gccgggacca ccaacaccgt ccacctccca ccaccaccac caccaccatc
   102361 aaggaccccc aacatcccca agaccctcta cttcttccca ccaagaccct ccaggaggag
   102421 gacccccatc tgctaagacc caccagggac cccccatctg ctaagaccca ccaccaccaa
   102481 gaccctccag gaggaggacc cccatccact tcttcccatc accaccacca agaccctcca
   102541 ggaggaggac ccccgtcacc cccaccaaga ccctccacct cttcttcttc ctcccaccag
   102601 ggacccccat ccacaagacc acctccaccc cagagaccac cgccaagatg gccgcctcca
   102661 tctccccaaa aaatctcaga gactcgagct ggttcagaaa atacagcaca aactttattt
   102721 tctcactctg aaaacaaact cttttctcac ccgatgggag aaggaggaga aggggaccgg
   102781 gggaccgcgg gaggaggaga aggggaccgg gacgatcctc cgccgccgag ccctccgccg
   102841 cggccgccgc cgccgcttcc accaccgccg ccacctccgc cgccgccgca gccacctccg
   102901 gccgggggat ccgcgcggag gagaaggaga ggaggagggc caccgggccg gggaggcagg
   102961 cgccggggag gcaagcgccg ccgggccgag gggaccgagg ccgccgccgc ggacgcagag
   103021 gaggaggagg acggggacgg ggacgaggac gaggacgagg accgggccga gggcgagggg
   103081 agagaagacg gaggagaagg gcctcgagga gccggtggag gggccggaga gtcagagtca
   103141 gagtccggcc gggccgaggg ggcgccccgc tcagcggagc agcaggtagg ggttgccggc
   103201 gtcctcggcc tcctcgtcgt ccgagatggc ctccaccttg atgggcccga gcgggccgcg
   103261 gggccggccg tcgccgccgc ggacgccgac gatctccaca gagtccccgt cctcgccggg
   103321 gccggccccg gcgcccgagg cccccgcggg ccggtgggtc tccacggcgc ccccggcggc
   103381 ggcgcggacg ctggtctcga agggggcaaa gtcccagagc acggccggcg gggcgcccgc
   103441 ggcggcgacg gcgcccgggg tcagcaccag cggggcggcc tcggcgtcgg gctccagcag
   103501 cgccgcggcg cagaaggcgc gcaactcggc cggcaggccc tcggggccgc ggagctcggc
   103561 gaggccccgg cggccgcagg agacgaagac gggccgcagc ggggcgccga gcccccagcg
   103621 gttggccgcg cggtgcccga aggcggcgcc cgcgtcaaag tccgggtccc cgagcccgag
   103681 cgcggagcgc tggcgggcca tgtccttgca gccgtccacg gtggggagca cgcgctggcg
   103741 gtaggcgcgc ggcggcagcg ggaccggggt ccggggcccg gcgcgggtgc tcaccgtgta
   103801 gcgcacgttg tcctggcggc agaggcgcag cggctcggcc ccggggtgca ggcgggcgaa
   103861 ggaggcctcc acgcgggcga agcaggccgg gcccacgatg gagctagagt ccagcacggc
   103921 cgcgcggagc tcgcggcacc cgggccagcg cacggcgcac tgggcggccg ggtccaggcg
   103981 gacgcggacg tagacgtggt agtcccccac ggccgggccg tccgcgggcc agtcctcgat
   104041 ggtgtccagc acgatgagcc ggcgccgcgc cgcgccgagc cgcgagcaga ggtactccac
   104101 ggcgccggcg aagccgaggt cccgcgccga gagcagcagc accccctggg cgttgaggcg
   104161 gccgatgtcg gggcgcccgg tccagttccc ggcccaggcg tgcgagtccg gcgtgcagag
   104221 gcggtgggcg aaggcggcga gcagcgccga gaggccgccg cggcgcgggt cccaggccgg
   104281 gcgcggggcg ccctcggcgg gctcggcgca gagctcctcg tggggcagcg ggtcgtagag
   104341 caccaccacg cgcacgtcct cggggtcggc tatctgccgc atccaggcgg cgcggcggcg
   104401 gagcggggcg ccgcggcgcg cggcgatgtg cgccagggcg gccgggtcga aggtgagcgc
   104461 cgggcgccag agttcgggga agacctcctg gtccacgagg gcgcgggcca cctcgggcgg
   104521 gcagtaggcg gcgagggccg cctcggaggg ccgcggcgtg tgggtctcgc cggccgggac
   104581 gcggcggaag ccgccgtcgg gcgcggggtg ctcgggcatg ggcccgagcg ggcgccggag
   104641 ccggtcgtcc tcggaggagg aggaggagga ggacagcagc gcgggagcgg ggtccggagc
   104701 gggcccgagt ccgagggagc ggcgcttgcg ccggggcccc cggtcctctt cgtcgtcgcg
   104761 gtggccgtgg ccgtccccgc ggagggccgc gccggagagc ccctcgtcct cctcgccgtc
   104821 cccggggcgg cgggccccgg gcgcgcggcg cttcttcttg cgccgctcgg gcgctgggtc
   104881 cgggccggcg gcgggggagc tggcgtagcc ggaggagccg gagaggccgg acttggtgct
   104941 ggagctggac ttggtgctgg agctggactt ggtgctggcg gggctggagg gcccggagcc
   105001 ggggaggccg gagggggcgc ccgccgccgc cggcgccggc gctgggacga cgaggccggg
   105061 ctgctcgggc cagagcgggg gcaggccggg cgcgggctcc gcgggcccgg gccgcgcggc
   105121 ggcctcggcg agccgggccg cggccacgtt ggccggggcg aagagggccg cggcgtaggt
   105181 ccaggcggcc tcgcgggcgc gggccccgtc cacgctgtag cgcaccagcg gcgccacggt
   105241 gcgggcgacg agggcgacag agtccgcggc ctgccgccgc tcggccgggc cggccccggg
   105301 gatcgcgtcg cggagcgcga gcagcgcggc cgtcacctcc tcgaggcagg cgggcccgag
   105361 ggcggccggg gcgcgggcgg gcgcgggcag ccggagcggg cagggcagca ggcgctcgag
   105421 gacgccgcgg caggccagga cgcaggcgtc cgccagctcg cggggcacgc ggccgggctg
   105481 cgcggcggcg aaggcggcgc ggacgcgggc gcagagggcc tcgacggtcg cctccccggc
   105541 gcgggggtcc gcggcgcggc ccgggtaggc catgtcggcg taggcccggc ggaggctctg
   105601 caggatgaag gtcttctggg tgcgatcgta gcggcggctc atggccacgg cgctcaccgc
   105661 gtgcggcagg gcccagagcg ggtcctgggc ggccatggcg tccccgatgt gcggcagcgg
   105721 cggggtcacg ctgccggtga tgaaggagcc gtggccgtgg ggcgcgtgga cccggcgctg
   105781 gcagaactgg ttgaagcgct ggtcgggggc ctgcatccgc gggttctgca gccaggacat
   105841 ggcctcgccg gcggccccgc tgtagatgag gcgcacgagg gcctcgtgct gcttcctcga
   105901 gtcccccatc tccgggatga agacgggcac gggcccggcc gcggcgcggt agcgggccgc
   105961 ggcctggcgg acgtcgtcct cgtcccagag cccctcgcgg gagtccccgg cgccgccgta
   106021 gcggacgcgg ccgtcggccg gagggtcgga gccgggccag ggctccccga gcggggtgag
   106081 cagcggcccg tcggtcggcg ggggcccgtc ggccatgagc gagaggtggt tgttggtgga
   106141 gcggcgcttc ctgcgcgggg gccgggcggg ctccggggcc ggggccgggg aggccgcggc
   106201 ggaggaggag gcggaggagg ccgagggccg cggggccgcg gcgggcgccg gcggagacgg
   106261 tggcggcccg gcgcgggcga gtggggcgcc gggccggact ccttcgtctt cttctccctc
   106321 ggaggaggac gaggacgagg aggacgagga ggacgaggag gacgaggacg aggaggaggc
   106381 cgagcgccgc gcggcggcgg cgggggcccg gggggcggag ggcgagcggg ccggggagag
   106441 gtccgagtcg ctgccgctgc tgctggagct gctgaagccg cggccgcggc ggagggcgcc
   106501 ctctccggcg cggcgccggc ggggctgtct ctgcgggggc gccccgccgt ccccggcgag
   106561 gccgagtccg tcctcgtcct tctcggggcc gcgggcgacg gtctcgacgg cgacggtggt
   106621 ggtggagttg gagttggagt tggggttgga ggagacgggg ctccgggcgc caagcggccg
   106681 aggatcgagc cgcctcgcgg cggcgggctc gtcgagcagg ggctcgcggt gctggtgatg
   106741 gtgacgaccg cggtcccctc cggcggaggg ggcgccgccg ccgccgggcg ccgagaccgg
   106801 cccggcggcg ggggaggctg gggaagcggg cccccgccgt gccggcgctg cggccaccgc
   106861 tgctggctgt gctggtggcg ccggggtccg aggccgcgcc gccggcccgg gctcaccgac
   106921 cgggtccccc ctcgcggggg accatctccg cggggctgcc gaggggccgg gagagccgga
   106981 ggaggaggcc ggggaggctg cggaggggga cgagcgcccg gggccgccgg gggccccggc
   107041 ctctgccgct gcgagtgctg ccggggtcgg cggccggggc ccggagccgg cccgggaccg
   107101 gggcccgagg acgaggtgac cgtgctcgga gccctgatgg agagcccgac cgggggaccc
   107161 ggcggccggg gacccgggct cgtcctcctc ctcgtcttcg tcgtctagca ccacgatctc
   107221 gcccgagccc cggcggggct gctgctgctg ctgggccgaa ggaggacggg gcggcctcgt
   107281 ggctccggcc gcggccgcga ggacggcggc ctcggcctcg gcggcgtcgt cggagaagag
   107341 gccgcccggg ccgaagagga gatcctcgcc ggaggagccg cggcgccggg agccctggct
   107401 gccgccgtcg gggccggacg cgatgccctc ttcctcggcc gcggcggcgg ccgccaggag
   107461 ctggctgaag ttgccctcgg tctcgatgaa gtcaaagaga tcgtcggcca tggtctcgat
   107521 cggggtcttt ctgcctgagc gaggccgggc gccgagcgcg gagagcgggc ggcggagaag
   107581 aaggaggaag gcggccggag gaggagaaga agaagactct tctctggcgg gccgagagcc
   107641 tcggtgggtc gggcgtccgt cgagggctga tagccgccgg agagccggag tcttcagagt
   107701 ccgcgccgga gcggagacgg tcggatcccc tcgggttggc agagaacgat gctgtccgta
   107761 cctgcaccgc agtgaagtgc tacgatggag accgcgctta taagcgcccc gaggagagcc
   107821 cgcccccagg taagcggacc aatggccgat tttcgccgcg gacttccccg acggccggcc
   107881 aatgggattt ttctcgcccg cttcctctgc cgtctgcttt gcatgcccgg cccaagatgg
   107941 cggccgccgg ccaatgggat ttcgcgagga acttcctcgc gaggaccatt tgcatgcccg
   108001 gcccccgcgg cggccatctt gccccatcga cggccaatgg gatttctctc gcccacttcc
   108061 tctcgcgtct actttgcatg tccggccccg agggcgccat cttggcccct cgacggccaa
   108121 tgggatttct ctccctactt cctctcgcgt ctactttgca tgtccggccc ccgcggcggc
   108181 catctcggct cgcccgggcc aatgggcgcg cggaggcgtc tcccgcgcgc ctctgatttg
   108241 catgcccggc ccgctctgcg gccatcttgg ccgcggcgcg ccaatgagat tgtccgaaaa
   108301 tccctcgcgc gggcgcgagg cgcatgctcg gcacgcgacc cacccccgtg gtgctagcga
   108361 gccaatcaga tgattttcgg ggaagcttcc gtgtgcacgt catttgcatg ctcgccccac
   108421 gtggccgccc tcggccaatg gggcctcacg gtgcaagctt ccgtgtgtct gcacgtggtc
   108481 cgcatgtgtt gtggtggtct ctgtgttgtg tggtggtctc tgtgttgtgt ggtggtctct
   108541 gtgttgtgtg gtggtctctg tgttgtgtgg tggtctctgt gttgtgtggt ggtctctgtg
   108601 ttgtgtggtg gtctctgtgt tgtgtggtgg tctctgtgtt gtgtggtggt ctctgtgttg
   108661 tgtggtggtc tctgtgttgt gtggtggtat caccgcctcc ccctgccact cgcgagaccc
   108721 cgagaccccc gtttccccct cctcgagacc cctgagaccc ccgagaccct cccgcgaccc
   108781 ccgcggtcgc cccacccgcg cctcgcgctc ggcgcgcgct ccgagggcgc cccagccggt
   108841 cggagagacg agcggaaccg ccgtcggacc ggggaccggc gaccggaccc gaaccgggaa
   108901 gcgacgccgg ggcgggagaa ccggacccga acctcgagcc cggacccgcc cggacccgga
   108961 aggaaggagc cggacagcca cgccttggat acttttgtcg cccacccacc ccctcctctc
   109021 ccccacccct ctatctctct ctcccggtcc cccctcccac cccacgagac acgccccaga
   109081 gtgaaaaaaa aaataaaagt tgttctcgtt gcaccgtctt ccggctcgtg tcgtccttcc
   109141 gcggtacctc gggcgggcgg gagggggcgc gagaccggct cggcctcgtc gggagagagg
   109201 gagttggggg gaggggagcc aagatggcga cggggcgtgg cggggcgtgg cagaggggga
   109261 gggggggggt cggagcgcgg accccgcccg gtgggggggc gggtgcaaag gggcggggcc
   109321 caaaatggac ctcgggccgg gaccccgggg gcgctccggg agacgaagag ggccgggtcc
   109381 ccttcccggc ggggagggcc gggccggcgc gccgggacgc ccctccgggg gaaagagtgt
   109441 ccccgcgcgg gcgccgcgtc ccgccccgag cccccggggc gcgcgggcct cgatcgcgcc
   109501 cgccggacgc ggaggcgcga ggcccccgcc cccggggggg tccgggatgg ggggggtcaa
   109561 tttttgctgt gtgtgtgtgt gtgtgtaggg aaggctcgct ctctctcgtg gagggtcggg
   109621 aggacggatg gtcggtcgga cggggcgggc ggggagggtg tcgtctgtgt gtctgtgcgc
   109681 ggggagagtg tgatgtgggg ggtgtgcgag agagagcgtg cgtgtgggtg ggtgggtgtg
   109741 agggccggtg cgagtatggg ggccggtgcg ggtgtgaggg tcctgtgcgg gtgtcggtgg
   109801 tgcgggtgtt actggcgata ccggtaccga cggtggtggc cgggcgggcg gtctctccgt
   109861 ctccgtctcc gccgtcgcct cggtccgagg aggggggtgc ccgggcgtgt ctcgcctttc
   109921 ccccagttcg cctcctcctt ctcctcctct ctcgcctctc ctctctctct ccgcgtgtgt
   109981 gcgcgcgcct ctccccgtgc gtgtctcgct cgccctctcc gcctctgtcc tccgcccgac
   110041 tttccgactc tcctccgtct cctctcctcc tctcctctcc ccgcccccgc cccctgtccc
   110101 ggtcccggtc ccacgcgcgc gcgccccggg gaagggtcgg gcgatggccg ccgccaccgc
   110161 cccacccttc ccccggaccc cctcccgccc gccggggcgc cccgcgtgct ccgggggcgc
   110221 cggccggcca tccccccaca cctcccttcc tccccgcccc cgacccgcct cgcactcgcc
   110281 cgacactcgg cccgcggcac gcgcccagac cttcctctcc cccctccacc gcccgccctc
   110341 gccccctccg tctcatgcca cccgcggcag catccccccc tccccgtcgt cctcggccaa
   110401 cggccaacag ccgacaaccc acagccaaca gcctcactct cgcgctctcc ccgtcgcggg
   110461 aaaaaaacac ggcaccacag gcgggagcgg ggtcgctcgg gggaaggttt cattccaacg
   110521 acaggcgaca ggagggggcc ccccgcgcgg gtcgggcctt cttccccatc cccgccggcc
   110581 cccctctttc tctctctctc ttcttccgcg tcttcttccg cgtccgcttc ggccccccgc
   110641 ggccgcggcg tgggagagcg gggcgtgtgg ggaaggaaga ggggacgggg gggaaagaag
   110701 aagaaacggg gaagcggggg aaggaacaga cggggaaggg gggaaaggga aacggggaaa
   110761 cggggaaggg gccggcggcg aggggggaag cgggagggag aggcgcggcg ccccgcgctt
   110821 ccccttcccg cttccccctc cgcccggccg cgggtgcccg ggagacggga gcgaaaggag
   110881 gagaggggag gaaaaaaagt ctagagcggg gaggagaagt caccgtagta gtcatagtag
   110941 tagtcatagt aatatagtag gagtgggagt agtaggagta ggagtaagag agtctgtgct
   111001 taccgagaga ggagaataag aagcagaagc cggggcgctt cctccccggc ggtccgggaa
   111061 gaaagccccg gcgcctcggg cctcggagat ggggacgcgg agaaggaaac acccaaaggc
   111121 ggaggaggag gaagaaggag aggaaggaaa aaaaacctcg agagcggcgg cggcggtcgc
   111181 cgcggccagg aggaaaaacg ggggagcggg agcggctccc gagtccggga aggaaaggcg
   111241 ggcggaggaa ggcgggtgcg gaggaggaag cgctcgcgcc cctcgctctc tctccccccg
   111301 tccccctctc cgcgtctctt ccccgcgtcc cctctctgcg ttcgccggtc gcggcgcggg
   111361 cggcggctgc agaggcggct gcggacgcgg aggggggcga ggggacacag aactcttttt
   111421 gtcctcctcg ccggctccca ggcggcgggc acgtcccgcg tccccggcgt catcacgcgg
   111481 gaccccccgg tccccgtgac gcaggacgcg ggaggggagg ggagggaggg gagggggtcg
   111541 gggggaaggg aggggggggg agagcggggt gacgccgcgg gtgggccgag gccggcgggg
   111601 agggaggagg aggaggacgc ggcggcggtg aaggaggaga gccgcccggc gcgcgcccgc
   111661 cgccgcaggc gcgtccccgg cgcgggcgcc tctccacgcc ccgttccgcc cggcgcccaa
   111721 tggcgcggcc ggctcggcgg cccggccctt cctccgccct cctccctccc cgcgcgcccg
   111781 cgtgcgctcg tgccggcgcg gcatccccgc ccaggcggcg ggggagcgcg gagcgcgccg
   111841 cccccccgtg atcacgttcg cgcaccgcgg cgccagcagg aaaaaaacaa caacacagag
   111901 acacacctcc ctctccgtct ccctcgcctt ctccgttttg gggggagacc gatgccggtg
   111961 ccacatacac atacacacac gcgcgcgcac cccgtccccc cccttcccct tcccctcgcc
   112021 ccggcccccc ggcttggtgc cggagaaaag ggggtgccgg cgcggaccgg ggtcgggccc
   112081 acggcgccga gggtgggcgc gcgtgtccgt gtgagagttt acggtgtggg tgggtgtcac
   112141 ggtggagcgg gccgggggcc ccggctcgcc cgcccgctcg ctcgccgggc cggccggccg
   112201 ggggcccggc ctggacgcgg gccacactgt gcggcggacc gtgccaagtt tagggcgctg
   112261 cgacccagag agagcgccga gctaaaagct attttatcgc cgctgcggtt tcccctggcg
   112321 cggcgcctag acaccgtttc tgcagacaga gccctctcta atggcgcgtc cgggaaggct
   112381 tctcccgggc cgcgagggcc gcggcggcga cccccttcct ccctcctcct ccccgtcccc
   112441 gtccccgtcc cccgcccgct ctcccgggcc gccgcgatac cgcgcgggcg ataccgcgcg
   112501 ggccgcccgc gggcgctacc gcgcgctccg ctcgccgcct cttcccccct cctccgccgc
   112561 cgccgccagt cctcctcgct cctctccgcc cacgcaactc ctcccgcccg cgtgcccccg
   112621 gggccatcgg ctggaacacc ctgagccttc gctgagtgct gcccccgccc cgcccgcggc
   112681 actccgggcc cgcgtgagag ggtacagagc gaacccggcc ccgacacccc cccgcccgcc
   112741 gggggaggct tcccggaacc agcgcggcca tcaaccccct cccccaccca cccgcacagc
   112801 gcgcacgccg accgcccgcg tttgctacga tccctgcgcc cgacggggcc gcgggacggc
   112861 gcgtgcggcg cggaacgaga ggggggagcg ggggtgaggg ggaggggtgc gggcgagtga
   112921 gcgtgcgcga aggggggaga gggcgcgtgg gcgagagggg cggggtgggg tggggggcgg
   112981 cggcggctcg ccctccgtcc tcccctcctt cctctccccg tcgactcgcg tcgcggcgat
   113041 tcgggccgca tcgaggcgcg tcggggtttt cgcgccctcg cgccgccgcc gcctcctcat
   113101 ctttcgtggt taacacacac caccacacat acacaccctc cccccgcgcc gctgtctgtg
   113161 gcgcccgtcg tctctcccgc cggcgcaacc ccgggccctg agagctttct ccgctttcta
   113221 tttcggcccc ggcctccccg acctctctca cccgccctcc cgcgctctct ttcccacaca
   113281 caacaagagg ctcgccctcg ttccatcatc tcggcgtact cgccgcctcg tacactacat
   113341 ccgtctaccg ccgccagcaa cccttttttt cccccgctca ctcctccccc ccctcctccc
   113401 ccctcctgcc tccattcatc aatctcgtcc aggccgcggg cccattcacc atcgccgcgg
   113461 tccgagctcg gccaggagag atggatggat ggattggggg aaggaggggc ggggagcgcg
   113521 agcgggagaa ggttggcgaa ggagagagcg agagcgggaa ctggagaggg ggctgggtgg
   113581 ggtgaggcga gtgaccgcca ccgccctcta ccaccaccac ccctcccctc cctctcctct
   113641 ctctctcccc ggtcccgtgt gcacacacag agagtgtttt ttttccttct tcttcttccc
   113701 ggttcctctt cgtcctccgg accctcggtg ccgcgatccc ccaccccgcc cccccccccc
   113761 ttcctcctcc ccccatttcc cccaccccca attcccccac tcctcccaca ccagcccccg
   113821 ccgccgcggc cgcagccgcc gcgatccgtc ctccccattc atcttttttc cagaggccat
   113881 tcatcgcccc gctcatccgt cttcatcgcc gcggagggct ggctcgaggc cagcgcgccc
   113941 tttcctctcc cggcgcgccc gctccctccg cgtcccctct ccccgccgcc ccccgcggcc
   114001 acaccgagcc ttctccgcgc ggtcccgcct ctcctctcct ctccccccat cccgccccgc
   114061 tccccgcccc ctctcccccc cccctctctc ccgccggtgt tttcccacgc ccacactcac
   114121 tttctccgct cccaccccac cctcccgact cacccgtccc gggggattcc ctgtccctcg
   114181 gggcgcggcc gacccggcgg tgacccatcc ccaccccgcc gcgccccttt ttcctcgaga
   114241 gcgggcgtcc gggaagggag aggtcgcggc gggtcacgcg cgctcccgcg acttcccggc
   114301 ccgcgatgcg gtcccggaaa tttccgggac ggtcgccgcg gccgtctcgg ggcccgcggc
   114361 gccgccaact cgagtcttgg cacgctgcca gcgttcgcac ttgttgtata taagatataa
   114421 tactagtaca tattagcaat tggtgcgaac gtgacgtggc ccaatcagat ccggccctcg
   114481 ggcccacgtg ccccattggc gatttatcga tcgctttccg aagggatcga accccgcggc
   114541 acccgcctcc ggggacgcgc cggccaatgg gggagccggg cccgcgtccc cggggcccgc
   114601 attggccggt cccggacgcc cgtcccgcgg gccggaccgc cccgccgact cgggtcctgg
   114661 cacgctgcca gcgttcgcac ttgcggtata taagatatta tactagtata tattagcaat
   114721 tggtgcgaac gtgacgtggc ccaatcagat cccgccgttt gccccacgtg cccctattgg
   114781 caatttatcg accgctttcc gaagggatcg aaccccgcgg cacccgcctc cggggacgcg
   114841 ccggccaatg cgggctcccg ggacgcgggc acggctcccc cattggccgg tcccggacgc
   114901 ccgtcccgcg ggccggaccg cccccttccc gggacttggc acgcatccag cgttcgcact
   114961 tgcggtatat aagatattat actagtatat attagcaatt ggtgcgaacg tgacgtggcc
   115021 caatcaaatc tctccacggg ccccacgtgc ccccattggc gatttatcga tcgctttccg
   115081 aagggatcga accccggggg cgggcgcccc ggggacgcgc cggccaatgg gggagccggg
   115141 cccgcgtccc cggggcccac gtgtgaggcc ccggccaatg ggcccgtcgg cccggccccc
   115201 tcgacggggc gataaagggg tgcgtggcgg cccggccgac ggcactcgcc gccccaacga
   115261 cgccgacggg gatcgaccgg gagaggcgcg gagcgcgccc cgagccgacg aggagccgcg
   115321 ccccgctcga ggacgcccgg acgacgacgg tgacgtcggc atcggcctcg acgacgacga
   115381 tcgcgggacc cgacggtacc ggatgcgggg gatcccccgg tcggggtggg ccgggagtgg
   115441 gcgtggcaac tcctccccgt cccccctccc tccccacccc gcgcgatcgc gctcatcgta
   115501 tccgttctcg tttcaggtgc cgcatcgttc cggaagaaac gcctcggggg tcgcgcgtcc
   115561 gtcgcctagg tgagtcgggg ggcttcccgg gtgcggctcc tcccccctcc cctcccccgg
   115621 gttgggttgg gcgggtgggc gggtgggcgg gggtcgggag ggatcggggg aagggggggg
   115681 gtcgtggctc acgctgacgt catgcgtttc cccccccccc acagggacgc gagcgggacc
   115741 ggctggtcga ccacccattc aatccatcca atccatccag ccacccccac ccgtcggggc
   115801 ggccgggctc gggtccggtt ccgggtcggc gtcggggagc ctcgcccacc cacccggccc
   115861 ccgtcccagc ccagcccccc cccccccccc cccccccccc acgcccccat cgcaccccct
   115921 cccaccccgt tcccaccacc ccgccgaccc cccgctcgac cgcccgcccc cgacccaccg
   115981 cgtccgccgc gcccatggac cgggtctggg ccgactggta cgagcccgtg ccctccccgc
   116041 cgttctcgcc cgtcgacccg cccgggcccc ggcccacgac cccggtcccg gggagcagcc
   116101 ccccgtcccc cgcctcgacc cccacgcccc ccaagcgcgg gcgctacgtc gtcgagcacc
   116161 ccgagtacgg gcccccgccc gaccccgagg aggtgcgcgt ccacggcgcg cggggccccg
   116221 gcgccttctg cgcggccccc tggcgccccg acacgcggcg cctcggggcc gacgtgaacc
   116281 gcctctttcg cggcatcgcc gtctcggccg ccgacgtgac gggcgacacg cgcgccctgc
   116341 gccgcgccct ctttgacttt tacgccatgg gctacacgcg ccagcgcccc tcggccccct
   116401 gctggcaggc cctgctccag ctctcgcccg agcagagcgc cccgctgcgc agcgcgctgc
   116461 gcgagctcaa cgagcgcgac gtctacgacc cgcgcgtcct ctccccgccg gtcatcgagg
   116521 gcccgctctt tggggaggag tgcgacgtcg acgaggacga cgccggctcg gacaccaccg
   116581 tcgcgtccga gtttagcttc cgcggctcgg tgtgcgagga cgacggggag gacgaggacg
   116641 aagaggaaga cggggaggag gaagacgagg acgaggaggg ggaagaggaa gaagacgagg
   116701 aggaagagga aggggacgag gacggggaga cggacgtgta cgaggaggac gacgaggccg
   116761 aggacgagga ggacgaggag gacggggacg actttgacgg ggccagcgtg ggcgacgacg
   116821 acgtgtttga gccccccgag gacggctcgg acggagaggg ctcgggctcg gacgacggcg
   116881 gggacgggga agatgaagac gaggacgaag atgaagacga ggacgaggac gatggagagg
   116941 acgaggagga cgaggaaggg gaggacgggg gggaagacgg cgaagacggt gaagaagacg
   117001 aagacgaaga cggagagggc gaggagggcg ggaaggacgc cgcccgccgg gggacgcgcg
   117061 ccccgacgcg gcccgccgcc gccccgtgag gcgggcctcg ccccgcgctg ttctttcctc
   117121 cccccacccc ccccacccca ccgtccgccc catcgtttgc ccctctcccc ctcccctctg
   117181 ttgtgccctc aataaacacg gcggcccgcc gctcgaacct caactctctc gtctctcggg
   117241 cgttttttcc ctcccggccc tcgtggggaa gggagatggg ggtggagacg gtggagggag
   117301 aggggagtgg gatggggtgg agacggtgga gggagagggg agtgggatgg ggtggagacg
   117361 gtggagggag aggggagtgg gatggggtgg agacggtgga gggagagggg agtgggatgg
   117421 ggtggagacg gtggagggag aggggagtgg gatggggtgg agacggtgga gggagagggg
   117481 agtgggatgg ggtggagacg gtggagggag aggggagtgg gatggggtgg agacggtgga
   117541 gggagagggg agtgggatgg ggtggagacg gtggagggag aggggagtgg gatggggtgg
   117601 agacggtgga gggagagggg agtgggatgg ggtggagacg gtggagggag aggggagtgg
   117661 gatggggtgg agacggtgga gggagagaaa ggacggaggc gtgtcatcgg gtgccagagc
   117721 gagagcgttt attgttaaag ttgttggtgg ggggggagtc cgggggagtc cgggggagtc
   117781 cgggggagtc cgggggagtc cgggggagtc cgggggagtc cgggggagtc cgggggagtc
   117841 ctcggcggct attggtggga agggggagtg acgtcagggc agcggggggg ggggaagggg
   117901 gggaaggggg gagatggggg agggagagag aggacggagg cggcgcgagt ctgtcggatg
   117961 gcgccagggg ggggcgggcg gccgcgggga gggatgacgg gcgcgcgtgg ggcggcggcg
   118021 cccccgtcgc ggtcgagaac caccgccgcc gtcaccgccg cctcccatcc gatgtgatat
   118081 cgcggcacgc cggccgtccc ggcgctcatt cacaccgcac ccgttcgccc acgtccccgc
   118141 ggccaagcac acacaccaac tcgcgcacca tgttggcgat gtggagatgg gtcaccaaga
   118201 ggtcgcggct ccgccgaggc cacgcccatc ttgggggaaa taaaggagtc cggggaattt
   118261 gttccttata ccttgccggg ctcagcaggg ggttgtcgcg cgtccacgcc cagcgctcgc
   118321 acgcagcaac aatggccgac gccggaatcc ccgacgagat cctgtactcg gacatcagcg
   118381 acgacgagat catcatcgac ggcgacggcg acagcagcgg ggacgaggac gacgatgacg
   118441 gggggctgac gcggcaggcc gcggcgcgca tcgtcacgga cctgggcttc gaggtgctgc
   118501 agcccctgca gtcgggctcg gagggccgcg tcttcgtggc ccgccggccg ggcgaggcgg
   118561 acacggtggt gctgaaggtg ggccagaagc cctcgacgct gatggagggc atgctgctgc
   118621 agcgcctgtc ccacgataac gtcatgcgca tgaaacagat gctcgcccgg ggcccggcga
   118681 cgtgcctggt cctgccgcac tttcggtgcg atctgtacag ctacctgacc atgcgggacg
   118741 ggccgctgga catgcgcgac gccgggtgcg tgatccgggc cgtgctccgc gggctcgcct
   118801 acctgcacgg gatgcgcatc atgcatcgcg acgtcaaggc ggagaacatc ttcctcgagg
   118861 acgtggacac ggtgtgccta ggggacctcg gggccgcgcg ctgcaacgtg gcggcgccca
   118921 acttttacgg gctcgccggg accatcgaga ccaacgcccc cgaggtgctc gcgcgcgacc
   118981 gctacgacac caaggtcgac gtctggggcg cgggggtggt gctcttcgag acgctggcct
   119041 accccaagac gatcaccggc ggggacgagc ccgcgatcaa cggggagatg cacctgatcg
   119101 acctcatccg cgccctcggg gtgcaccccg aggagttccc gcccgacacg cgcctccgga
   119161 gcgagttcgt ccggtacgcc gggacccacc gccagccgta cacgcagtac gcgcgcgtgg
   119221 ctcgcctcgg gctgcccgag acgggggctt tcctgattta caagatgttg acgtttgatc
   119281 ccgtccgccg cccttccgct gatgagatac tcaactttgg aatgtggacc gtataaaacg
   119341 ggccggctcc gagcggtagg acacacacac ctttgcgcat ctccacagct caacaatgaa
   119401 gtgggcaacg tggatcctcg ccctcgggct cctcgtggtc cgcaccgtcg tggccagaga
   119461 ggcccctcgg gagctctgct acggccaccc cgtccacgac gaccggcggc ccgtcgggcc
   119521 cgcgaccgac gcccagcccg tgaacccgct cgcccccgcc aacgccaccg ggacggacta
   119581 ctctcgcggc tgcgagatgc gcctcctgga tccgcctctc gacgtatcgt cccgctcctc
   119641 ggaccccgtc aacgtgaccg tcgcctggtt ctttgacggc ggccactgca aggtgcccct
   119701 cgtccaccgc gagtactacg gctgccccgg ggacgccatg ccctccgtcg agacgtgcac
   119761 cggcgggtac tcgtacaccc gcacgcgcat cgacaccctg atggagtacg ccctcgtgaa
   119821 cgccagcctc gtgctgcagc ccgggctgta cgacgccggc ctgtacatcg tcgtgctcgt
   119881 ctttggcgac gacgcctacc tcggcaccgt ctccctgtcg gtggaggcca acctggacta
   119941 cccctgcggc atgaagcacg ggctcacgat cacccgcccc ggggccaccc tcccacccat
   120001 cgcccccacg gccggcgacc accagcgctg gcgcgggtgc ttcccctcga ccgacgaggg
   120061 cgcctgggag aacgtgaccg ccgccgagaa gggcctgtcc gacgactacg ccgactacta
   120121 cgacgtgcac atcttccgct cggagtctga cgacgaggtc gtccacggcg atgcccccga
   120181 ggcccccgag ggcgaggagg tgaccgagga ggaggccgag ctgacctcca gcgacctcga
   120241 caacatcgag atcgaggtcg tgggctctcc cgccgctccc gccgagggcc cggcgacgga
   120301 ggaggggcgc ggggccgagg aggacgagga gctgacctcc agcgacctcg acaacatcga
   120361 gatcgaggtc gtgggctcgc cgcggccgcc cgcttcttcg ccgcctccac cacccccgcg
   120421 cccccacccg cgcggccgag atcacgacca tgaccacggt caccaccgtg cggacgaccg
   120481 aggaccccag cggcatcacc gactgccgcc ggagccgacc ttcgtctcgc cctctgacat
   120541 cttcgtgacc cccaccggca gccccgccct gctcctgggc ttcctgggca gcgcgctcgc
   120601 ctcgcgcccc ctgcacctga cggccgggga gacggcccag cacgtgcgcg aggcccagca
   120661 gaagagccgc cacatccgct ccctcggcgg cctccagctc tcggtcgaga ccgagaccac
   120721 caacaccacc accacccaga cgggcctgtc gggcgacatc cgcacctcga tctacatctg
   120781 cgtcgccctc gccggcctgg tcgtcgtggg catcgtcatc atgtgcctcc atatggcgat
   120841 catcagggcc cgggcccgga acgacggcta ccgccacgtg gcctccgcct gacccggccc
   120901 cgcccgactc ccccgcgatt ccccccctct ctcaccgggt gtccatcttc aataaagtat
   120961 gtctcaaaca cctaatttgc gtacggcctt gcttacgggg ggtgcgatcc acgcccagcg
   121021 gtccataaaa ttgggtgggg gccccaggtt cccatacact cacctgccag cgccatgctg
   121081 ctcgcagcgc tattggcggc gctggtcgcc cggacgacgc tcggcgcgga cgtggacgcc
   121141 gtgcccgcgc cgaccttccc cccgcccgcg tacccgtaca ccgagtcgtg gcagctgacg
   121201 ctgacgacgg tcccctcgcc cttcgtcggc cccgcggacg tctaccacac gcgcccgctg
   121261 gaggacccgt gcggggtggt ggcgctgatc tccgacccgc aggtggaccg gctgctgaac
   121321 gaggcggtgg cccaccggcg gcccacgtac cgcgcccacg tggcctggta ccgcatcgcg
   121381 gacgggtgcg cgcacctgct gtactttatc gagtacgccg actgcgaccc caggcagatc
   121441 tttgggcgct gccggcgccg caccacgccg atgtggtgga ccccgtccgc ggactacatg
   121501 ttccccacgg aggacgagct ggggctgctc atggtggctc cggggcggtt caacgagggc
   121561 cagtaccggc gcctggtgtc cgtcgacggc gtgaacatcc tcaccgactt catggtggcg
   121621 ctccccgagg ggcaagagtg cccgttcgcc cgcgtggacc agcaccgcac gtacaagttc
   121681 ggcgcgtgct ggaacgacga gagcttcagg cggggcgtgg acgtgatgcg attcctgacg
   121741 ccgttctacc agcagccccc gcaccgggag gtggtgaact actggtaccg caagaacggc
   121801 cggacgctcc cgcgggccta cgccgccgcc acgccgtacg ccatcgaccc cgcgcggccc
   121861 tcggcgggct cgccgaggcc caggccccgg ccccggcccc ggccgaagcc cgagcccgcc
   121921 ccggtgacgc ccgcgccccc cggccgcctg cccgagccgg cgacgcggga ccacgccgcc
   121981 gggggccacc ccacgccgcg acccccgagg cccgagacgc cgcaccgccc cttcgccccg
   122041 ccggccgtcg tgcccagcgg gtggccgcag cccgcggagc cgttccagcc gcggaccccc
   122101 gccgcgccgg gcgtctcgcg ccaccgctcg gtgatcgtcg gcacgggcac cgcgatgggc
   122161 gcgctcctgg tgggcgtgtg cgtctacatc ttcttccgcc tgaggggggc gaaggggtat
   122221 cgcctcctgg gcggtcccgc ggacaccgac gagctaaaag cgcagcccgg tccgtagcct
   122281 ccgcagtacc ggcgtcgatg atgatggtgg cgcgcgacgt gacccggctc cccgcggggc
   122341 tcctcctcgc cgccctgacc ctggccgccc tgaccccgcg cgtcgggggc gtcctcttca
   122401 ggggcgccgg cgtcagcgtg cacgtcgccg gcagcgccgt cctcgtgccc ggcgacgcgc
   122461 ccaacctgac gatcgacggg acgctgctgt ttctggaggg gccctcgccg agcaactaca
   122521 gcgggcgcgt ggagctgctg cgcctcgacc ccaagcgcgc ctgctacacg cgcgagtacg
   122581 ccgccgagta cgacctctgc ccccgcgtgc accacgaggc cttccgcggc tgtctgcgca
   122641 agcgcgagcc gctcgcccgg cgcgcgtccg ccgcggtgga ggcgcgccgg ctgctgttcg
   122701 tctcgcgccc ggccccgccg gacgcggggt cgtacgtgct gcgggtccgc gtgaacggga
   122761 ccacggacct ctttgtgctg acggccctgg tgccgcccag ggggcgcccc caccacccca
   122821 cgccgtcgtc cgcggacgag tgccggcccg tcgtcggatc gtggcacgac agcctgcgcg
   122881 tcgtggaccc cgccgaggac gccgtgttca ccacgccgcc cccgatcgag ccagagccgc
   122941 cgacgacccc cgcgcccccc cgggggaccg gcgccacccc cgagccccgc tccgacgaag
   123001 aggaggagga cgaggagggg gcgacgacgg cgatgacccc ggtgcccggg accctggacg
   123061 cgaacggcac gatggtgctg aacgccagcg tcgtgtcgcg cgtcctgctc gccgccgcca
   123121 acgccacggc gggcgcccgg ggccccggga agatagccat ggtgctgggg cccacgatcg
   123181 tcgtcctcct gatcttcttg ggcggggtcg cctgcgcggc ccggcgctgc gcgcggaatc
   123241 gcatctaccg gccgcgaccc gggcgcggcc cggcggtcca cgcgccgccc ccgcggcgcc
   123301 cgccccccag ccccgtcgcc ggggcgcccg tcccccagcc caagatgacg ttggccgagc
   123361 ttcgccagaa gctggccacc atcgcagagg aacaataaaa aggtggtgtt tgcataattt
   123421 tgtgggtggc gttttatctc cgtccgcgcc gttttaaacc tgggcacccc cgcgagtctc
   123481 gcacacaccg gggttgagac catgcggccc tttctgctgc gcgccgcgca gctcctggcg
   123541 ctgctggccc tggcgctctc caccgaggcc ccgagcctct ccgccgagac gaccccgggc
   123601 cccgtcaccg aggtcccgag tccctcggcc gaggtctggg acctctccac cgaggccggc
   123661 gacgatgacc tcgacggcga cctcaacggc gacgaccgcc gcgcgggctt cggctcggcc
   123721 ctcgcctccc tgagggaggc acccccggcc catctggtga acgtgtccga gggcgccaac
   123781 ttcaccctcg acgcgcgcgg cgacggcgcc gtggtggccg ggatctggac gttcctgccc
   123841 gtccgcggct gcgacgccgt ggcggtgacc atggtgtgct tcgagaccgc ctgccacccg
   123901 gacctggtgc tgggccgcgc ctgcgtcccc gaggccccgg agcggggcat cggcgactac
   123961 ctgccgcccg aggtgccgcg gctccagcgc gagccgccca tcgtcacccc ggagcggtgg
   124021 tcgccgcacc tgaccgtccg gcgggccacg cccaacgaca cgggcctcta cacgctgcac
   124081 gacgcctcgg ggccgcgggc cgtgttcttt gtggcggtgg gcgaccggcc gcccgcgccg
   124141 ctggccccgg tgggccccgc gcgccacgag ccccgcttcc acgcgctcgg cttccactcg
   124201 cagctcttct cgcccgggga cacgttcgac ctgatgccgc gcgtggtctc ggacatgggc
   124261 gactcgcgcg agaacttcac cgccacgctg gactggtact acgcgcgcgc gcccccgcgg
   124321 tgcctgctgt actacgtgta cgagccctgc atctaccacc cgcgcgcgcc cgagtgcctg
   124381 cgcccggtgg acccggcgtg cagcttcacc tcgccggcgc gcgcgcggct ggtggcgcgc
   124441 cgcgcgtacg cctcgtgcag cccgctgctc ggggaccggt ggctgaccgc ctgccccttc
   124501 gacgccttcg gcgaggaggt gcacacgaac gccaccgcgg acgagtcggg gctgtacgtg
   124561 ctcgtgatga cccacaacgg ccacgtcgcc acctgggact acacgctcgt cgccaccgcg
   124621 gccgagtacg tcacggtcat caaggagctg acggccccgg cccgggcccc gggcaccccg
   124681 tggggccccg gcggcggcga cgacgcgatc tacgtggacg gcgtcacgac gccggcgccg
   124741 cccgcgcgcc cgtggaaccc gtacggccgg acgacgcccg ggcggctgtt tgtgctggcg
   124801 ctgggctcct tcgtgatgac gtgcgtcgtc gggggggccg tctggctctg cgtgctgtgc
   124861 tcccgccgcc gggcggcctc gcggccgttc cgggtgccga cgcgggcggg gacgcgcatg
   124921 ctctcgccgg tgtacaccag cctgcccacg cacgaggact actacgacgg cgacgacgac
   124981 gacgaggagg cgggcgacgc ccgccggcgg ccctcctccc ccggcgggga cagcggctac
   125041 gaggggccgt acgtgagcct ggacgccgag gacgagttca gcagcgacga ggacgacggg
   125101 ctgtacgtgc gccccgagga ggcgccccgc tccggcttcg acgtctggtt ccgcgatccg
   125161 gagaaaccgg aagtgacgaa tgggcccaac tatggcgtga ccgccagccg cctgttgaat
   125221 gcccgccccg cttaaatacc gggagaaccg gcccgcccgc attccgacat gcccgccgcc
   125281 gcccccgccg acatggacac gttcgacccc agcgcccccg tcccgacgag cgtctctaac
   125341 ccggccgccg acgtcctgct ggcccccaag ggaccccgct ccccgctgcg cccccaggac
   125401 gactcggact gctactacag cgagagcgac aacgagacgc ccagcgagtt cctgcgccgc
   125461 gtgggacgcc ggcaggcggc gcgccggaga cgccgccgct gcctgatggg cgtcgcgatc
   125521 agcgccgccg cgctggtcat ctgctcgctg tcggcgctga tcgggggcat catcgcccgg
   125581 cacgtgtagc gagcgggtgg tggccgcccg ccccgccgcg cccaggaggg ggggtccggg
   125641 ggggcgaagc gggcggagga gagcgagcca cgtggttgtg ggctcggact tgtcacaata
   125701 aatgggcccc ggcgcacccg ggcgcacaca gcagccttcc tcgtctccgc gtctctgctg
   125761 ttcctctcgt cggtcttctc ccactccgcc gtcgcgaacg cgctcgcgcc atgggggtga
   125821 cggccatcac cgtggtcacg ctgatggacg ggtccgggcg catccccgcc ttcgtgggcg
   125881 aggcgcaccc ggacctgtgg aaggtgctca ccgagtggtg ctacgcgtcg ctggtgcagc
   125941 agcggcgcgc cgccgacgag gacacgccgc ggcaacacgt ggtgctgcgc tcctcggaga
   126001 tcgcccccgg ctcgctggcc ctgctgccgc gcgccacgcg ccccgtcgtg cggacacggt
   126061 ccgaccccac ggcgccgttc tacatcacca ccgagacgca cgagctgacg cggcgccccc
   126121 cggcggacgg ctcgaagccc ggggagcccc tccgtatcag cccgcccccg cggctggaca
   126181 cggagtggtc ctccgtcatc aacgggatcc agtacctgaa ctcgggggcc cggggcacgg
   126241 ccccgatcca cctgtggatc ctgggcgccg ccgacctctg cgaccaggtg ctcctggccg
   126301 cctcccgcag caccgccgcc ggagcccccg gcgccccgac gggcgcgcgc ctgacccggc
   126361 ggcggcccgg gctgacggac gccgacgccc tggacgtgat cgtcgccggg atcccggcca
   126421 cccgcgccat gttcgcgcgg gtccacaacc gctcctggcg ccacgccggc gagtggacgg
   126481 aggccctgca tgcccagatc gtgacccggg gcgacgtgcg ccggcgccgg ggcgggcgcg
   126541 gcaacggacg cgagcgcgcc ccgcgatgta ccatctccta gacggcagga tctctccgca
   126601 tcccccacac cccccaaaaa aacaaacaat aaacgctctc gctctggcac ccgatgacac
   126661 gcctccgtcc tctctctccc tcccccatct ccccccttcc cccccttccc ccccccccgc
   126721 tgccctgacg tcactccccc ttcccaccaa tagccgccga ggactccccc ggactccccc
   126781 ggactccccc ggactccccc ggactccccc ggactccccc ggactccccc ggactccccc
   126841 ggactccccc cccaccaaca actttaacaa taaacgctct cgctctggca cccgatgaca
   126901 cgcctccgtc ctttctctcc ctccaccgtc tccaccccat cccactcccc tctccctcca
   126961 ccgtctccac cccatcccac tcccctctcc ctccaccgtc tccaccccat cccactcccc
   127021 tctccctcca ccgtctccac cccatcccac tcccctctcc ctccaccgtc tccaccccat
   127081 cccactcccc tctccctcca ccgtctccac cccatcccac tcccctctcc ctccaccgtc
   127141 tccaccccat cccactcccc tctccctcca ccgtctccac cccatcccac tcccctctcc
   127201 ctccaccgtc tccaccccat cccactcccc tctccctcca ccgtctccac cccatcccac
   127261 tcccctctcc ctccaccgtc tccaccccat cccactcccc tctccctcca ccgtctccac
   127321 ccccatctcc cttccccacg agggccggga gggaaaaaac gcccgagaga cgagagagtt
   127381 gaggttcgag cggcgggccg ccgtgtttat tgagggcaca acagagggga gggggagagg
   127441 ggcaaacgat ggggcggacg gtggggtggg gggggtgggg ggaggaaaga acagcgcggg
   127501 gcgaggcccg cctcacgggg cggcggcggg ccgcgtcggg gcgcgcgtcc cccggcgggc
   127561 ggcgtccttc ccgccctcct cgccctctcc gtcttcgtct tcgtcttctt caccgtcttc
   127621 gccgtcttcc cccccgtcct ccccttcctc gtcctcctcg tcctctccat cgtcctcgtc
   127681 ctcgtcttca tcttcgtcct cgtcttcatc ttccccgtcc ccgccgtcgt ccgagcccga
   127741 gccctctccg tccgagccgt cctcgggggg ctcaaacacg tcgtcgtcgc ccacgctggc
   127801 cccgtcaaag tcgtccccgt cctcctcgtc ctcctcgtcc tcggcctcgt cgtcctcctc
   127861 gtacacgtcc gtctccccgt cctcgtcccc ttcctcttcc tcctcgtctt cttcctcttc
   127921 cccctcctcg tcctcgtctt cctcctcccc gtcttcctct tcgtcctcgt cctccccgtc
   127981 gtcctcgcac accgagccgc ggaagctaaa ctcggacgcg acggtggtgt ccgagccggc
   128041 gtcgtcctcg tcgacgtcgc actcctcccc aaagagcggg ccctcgatga ccggcgggga
   128101 gaggacgcgc gggtcgtaga cgtcgcgctc gttgagctcg cgcagcgcgc tgcgcagcgg
   128161 ggcgctctgc tcgggcgaga gctggagcag ggcctgccag cagggggccg aggggcgctg
   128221 gcgcgtgtag cccatggcgt aaaagtcaaa gagggcgcgg cgcagggcgc gcgtgtcgcc
   128281 cgtcacgtcg gcggccgaga cggcgatgcc gcgaaagagg cggttcacgt cggccccgag
   128341 gcgccgcgtg tcggggcgcc agggggccgc gcagaaggcg ccggggcccc gcgcgccgtg
   128401 gacgcgcacc tcctcggggt cgggcggggg cccgtactcg gggtgctcga cgacgtagcg
   128461 cccgcgcttg gggggcgtgg gggtcgaggc gggggacggg gggctgctcc ccgggaccgg
   128521 ggtcgtgggc cggggcccgg gcgggtcgac gggcgagaac ggcggggagg gcacgggctc
   128581 gtaccagtcg gcccagaccc ggtccatggg cgcggcggac gcggtgggtc gggggcgggc
   128641 ggtcgagcgg ggggtcggcg gggtggtggg aacggggtgg gagggggtgc gatgggggcg
   128701 tggggggggg gggggggggg gggggggctg ggctgggacg ggggccgggt gggtgggcga
   128761 ggctccccga cgccgacccg gaaccggacc cgagcccggc cgccccgacg ggtgggggtg
   128821 gctggatgga ttggatggat tgaatgggtg gtcgaccagc cggtcccgct cgcgtccctg
   128881 tggggggggg ggaaacgcat gacgtcagcg tgagccacga ccccccccct tcccccgatc
   128941 cctcccgacc cccgcccacc cgcccacccg cccaacccaa cccgggggag gggagggggg
   129001 aggagccgca cccgggaagc cccccgactc acctaggcga cggacgcgcg acccccgagg
   129061 cgtttcttcc ggaacgatgc ggcacctgaa acgagaacgg atacgatgag cgcgatcgcg
   129121 cggggtgggg agggaggggg gacggggagg agttgccacg cccactcccg gcccaccccg
   129181 accgggggat cccccgcatc cggtaccgtc gggtcccgcg atcgtcgtcg tcgaggccga
   129241 tgccgacgtc accgtcgtcg tccgggcgtc ctcgagcggg gcgcggctcc tcgtcggctc
   129301 ggggcgcgct ccgcgcctct cccggtcgat ccccgtcggc gtcgttgggg cggcgagtgc
   129361 cgtcggccgg gccgccacgc acccctttat cgccccgtcg agggggccgg gccgacgggc
   129421 ccattggccg gggcctcaca cgtgggcccc ggggacgcgg gcccggctcc cccattggcc
   129481 ggcgcgtccc cggggcgccc gcccccgggg ttcgatccct tcggaaagcg atcgataaat
   129541 cgccaatggg ggcacgtggg gcccgtggag agatttgatt gggccacgtc acgttcgcac
   129601 caattgctaa tatatactag tataatatct tatataccgc aagtgcgaac gctggatgcg
   129661 tgccaagtcc cgggaagggg gcggtccggc ccgcgggacg ggcgtccggg accggccaat
   129721 gggggagccg tgcccgcgtc ccgggagccc gcattggccg gcgcgtcccc ggaggcgggt
   129781 gccgcggggt tcgatccctt cggaaagcgg tcgataaatt gccaataggg gcacgtgggg
   129841 caaacggcgg gatctgattg ggccacgtca cgttcgcacc aattgctaat atatactagt
   129901 ataatatctt atataccgca agtgcgaacg ctggcagcgt gccaggaccc gagtcggcgg
   129961 ggcggtccgg cccgcgggac gggcgtccgg gaccggccaa tgcgggcccc ggggacgcgg
   130021 gcccggctcc cccattggcc ggcgcgtccc cggaggcggg tgccgcgggg ttcgatccct
   130081 tcggaaagcg atcgataaat cgccaatggg gcacgtgggc ccgagggccg gatctgattg
   130141 ggccacgtca cgttcgcacc aattgctaat atgtactagt attatatctt atatacaaca
   130201 agtgcgaacg ctggcagcgt gccaagactc gagttggcgg cgccgcgggc cccgagacgg
   130261 ccgcggcgac cgtcccggaa atttccggga ccgcatcgcg ggccgggaag tcgcgggagc
   130321 gcgcgtgacc cgccgcgacc tctcccttcc cggacgcccg ctctcgagga aaaaggggcg
   130381 cggcggggtg gggatgggtc accgccgggt cggccgcgcc ccgagggaca gggaatcccc
   130441 cgggacgggt gagtcgggag ggtggggtgg gagcggagaa agtgagtgtg ggcgtgggaa
   130501 aacaccggcg ggagagaggg gggggggaga gggggcgggg agcggggcgg gatgggggga
   130561 gaggagagga gaggcgggac cgcgcggaga aggctcggtg tggccgcggg gggcggcggg
   130621 gagaggggac gcggagggag cgggcgcgcc gggagaggaa agggcgcgct ggcctcgagc
   130681 cagccctccg cggcgatgaa gacggatgag cggggcgatg aatggcctct ggaaaaaaga
   130741 tgaatgggga ggacggatcg cggcggctgc ggccgcggcg gcgggggctg gtgtgggagg
   130801 agtgggggaa ttgggggtgg gggaaatggg gggaggagga aggggggggg gggcggggtg
   130861 ggggatcgcg gcaccgaggg tccggaggac gaagaggaac cgggaagaag aagaaggaaa
   130921 aaaaacactc tctgtgtgtg cacacgggac cggggagaga gagaggagag ggaggggagg
   130981 ggtggtggtg gtagagggcg gtggcggtca ctcgcctcac cccacccagc cccctctcca
   131041 gttcccgctc tcgctctctc cttcgccaac cttctcccgc tcgcgctccc cgcccctcct
   131101 tcccccaatc catccatcca tctctcctgg ccgagctcgg accgcggcga tggtgaatgg
   131161 gcccgcggcc tggacgagat tgatgaatgg aggcaggagg ggggaggagg ggggggagga
   131221 gtgagcgggg gaaaaaaagg gttgctggcg gcggtagacg gatgtagtgt acgaggcggc
   131281 gagtacgccg agatgatgga acgagggcga gcctcttgtt gtgtgtggga aagagagcgc
   131341 gggagggcgg gtgagagagg tcggggaggc cggggccgaa atagaaagcg gagaaagctc
   131401 tcagggcccg gggttgcgcc ggcgggagag acgacgggcg ccacagacag cggcgcgggg
   131461 ggagggtgtg tatgtgtggt ggtgtgtgtt aaccacgaaa gatgaggagg cggcggcggc
   131521 gcgagggcgc gaaaaccccg acgcgcctcg atgcggcccg aatcgccgcg acgcgagtcg
   131581 acggggagag gaaggagggg aggacggagg gcgagccgcc gccgcccccc accccacccc
   131641 gcccctctcg cccacgcgcc ctctcccccc ttcgcgcacg ctcactcgcc cgcacccctc
   131701 cccctcaccc ccgctccccc ctctcgttcc gcgccgcacg cgccgtcccg cggccccgtc
   131761 gggcgcaggg atcgtagcaa acgcgggcgg tcggcgtgcg cgctgtgcgg gtgggtgggg
   131821 gagggggttg atggccgcgc tggttccggg aagcctcccc cggcgggcgg gggggtgtcg
   131881 gggccgggtt cgctctgtac cctctcacgc gggcccggag tgccgcgggc ggggcggggg
   131941 cagcactcag cgaaggctca gggtgttcca gccgatggcc ccgggggcac gcgggcggga
   132001 ggagttgcgt gggcggagag gagcgaggag gactggcggc ggcggcggag gaggggggaa
   132061 gaggcggcga gcggagcgcg cggtagcgcc cgcgggcggc ccgcgcggta tcgcccgcgc
   132121 ggtatcgcgg cggcccggga gagcgggcgg gggacgggga cggggacggg gaggaggagg
   132181 gaggaagggg gtcgccgccg cggccctcgc ggcccgggag aagccttccc ggacgcgcca
   132241 ttagagaggg ctctgtctgc agaaacggtg tctaggcgcc gcgccagggg aaaccgcagc
   132301 ggcgataaaa tagcttttag ctcggcgctc tctctgggtc gcagcgccct aaacttggca
   132361 cggtccgccg cacagtgtgg cccgcgtcca ggccgggccc ccggccggcc ggcccggcga
   132421 gcgagcgggc gggcgagccg gggcccccgg cccgctccac cgtgacaccc acccacaccg
   132481 taaactctca cacggacacg cgcgcccacc ctcggcgccg tgggcccgac cccggtccgc
   132541 gccggcaccc ccttttctcc ggcaccaagc cggggggccg gggcgagggg aaggggaagg
   132601 ggggggacgg ggtgcgcgcg cgtgtgtgta tgtgtatgtg gcaccggcat cggtctcccc
   132661 ccaaaacgga gaaggcgagg gagacggaga gggaggtgtg tctctgtgtt gttgtttttt
   132721 tcctgctggc gccgcggtgc gcgaacgtga tcacgggggg gcggcgcgct ccgcgctccc
   132781 ccgccgcctg ggcggggatg ccgcgccggc acgagcgcac gcgggcgcgc ggggagggag
   132841 gagggcggag gaagggccgg gccgccgagc cggccgcgcc attgggcgcc gggcggaacg
   132901 gggcgtggag aggcgcccgc gccggggacg cgcctgcggc ggcgggcgcg cgccgggcgg
   132961 ctctcctcct tcaccgccgc cgcgtcctcc tcctcctccc tccccgccgg cctcggccca
   133021 cccgcggcgt caccccgctc tccccccccc tcccttcccc ccgaccccct cccctccctc
   133081 ccctcccctc ccgcgtcctg cgtcacgggg accggggggt cccgcgtgat gacgccgggg
   133141 acgcgggacg tgcccgccgc ctgggagccg gcgaggagga caaaaagagt tctgtgtccc
   133201 ctcgcccccc tccgcgtccg cagccgcctc tgcagccgcc gcccgcgccg cgaccggcga
   133261 acgcagagag gggacgcggg gaagagacgc ggagaggggg acggggggag agagagcgag
   133321 gggcgcgagc gcttcctcct ccgcacccgc cttcctccgc ccgcctttcc ttcccggact
   133381 cgggagccgc tcccgctccc ccgtttttcc tcctggccgc ggcgaccgcc gccgccgctc
   133441 tcgaggtttt ttttccttcc tctccttctt cctcctcctc cgcctttggg tgtttccttc
   133501 tccgcgtccc catctccgag gcccgaggcg ccggggcttt cttcccggac cgccggggag
   133561 gaagcgcccc ggcttctgct tcttattctc ctctctcggt aagcacagac tctcttactc
   133621 ctactcctac tactcccact cctactatat tactatgact actactatga ctactacggt
   133681 gacttctcct ccccgctcta gacttttttt cctcccctct cctcctttcg ctcccgtctc
   133741 ccgggcaccc gcggccgggc ggagggggaa gcgggaaggg gaagcgcggg gcgccgcgcc
   133801 tctccctccc gcttcccccc tcgccgccgg ccccttcccc gtttccccgt ttccctttcc
   133861 ccccttcccc gtctgttcct tcccccgctt ccccgtttct tcttctttcc cccccgtccc
   133921 ctcttccttc cccacacgcc ccgctctccc acgccgcggc cgcggggggc cgaagcggac
   133981 gcggaagaag acgcggaaga agagagagag agaaagaggg gggccggcgg ggatggggaa
   134041 gaaggcccga cccgcgcggg gggccccctc ctgtcgcctg tcgttggaat gaaaccttcc
   134101 cccgagcgac cccgctcccg cctgtggtgc cgtgtttttt tcccgcgacg gggagagcgc
   134161 gagagtgagg ctgttggctg tgggttgtcg gctgttggcc gttggccgag gacgacgggg
   134221 agggggggat gctgccgcgg gtggcatgag acggaggggg cgagggcggg cggtggaggg
   134281 gggagaggaa ggtctgggcg cgtgccgcgg gccgagtgtc gggcgagtgc gaggcgggtc
   134341 gggggcgggg aggaagggag gtgtgggggg atggccggcc ggcgcccccg gagcacgcgg
   134401 ggcgccccgg cgggcgggag ggggtccggg ggaagggtgg ggcggtggcg gcggccatcg
   134461 cccgaccctt ccccggggcg cgcgcgcgtg ggaccgggac cgggacaggg ggcgggggcg
   134521 gggagaggag aggaggagag gagacggagg agagtcggaa agtcgggcgg aggacagagg
   134581 cggagagggc gagcgagaca cgcacgggga gaggcgcgcg cacacacgcg gagagagaga
   134641 ggagaggcga gagaggagga gaaggaggag gcgaactggg ggaaaggcga gacacgcccg
   134701 ggcacccccc tcctcggacc gaggcgacgg cggagacgga gacggagaga ccgcccgccc
   134761 ggccaccacc gtcggtaccg gtatcgccag taacacccgc accaccgaca cccgcacagg
   134821 accctcacac ccgcaccggc ccccatactc gcaccggccc tcacacccac ccacccacac
   134881 gcacgctctc tctcgcacac cccccacatc acactctccc cgcgcacaga cacacagacg
   134941 acaccctccc cgcccgcccc gtccgaccga ccatccgtcc tcccgaccct ccacgagaga
   135001 gagcgagcct tccctacaca cacacacaca cacagcaaaa attgaccccc cccatcccgg
   135061 acccccccgg gggcgggggc ctcgcgcctc cgcgtccggc gggcgcgatc gaggcccgcg
   135121 cgccccgggg gctcggggcg ggacgcggcg cccgcgcggg gacactcttt cccccggagg
   135181 ggcgtcccgg cgcgccggcc cggccctccc cgccgggaag gggacccggc cctcttcgtc
   135241 tcccggagcg cccccggggt cccggcccga ggtccatttt gggccccgcc cctttgcacc
   135301 cgccccccca ccgggcgggg tccgcgctcc gacccccccc ctccccctct gccacgcccc
   135361 gccacgcccc gtcgccatct tggctcccct ccccccaact ccctctctcc cgacgaggcc
   135421 gagccggtct cgcgccccct cccgcccgcc cgaggtaccg cggaaggacg acacgagccg
   135481 gaagacggtg caacgagaac aacttttatt ttttttttca ctctggggcg tgtctcgtgg
   135541 ggtgggaggg gggaccggga gagagagata gaggggtggg ggagaggagg gggtgggtgg
   135601 gcgacaaaag tatccaaggc gtggctgtcc ggctccttcc ttccgggtcc gggcgggtcc
   135661 gggctcgagg ttcgggtccg gttctcccgc cccggcgtcg cttcccggtt cgggtccggt
   135721 cgccggtccc cggtccgacg gcggttccgc tcgtctctcc gaccggctgg ggcgccctcg
   135781 gagcgcgcgc cgagcgcgag gcgcgggtgg ggcgaccgcg ggggtcgcgg gagggtctcg
   135841 ggggtctcag gggtctcgag gagggggaaa cgggggtctc ggggtctcgc gagtggcagg
   135901 gggaggcggt gataccacca cacaacacag agaccaccac acaacacaga gaccaccaca
   135961 caacacagag accaccacac aacacagaga ccaccacaca acacagagac caccacacaa
   136021 cacagagacc accacacaac acagagacca ccacacaaca cagagaccac cacacaacac
   136081 agagaccacc acacaacaca gagaccacca caacacatgc ggaccacgtg cagacacacg
   136141 gaagcttgca ccgtgaggcc ccattggccg agggcggcca cgtggggcga gcatgcaaat
   136201 gacgtgcaca cggaagcttc cccgaaaatc atctgattgg ctcgctagca ccacgggggt
   136261 gggtcgcgtg ccgagcatgc gcctcgcgcc cgcgcgaggg attttcggac aatctcattg
   136321 gcgcgccgcg gccaagatgg ccgcagagcg ggccgggcat gcaaatcaga ggcgcgcggg
   136381 agacgcctcc gcgcgcccat tggcccgggc gagccgagat ggccgccgcg ggggccggac
   136441 atgcaaagta gacgcgagag gaagtaggga gagaaatccc attggccgtc gaggggccaa
   136501 gatggcgccc tcggggccgg acatgcaaag tagacgcgag aggaagtggg cgagagaaat
   136561 cccattggcc gtcgatgggg caagatggcc gccgcggggg ccgggcatgc aaatggtcct
   136621 cgcgaggaag ttcctcgcga aatcccattg gccggcggcc gccatcttgg gccgggcatg
   136681 caaagcagac ggcagaggaa gcgggcgaga aaaatcccat tggccggccg tcggggaagt
   136741 ccgcggcgaa aatcggccat tggtccgctt acctgggggc gggctctcct cggggcgctt
   136801 ataagcgcgg tctccatcgt agcacttcac tgcggtgcag gtacggacag catcgttctc
   136861 tgccaacccg aggggatccg accgtctccg ctccggcgcg gactctgaag actccggctc
   136921 tccggcggct atcagccctc gacggacgcc cgacccaccg aggctctcgg cccgccagag
   136981 aagagtcttc ttcttctcct cctccggccg ccttcctcct tcttctccgc cgcccgctct
   137041 ccgcgctcgg cgcccggcct cgctcaggca gaaagacccc gatcgagacc atggccgacg
   137101 atctctttga cttcatcgag accgagggca acttcagcca gctcctggcg gccgccgccg
   137161 cggccgagga agagggcatc gcgtccggcc ccgacggcgg cagccagggc tcccggcgcc
   137221 gcggctcctc cggcgaggat ctcctcttcg gcccgggcgg cctcttctcc gacgacgccg
   137281 ccgaggccga ggccgccgtc ctcgcggccg cggccggagc cacgaggccg ccccgtcctc
   137341 cttcggccca gcagcagcag cagccccgcc ggggctcggg cgagatcgtg gtgctagacg
   137401 acgaagacga ggaggaggac gagcccgggt ccccggccgc cgggtccccc ggtcgggctc
   137461 tccatcaggg ctccgagcac ggtcacctcg tcctcgggcc ccggtcccgg gccggctccg
   137521 ggccccggcc gccgaccccg gcagcactcg cagcggcaga ggccggggcc cccggcggcc
   137581 ccgggcgctc gtccccctcc gcagcctccc cggcctcctc ctccggctct cccggcccct
   137641 cggcagcccc gcggagatgg tcccccgcga ggggggaccc ggtcggtgag cccgggccgg
   137701 cggcgcggcc tcggaccccg gcgccaccag cacagccagc agcggtggcc gcagcgccgg
   137761 cacggcgggg gcccgcttcc ccagcctccc ccgccgccgg gccggtctcg gcgcccggcg
   137821 gcggcggcgc cccctccgcc ggaggggacc gcggtcgtca ccatcaccag caccgcgagc
   137881 ccctgctcga cgagcccgcc gccgcgaggc ggctcgatcc tcggccgctt ggcgcccgga
   137941 gccccgtctc ctccaacccc aactccaact ccaactccac caccaccgtc gccgtcgaga
   138001 ccgtcgcccg cggccccgag aaggacgagg acggactcgg cctcgccggg gacggcgggg
   138061 cgcccccgca gagacagccc cgccggcgcc gcgccggaga gggcgccctc cgccgcggcc
   138121 gcggcttcag cagctccagc agcagcggca gcgactcgga cctctccccg gcccgctcgc
   138181 cctccgcccc ccgggccccc gccgccgccg cgcggcgctc ggcctcctcc tcgtcctcgt
   138241 cctcctcgtc ctcctcgtcc tcctcgtcct cgtcctcctc cgagggagaa gaagacgaag
   138301 gagtccggcc cggcgcccca ctcgcccgcg ccgggccgcc accgtctccg ccggcgcccg
   138361 ccgcggcccc gcggccctcg gcctcctccg cctcctcctc cgccgcggcc tccccggccc
   138421 cggccccgga gcccgcccgg cccccgcgca ggaagcgccg ctccaccaac aaccacctct
   138481 cgctcatggc cgacgggccc ccgccgaccg acgggccgct gctcaccccg ctcggggagc
   138541 cctggcccgg ctccgaccct ccggccgacg gccgcgtccg ctacggcggc gccggggact
   138601 cccgcgaggg gctctgggac gaggacgacg tccgccaggc cgcggcccgc taccgcgccg
   138661 cggccgggcc cgtgcccgtc ttcatcccgg agatggggga ctcgaggaag cagcacgagg
   138721 ccctcgtgcg cctcatctac agcggggccg ccggcgaggc catgtcctgg ctgcagaacc
   138781 cgcggatgca ggcccccgac cagcgcttca accagttctg ccagcgccgg gtccacgcgc
   138841 cccacggcca cggctccttc atcaccggca gcgtgacccc gccgctgccg cacatcgggg
   138901 acgccatggc cgcccaggac ccgctctggg ccctgccgca cgcggtgagc gccgtggcca
   138961 tgagccgccg ctacgatcgc acccagaaga ccttcatcct gcagagcctc cgccgggcct
   139021 acgccgacat ggcctacccg ggccgcgccg cggacccccg cgccggggag gcgaccgtcg
   139081 aggccctctg cgcccgcgtc cgcgccgcct tcgccgccgc gcagcccggc cgcgtgcccc
   139141 gcgagctggc ggacgcctgc gtcctggcct gccgcggcgt cctcgagcgc ctgctgccct
   139201 gcccgctccg gctgcccgcg cccgcccgcg ccccggccgc cctcgggccc gcctgcctcg
   139261 aggaggtgac ggccgcgctg ctcgcgctcc gcgacgcgat ccccggggcc ggcccggccg
   139321 agcggcggca ggccgcggac tctgtcgccc tcgtcgcccg caccgtggcg ccgctggtgc
   139381 gctacagcgt ggacggggcc cgcgcccgcg aggccgcctg gacctacgcc gcggccctct
   139441 tcgccccggc caacgtggcc gcggcccggc tcgccgaggc cgccgcgcgg cccgggcccg
   139501 cggagcccgc gcccggcctg cccccgctct ggcccgagca gcccggcctc gtcgtcccag
   139561 cgccggcgcc ggcggcggcg ggcgccccct ccggcctccc cggctccggg ccctccagcc
   139621 ccgccagcac caagtccagc tccagcacca agtccagctc cagcaccaag tccggcctct
   139681 ccggctcctc cggctacgcc agctcccccg ccgccggccc ggacccagcg cccgagcggc
   139741 gcaagaagaa gcgccgcgcg cccggggccc gccgccccgg ggacggcgag gaggacgagg
   139801 ggctctccgg cgcggccctc cgcggggacg gccacggcca ccgcgacgac gaagaggacc
   139861 gggggccccg gcgcaagcgc cgctccctcg gactcgggcc cgctccggac cccgctcccg
   139921 cgctgctgtc ctcctcctcc tcctcctccg aggacgaccg gctccggcgc ccgctcgggc
   139981 ccatgcccga gcaccccgcg cccgacggcg gcttccgccg cgtcccggcc ggcgagaccc
   140041 acacgccgcg gccctccgag gcggccctcg ccgcctactg cccgcccgag gtggcccgcg
   140101 ccctcgtgga ccaggaggtc ttccccgaac tctggcgccc ggcgctcacc ttcgacccgg
   140161 ccgccctggc gcacatcgcc gcgcgccgcg gcgccccgct ccgccgccgc gccgcctgga
   140221 tgcggcagat agccgacccc gaggacgtgc gcgtggtggt gctctacgac ccgctgcccc
   140281 acgaggagct ctgcgccgag cccgccgagg gcgccccgcg cccggcctgg gacccgcgcc
   140341 gcggcggcct ctcggcgctg ctcgccgcct tcgcccaccg cctctgcacg ccggactcgc
   140401 acgcctgggc cgggaactgg accgggcgcc ccgacatcgg ccgcctcaac gcccaggggg
   140461 tgctgctgct ctcggcgcgg gacctcggct tcgccggcgc cgtggagtac ctctgctcgc
   140521 ggctcggcgc ggcgcggcgc cggctcatcg tgctggacac catcgaggac tggcccgcgg
   140581 acggcccggc cgtgggggac taccacgtct acgtccgcgt ccgcctggac ccggccgccc
   140641 agtgcgccgt gcgctggccc gggtgccgcg agctccgcgc ggccgtgctg gactctagct
   140701 ccatcgtggg cccggcctgc ttcgcccgcg tggaggcctc cttcgcccgc ctgcaccccg
   140761 gggccgagcc gctgcgcctc tgccgccagg acaacgtgcg ctacacggtg agcacccgcg
   140821 ccgggccccg gaccccggtc ccgctgccgc cgcgcgccta ccgccagcgc gtgctcccca
   140881 ccgtggacgg ctgcaaggac atggcccgcc agcgctccgc gctcgggctc ggggacccgg
   140941 actttgacgc gggcgccgcc ttcgggcacc gcgcggccaa ccgctggggg ctcggcgccc
   141001 cgctgcggcc cgtcttcgtc tcctgcggcc gccggggcct cgccgagctc cgcggccccg
   141061 agggcctgcc ggccgagttg cgcgccttct gcgccgcggc gctgctggag cccgacgccg
   141121 aggccgcccc gctggtgctg accccgggcg ccgtcgccgc cgcgggcgcc ccgccggccg
   141181 tgctctggga ctttgccccc ttcgagacca gcgtccgcgc cgccgccggg ggcgccgtgg
   141241 agacccaccg gcccgcgggg gcctcgggcg ccggggccgg ccccggcgag gacggggact
   141301 ctgtggagat cgtcggcgtc cgcggcggcg acggccggcc ccgcggcccg ctcgggccca
   141361 tcaaggtgga ggccatctcg gacgacgagg aggccgagga cgccggcaac ccctacctgc
   141421 tgctccgctg agcggggcgc cccctcggcc cggccggact ctgactctga ctctccggcc
   141481 cctccaccgg ctcctcgagg cccttctcct ccgtcttctc tcccctcgcc ctcggcccgg
   141541 tcctcgtcct cgtcctcgtc cccgtccccg tcctcctcct cctctgcgtc cgcggcggcg
   141601 gcctcggtcc cctcggcccg gcggcgcttg cctccccggc gcctgcctcc ccggcccggt
   141661 ggccctcctc ctctccttct cctccgcgcg gatcccccgg ccggaggtgg ctgcggcggc
   141721 ggcggaggtg gcggcggtgg tggaagcggc ggcggcggcc gcggcggagg gctcggcggc
   141781 ggaggatcgt cccggtcccc ttctcctcct cccgcggtcc cccggtcccc ttctcctcct
   141841 tctcccatcg ggtgagaaaa gagtttgttt tcagagtgag aaaataaagt ttgtgctgta
   141901 ttttctgaac cagctcgagt ctctgagatt ttttggggag atggaggcgg ccatcttggc
   141961 ggtggtctct ggggtggagg tggtcttgtg gatgggggtc cctggtggga ggaagaagaa
   142021 gaggtggagg gtcttggtgg gggtgacggg ggtcctcctc ctggagggtc ttggtggtgg
   142081 tgatgggaag aagtggatgg gggtcctcct cctggagggt cttggtggtg gtgggtctta
   142141 gcagatgggg ggtccctggt gggtcttagc agatgggggt cctcctcctg gagggtcttg
   142201 gtgggaagaa gtagagggtc ttggggatgt tgggggtcct tgatggtggt ggtggtggtg
   142261 gtgggaggtg gacggtgttg gtggtcccgg cgggtcctgg tgggaggtag atggtcccga
   142321 gggtcccggt ggtcccgggc gggagttgga cgatggtggt cctgcggtgg tcgagggggg
   142381 tgggggggga aagagagaaa gagagaaaaa aacacggtgg tggtcagtac agggaactgc
   142441 cgttgcaacc atcgcccact ggtggtgata gtagtaaagt gtgtgcgtga gggggggggg
   142501 ggggggtggt ggtggtgttg ttggtggtgg tggtcccggg tggtcgtcgt ggaggggagg
   142561 gaaaggcggt gggagagcgg gcggaacagg ttcatctggc ttccgtcttc cgtccccact
   142621 cccagcctcc cccgctgcca ccgattggcc ggcgggacga tgacgacggc gaccgcgtgg
   142681 cgcgagggga gccaatgggg cgggcgccgc ggagcggaag cccccgcccg cggacccccg
   142741 gtgcgacgga aggggcaggc tcggcgcgcc gatgcgatcc gcggagcccg ccccggccgc
   142801 gccccggaag ccggcgtcac gtccggggga agcggaaggg gccggcgcga tatgcagatg
   142861 agatccgtgg ggaccggcgt cacgtccggg ggaagcggaa ggggccggcg cgatatgcag
   142921 atgagatccg tggggaccgg cgtcacgtcc ggcggaagtt gcgcgcggga agcgtcatac
   142981 gcaaatgagg cggaagtcgt catcggcaaa aacgtcacgt ccgggaagcg tcatatgcaa
   143041 atgggggggg gggggaggag cccggcgtca cgtccgggga agcggtcata tttaaatgag
   143101 gggggagggg ttatgcagat tagggggagg ggttatgcag attaggggga ggggttatgc
   143161 agattagggg gaggggttat gcagattagg gggaggggtt atgcagatta gggggagggg
   143221 ttatgctaat ttatgcaaat gaaggggcgg ggctatgcaa atgtatgcaa atgagggggt
   143281 ggggttatgc agatcagggg gaggggttat gcaaatgcat gcaaatgagg gggaggggcc
   143341 atgctaattt atgcaaatga gggggcgggg ctatgcaaat gtatgcaaat ttatgcaaat
   143401 tagccccccc cctttaagcc ccgccccctt ttttcgcggc ccccggggag cggggggtgg
   143461 g
//

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH