NCBI Nucleotide banner
My NCBI
[Sign In]  [Register]
PubMed Nucleotide Protein Genome Structure PMC Taxonomy OMIM Books
 Search  for    
  Limits Preview/Index History Clipboard Details
 Display   Show    Hide:     
  Range: from   to  Features:  
1:  NC_006623Reports  Gallid herpesviru...[gi:57790931] Links
LOCUS       NC_006623             148687 bp    DNA     linear   VRL 30-MAR-2006
DEFINITION  Gallid herpesvirus 1, complete genome.
ACCESSION   NC_006623
VERSION     NC_006623.1  GI:57790931
KEYWORDS    .
SOURCE      Gallid herpesvirus 1 (Infectious laryngotracheitis virus)
  ORGANISM  Gallid herpesvirus 1
            Viruses; dsDNA viruses, no RNA stage; Herpesviridae;
            Alphaherpesvirinae; Iltovirus.
REFERENCE   1  (bases 1 to 148687)
  AUTHORS   Thureen,D.R. and Keeler,C.L. Jr.
  TITLE     Psittacid Herpesvirus 1 and Infectious Laryngotracheitis Virus:
            Comparative Analysis of Two Avian Alpha Herpesviruses
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 148687)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (14-JAN-2005) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 148687)
  AUTHORS   Thureen,D.R. and Keeler,C.L. Jr.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JAN-2005) Department of Animal and Food Sciences,
            University of Delaware, 531 South College Ave., Newark, DE 19714,
            USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from U80762,
            AJ249803, Y14300, D00565, X56093, AY033142, AF168792, AY033143,
            U06635, Y14301, AJ131832, X97256, U28832 and L32139.
            This record has been assembled from pre-existing records as
            follows:  U80762 Johnson et.al., 1995; AJ249803 Johnson et.al.,
            1997; Y14300 Ziemann et.al., 1998; D00565 Griffin and Boursnell,
            1990; X56093 Poulsen et.al., 1991; AY033142 Kehu et.al., 2001;
            AF168792 Johnson, 1999; AY033143 Kehu et.al., 2001 439; Keeler and
            Kingsley, 1994; Y14301 Ziemann et.al., 1998; AJ131832 Fuchs and
            Mettenleiter, 1999; X97256 Fuchs and Mettenleiter, 1996; L32139
            Johnson et.al., 1995; U28832 Wild et.al., 1996.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..148687
                     /organism="Gallid herpesvirus 1"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:10386"
                     /synonym="Infectious laryngotracheitis virus"
     gene            complement(10784..12046)
                     /locus_tag="GaHV1gp01"
                     /db_xref="GeneID:3239072"
     CDS             complement(10784..12046)
                     /locus_tag="GaHV1gp01"
                     /note="UL54-like"
                     /codon_start=1
                     /product="IE protein ICP27"
                     /protein_id="YP_182336.1"
                     /db_xref="GI:57790932"
                     /db_xref="GeneID:3239072"
                     /translation="MARPRSRYENQSGMSVRSSIRRVSSPRNKFMRGRAHIQVRRGIP
                     PRPRRRAGTPEKRYRAPIFTVSLKHSRRSWERNRDELRRPIWRDFVRCPTSSRTETKE
                     LRNVTPAQYFEKAATAFGGLGKCITEELRLENQKCLLDMVNRAVDDDDCDDIDRDRGI
                     CFPAFLSSGSSDLAADAAFTSWKQFCGRAASLKGRWTSRPDIARLAKISRAVYLANCS
                     FEELLFACDETLVWMLWHQFEDERIYPHDPIFSNIYCACQSLAMHLGPILPCYLSSIG
                     SQLRDTTRSQELSLSSAKCPLTLLLTFFDRFSRIVYPRSEAIVMNHKAIDPARTLWDM
                     YYPGTCSKKIPLVLRSTQMCAAKRNAEWFVRSSKPQYTVGKFSLATCLTVLYTYRHMA
                     VLYWNWCHPTFLKIAISVTGQQMAPRAQ"
     gene            complement(12852..13865)
                     /locus_tag="GaHV1gp02"
                     /db_xref="GeneID:3239068"
     CDS             complement(12852..13865)
                     /locus_tag="GaHV1gp02"
                     /note="UL53-like"
                     /codon_start=1
                     /product="glycoprotein K"
                     /protein_id="YP_182337.1"
                     /db_xref="GI:57790933"
                     /db_xref="GeneID:3239068"
                     /translation="MLRPECLKWAVILTGTIHIVFLVWYVCSKISTDSKDDCLYVLAN
                     IKWLLPGQQEFNPVHQPPATFNSSLVYVLTKYTQRLNNYENHQTRCVKGAYFENETVL
                     ISRLIPLAKEQYSSWKWQTVSLHMVFPDQSCISTVIVHMLLADPCQRRMFGSVCRENA
                     LRLDAYHLNYWTAFTSRLILRVPYTKMQRFLREFEHVRDCKSLNYVADPLGFCICNPG
                     VLVLKTLEIGLYLASLIMSTMTLRICYDPCAYILHEHVKISAWVYVIVSAVLELLSLM
                     GYTTPAKTKVSASKPPSILTSCLANIASSLVLRALCVAAIASIVIIAFKYEQKIQNKL
                     FGP"
     gene            complement(13844..17176)
                     /locus_tag="GaHV1gp03"
                     /db_xref="GeneID:3239094"
     CDS             complement(13844..17176)
                     /locus_tag="GaHV1gp03"
                     /note="UL52-like"
                     /codon_start=1
                     /product="DNA helicase primase component"
                     /protein_id="YP_182338.1"
                     /db_xref="GI:57790934"
                     /db_xref="GeneID:3239094"
                     /translation="MNFDCVPDAKWEYEADDWMLVEMLNETETSQAGYCEPCGAPPSE
                     DVSYEEIRVLYATDGYPVVCSLHLLLGQALQPEIYVLAFSHVDALAQDFCKDSPLKIT
                     FFLPANTGAEKYRQRSRPVFVCRFVGQGAATMREALAEGFPIDAKLLLETMDLEETFA
                     LHTDIIEALGVIFRAENTTNKIPFSAIHATLPRGRPALEGLMLQHESRVIAAYRRLYN
                     SNFSNPFWFVSKFGPSEITLVAAMRYYLLEATPDDGIAGTFDLQAVKDLCITFQTENS
                     NNRSNLTIARLTSFSAFSKFWCSSYYATRESAKLFRDHLRLRTSADRGYSEQLEALIC
                     KYRHALRLPARDFISFVYLAYSEGYGRNVIREHLQCLSENLTNPVKSSARAQSDFFKS
                     LRECCNFASYFRQHVTMQVMKLPAVVAGKFAAIKSYGEIQGRNFLGFCRSAFDVSTRI
                     DRLYSDTLCRYGAHLADMLVRNVSTVSSNEQEEEEEEEEEEGDDASAPHALAQKRERD
                     GQYCKTGDIIFAPLSRLLSLVSSDQVICGKRPVTLLFHSLKPTSIPPPTARNGPCPVY
                     RVTLAGHGQAFAAIASDEWDSIITADVRSDTSIHDSCLLMRSDAPLADQAMLPVIDFA
                     WTSAMNETAWGTSSKNKIRASCSGLSQMYLNRNEVLNESLAIQSLILDIDIPLKLDHG
                     PITMLTLHKAMRAVRVALIQLIALLFPETSISHDTYPVYFYKSHCSSPESHDAQYSSV
                     DIDFLENTCSDDIEDEENMYLCDSGWVEEMSWCDEHASEHGAIVSVQDLQDALNVFRD
                     RANSTLCKCKEKLGFRVCVPIPSPYALFGLETVKTIAKLAQHVILLQEEIIECLDDVI
                     RDYDFIDTGIYSPGRSLRLPFFAKVSESGFMSGRLLPFIIFPPDCADKVAFAAAHKDP
                     NNFHFHAFRPDNPTPNIIVTRIACPPDVIGGVSKPSSNLPQTAVSLSLAEAFSRVNLA
                     PCEDRTGAGVDTIDGVFVLTTYVLPAITNYIKEHFPSLAHEYSDISFGDVRVLKTRIT
                     ASLLRNRRGCGGRATFTCLKHSHRSAAAQTVITSVAVAINSQGNPYAAFQTKCFATKC
                     GGNTLQTQFTVRLTKECCDQNV"
     gene            17189..17878
                     /locus_tag="GaHV1gp04"
                     /db_xref="GeneID:3239095"
     CDS             17189..17878
                     /locus_tag="GaHV1gp04"
                     /note="UL51-like"
                     /codon_start=1
                     /product="virion associated phosphoprotein"
                     /protein_id="YP_182339.1"
                     /db_xref="GI:57790935"
                     /db_xref="GeneID:3239095"
                     /translation="MWQLLKSVFCGRSNSESKYEALPTGRCLPVDDRKVQSAVKLIKI
                     FIPNCLDVEDVIGSRDELNKLAQARQISRILAKSAAAMQIAKNMRCPRGAEAVLRQTI
                     VDNGTVFRSLYSVLAYLYLSPGADTDGLLAQVTAQTADRTMMLGDMTVLTHAMHVDGM
                     DRDHSSLELLRMGLVPNSDLKDPIELVPVIDKLPDKVLFPDPVPTLPVENPPMERTRP
                     AKTRKELVAAS"
     gene            complement(17932..19182)
                     /locus_tag="GaHV1gp05"
                     /db_xref="GeneID:3239078"
     CDS             complement(17932..19182)
                     /locus_tag="GaHV1gp05"
                     /note="UL50-like"
                     /codon_start=1
                     /product="dUTPase"
                     /protein_id="YP_182340.1"
                     /db_xref="GI:57790936"
                     /db_xref="GeneID:3239078"
                     /translation="MEMEMTTEKNALIEIGSGWDIFGLDSLQCVITNVEATIAKTRTD
                     SPVLRIDSAIRTSLPVGYGIVISDVEGHAACYQIIPGLVDADYTGLLGILVVLVNDGG
                     NVLTGTETRDGNVIFPPGTVRARLNVIKLANDSMLSKCGTGYARLLLETADSFQGEDD
                     YLGEGFEKCISSLLSIPPDILRAKITIPGNIGCMGCTTFYRRTFEELQEQDAACNERI
                     VILNGATPENINRFCGASNIKFVAQVRHHIIVGATRSLVKDQTVELRSDPDCPAALFP
                     FNEIFAPKRPGDGGYDIRATKDVTILPKSSTRITLPQKLACGPFWRAFILGRSSMNLK
                     GLLVDPIHVQDNDWISFSLTNIRDEAASIHAGDRVAQLIVTEKRSTFLGEPDALRWKI
                     VNSVVDERNTLSVRGDGGFGSTGK"
     gene            19336..19689
                     /locus_tag="GaHV1gp06"
                     /db_xref="GeneID:3239079"
     CDS             19336..19689
                     /locus_tag="GaHV1gp06"
                     /note="UL49.5-like"
                     /codon_start=1
                     /product="homolog to glycoprotein N of HVT"
                     /protein_id="YP_182341.1"
                     /db_xref="GI:57790937"
                     /db_xref="GeneID:3239079"
                     /translation="MRLPWERSFMLLGAVVYLLHLALVFAQPGVTPGHGMEHGYYGLG
                     AGNMLGAENSMYSANMEHFYHSACSSRGFSLVNGTAASVFFFISLAVALIGLLAVLYN
                     GCFNSFKSSVISSRW"
     gene            19749..20549
                     /locus_tag="GaHV1gp07"
                     /db_xref="GeneID:3239080"
     CDS             19749..20549
                     /locus_tag="GaHV1gp07"
                     /note="UL49-like"
                     /codon_start=1
                     /product="VP22 tegument protein"
                     /protein_id="YP_182342.1"
                     /db_xref="GI:57790938"
                     /db_xref="GeneID:3239080"
                     /translation="MSYYKDLSEEAKKYHDDTRRRRDTTTRRPKPPQFEHPWSGRRTS
                     PYLDLDRGSDSDSSEGDYGHPSRAHYSRDHTAPPQGRRSPPMESFRKETTPKEEPPQS
                     KRGWNPDNHCAGLMRRLTISKGFGPSATPSGDEDPWHTSTIPANRSAFVQAVSVTAMA
                     QAELAAREVWDVTKPRTNRELRDMVRELEITIIINPGESLWSVATSVARAIKEGTPIT
                     HELLQKRPSKPPTRRKTEDGARKSSSRPSQPKPEHFPPPRRKTSERKY"
     gene            20695..21885
                     /locus_tag="GaHV1gp08"
                     /db_xref="GeneID:3239081"
     CDS             20695..21885
                     /locus_tag="GaHV1gp08"
                     /note="UL48-like"
                     /codon_start=1
                     /product="alpha-TIF"
                     /protein_id="YP_182343.1"
                     /db_xref="GI:57790939"
                     /db_xref="GeneID:3239081"
                     /translation="MEEESSTGAFALYEVEDFIEEVESGAGGRCSDFEDDATDLIELE
                     DLYFDWLRNPGPPALVNAPKYVRPSKCSASFLAKNALTELQFADWDKIQHVLKTINID
                     IFSCVPVGENGLCNMDWFSLDTEKIWTLMDSGTPNVSPNLLITPGPPPECIKTPEEAP
                     AYFEAISNYFESVLAAREAEYAKLLAEYAKSLAKYIRHKSQKVGRGLRALELDTEEAK
                     KRFTVLMKSEYYKGIEKLLIIFLVHLVLNACRDVARIIWVQQRDSSSVLQKVTYRWES
                     QQLHCIFQPLLVSPGPVFLDNDPLPLQTLQHVNYVRYLLGVPVLRFSMIEESPSAQYI
                     PYDKTAPSAYDVLATIARTCLTSSGCSRASHDHTYARDNEKPNYSSSRIVLLADSALD
                     TPMP"
     gene            21888..23561
                     /locus_tag="GaHV1gp09"
                     /db_xref="GeneID:3239046"
     CDS             21888..23561
                     /locus_tag="GaHV1gp09"
                     /note="UL46-like"
                     /codon_start=1
                     /product="VP11-12 tegument protein"
                     /protein_id="YP_182344.1"
                     /db_xref="GI:57790940"
                     /db_xref="GeneID:3239046"
                     /translation="MTAQAIKQMDWPDNIIAAMAEGDGFEERLRAKARCHQMKRTPIG
                     LLQVILDGARKIDPKRILDNSSPSDLAVLAERELPSSLLGPAREEYLKFGDKKLPDNF
                     ISRTVSNDTTDEYRRNLDEAFKLFIARRGVTEKCVARMLRHLYAKRLSVVLDLDVPFG
                     EKINKALSADDQDFVLKLYYWVFPDKVSAPRLKEPEMQAYLASVTYLSCTFKFIEGYA
                     YYMRPPGPELHSTETTARLAALLVYVRSMYCKLASLFDAIDAAVLRSKFNRGASAQAL
                     TGIYGYTRNGKGTIMSRYSSEAMSDEIMSVCRTGSDTLIESLRKALGRLTYLIARWEL
                     ISVEKKRDAKEAVTAALALSGLVSGHLGYLLNLISMAYVFWLPGHYLNMRLILALSSR
                     ELLSHLLATNPSSLREVASCPKILFYQSVEEWRGQERGTQIWLDYVTVRAWLDYIDTG
                     IPTIRSEETNASINEISEYLEQRRSASPTESFLSSDGPPNSSAASLPPTQGSMQTQNR
                     RRERRSNSVVIRKPSRSAHSKSNTIPVFQETTISYSAPNSPADHYVVMN"
     gene            complement(23660..24505)
                     /locus_tag="GaHV1gp10"
                     /db_xref="GeneID:3239047"
     CDS             complement(23660..24505)
                     /locus_tag="GaHV1gp10"
                     /note="UL49-like"
                     /codon_start=1
                     /product="VP22 membrane protein"
                     /protein_id="YP_182345.1"
                     /db_xref="GI:57790941"
                     /db_xref="GeneID:3239047"
                     /translation="MPEIAAGQSLPVILQPSSEDQRSYLNPPIISQTPSEDQRSHLEK
                     MMAELPFEVRAILEDEPSVCSSTSSSTTSTYSPHPSGELHSMRPENTGGQYWKACKVI
                     LLILLGIFLGLLIFMFVISTVMAFALPNSTWEGGLCPPDWIQHLDSCYRAGGGPPQDT
                     YENAKLSCRALGGKIASSSKAIGFLTILDRLFYWSGSTSPQGLWWADDGGKCANVYFI
                     NSIHDDSTASLSTQKMSVALVENLQCSGTAGVICYMSPAISPALRYIKALRVALSFGV
                     YEESK"
     gene            25278..26408
                     /locus_tag="GaHV1gp11"
                     /db_xref="GeneID:3239076"
     CDS             25278..26408
                     /locus_tag="GaHV1gp11"
                     /note="ORF A-like"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_182346.1"
                     /db_xref="GI:57790942"
                     /db_xref="GeneID:3239076"
                     /translation="MEGVTDTVLVLTERDRLALFGPILFRGGGLTAARWAVSVDAVLP
                     WTEKTIPPLKGSKLIIAGEPYLGLTSSDVLSKCEGKTFFVLIAVPAALGRWICAPPPP
                     LLESVAENVRCKISATLSKEHGAPFCTAVYILGSTTQVPPGSSLGWSCVGQPVLRAPL
                     KEATKPDESLQSAECVFKCPLFADEFSGNNPFAIGFLCALDKGVLKHELFAAIYAAKK
                     AISNASLDGTFCASFGDKEMKLESVSTHLGPAVVVTRGAITDFPPKNEFMDRLTCKRT
                     FLRKDGDFLLGSAFLMCKRQNRTSPVLRRWKRAWLRDRRRKHLMRRARVSVTAELGCR
                     ILSHPSRIASFGLEVTERDLNLQRRLSAHRPRARGVVYEDFD"
     gene            26448..27470
                     /locus_tag="GaHV1gp12"
                     /db_xref="GeneID:3239077"
     CDS             26448..27470
                     /locus_tag="GaHV1gp12"
                     /note="ORF B-like"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_182347.1"
                     /db_xref="GI:57790943"
                     /db_xref="GeneID:3239077"
                     /translation="MHALGIKYSAIFAVVRHTLYAPTSVVMEQRRDEKEAEEQKVSAI
                     ASAFLNVGQFFSRGQTNKSRPWVTSSETIKVSIYAWTRCRDSLLFSDYLFRRGTMDSA
                     RQQLQVGVPKKGGVYRQLSRDDGTVFEVSLDPAVCFEFSVTLILPGHDLFWPVVPPLQ
                     FLELISQRAVILADQFISSSIMKRVSLSPIMLFPKNTFMPGYWSPDPQPGRYRPKFQP
                     TRSEQHFMTVGKLVPPFQIDLHGKKNNFMAGIAVGFHGPPTLTGTIRALTEQAIHNAV
                     AEVVRTLEPMTVVPITLKNGTGALMGLTSDNKGLRILIKPALGELARSPRRRRSESRG
                     RESVLL"
     gene            complement(27525..28529)
                     /locus_tag="GaHV1gp13"
                     /db_xref="GeneID:3239041"
     CDS             complement(27525..28529)
                     /locus_tag="GaHV1gp13"
                     /note="ORF C-like"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_182348.1"
                     /db_xref="GI:57790944"
                     /db_xref="GeneID:3239041"
                     /translation="MGWLSKFMPFGRRKRFSRSEPQLHRLEISGPISPPLKPAPSLPS
                     VKNSHSGRSGWIRQTLRRKKDDEPQENAEITNQLLDSMVDKERHGNSIRQQRPTPSAQ
                     GPCWIFSNRSYHHISILPEHLPELFGKTSDEIQGIQSAFDHTGDPLFAPALQAILVEI
                     LGPRFLYEKRCKGASSPISLDIPIYFSGTCLTRRVRIGIFDAPIAFPEEFLGEQYFVP
                     YLRLWPKTFTRAESLSLPDALSAATYANLRWDRSYSILGNVSFYAAAMLSESGPTPDF
                     TTAGAQVIDSPYRFCSFLPGILVVLPQQQELCIPTMQNAVVVAREAIESCIMLPEGAV"
     gene            28639..29763
                     /locus_tag="GaHV1gp14"
                     /db_xref="GeneID:3239042"
     CDS             28639..29763
                     /locus_tag="GaHV1gp14"
                     /note="ORF D-like"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_182349.1"
                     /db_xref="GI:57790945"
                     /db_xref="GeneID:3239042"
                     /translation="MGRVLGVDIRHVPRRPPRTISADMSSMACSRFQKPKAKNDSSPE
                     KCERTAKQIVAASDYCNDSEKLEEEMVFVGAGKISYSSWMYEAIFSCDCIPDGSAFAV
                     AKHAVILNRVNGGLPSCLGSAHGLTIYPARTSQRGRFSRLAYRNDMSPAPQSENTVDV
                     DGELGACAIGVLEMGEEVWAHEEMFFLPVVPKLDRMWPCVPNPALFWGLARALNNLPP
                     KILVSGKLAKGFICPLYYLSVPTFGEESKETFLRTRQKQRSLYDPLFDPASLLVQPQF
                     FGCDGIKDSNNFQAGLGIVFQPQDGWTAKTKLLELDRVRSELVTLFARQEQSRPITVI
                     ITRGAVRRRLVFSTVGGFRFSSSFEPSGTPLKTHSVTLHI"
     gene            complement(29835..31067)
                     /locus_tag="GaHV1gp15"
                     /db_xref="GeneID:3239024"
     CDS             complement(29835..31067)
                     /locus_tag="GaHV1gp15"
                     /note="ORF E-like"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_182350.1"
                     /db_xref="GI:57790946"
                     /db_xref="GeneID:3239024"
                     /translation="MAPSKKQSQASKALSTSNRECRFAVTHCLANFVDSSHMELGTHR
                     GKLWTEKVEYGLAVLHGTASFFLDCNKDLTIHVFQDHDSKQPDNSQIRFVAAPLFEDP
                     QESLSNDTGIPSTAIIMTRTPYTTNSNLEIGVEQLLLAMKRASLKNFQRWQAVADSVH
                     SKNPMTFGAKYLPFKLLSADKWKDGVGFLMLGLISDLELSPVVAAVRAFSGALFFQSP
                     PSLTLSGEILDLKHGDSPHHSPVGLLQAAIFTGLRAYRSQIASPIITCREEWAFRIPF
                     CVAIGDSQIHPPRAQQTASIPKGTHILCAFFPVSGVLASDERSYLAVDTWASRATSWL
                     TGRGFTFWRALLEETPMCGKFLCAAICHAYDPPRLGILLHSHWTPDEIGDFKTAACTA
                     VSEAWKNMGIATRPDLFG"
     gene            complement(31125..33539)
                     /locus_tag="GaHV1gp16"
                     /db_xref="GeneID:3239025"
     CDS             complement(31125..33539)
                     /locus_tag="GaHV1gp16"
                     /note="UL22-like"
                     /codon_start=1
                     /product="glycoprotein H"
                     /protein_id="YP_182351.1"
                     /db_xref="GI:57790947"
                     /db_xref="GeneID:3239025"
                     /translation="MSFTHFLALYSFLLERAWLHQQPAPMGHAREIFFLILAILLRAK
                     GDDKAKAKIVFVPPTSENLAPPKEFIAIATAVENGHITQLCLVDRNLIFGPPGSANRN
                     LSIALDLLGQLYVAYTYSRWGSASEATIQPRKFSNDPKLEHRLLVGYKGNALTSAKLV
                     NFPPNNSVHRGESIIAPIRVIYSDPLQTVFPFVFTRYISLAVTSDIDLKINIGLNVAT
                     LIIATQHSPQIEMIITPTSAKVKETSLKSWPYMLKAEDQGLTVRINVAAGPNYRPNLF
                     TAVTTAAQDFLELASFDEQISAGHFLTLQKVAIAGCPNTIDESFFVRFAARFMAAWFR
                     FLKFTIDAYVTDSEIVEFIAETQTWADQVAVCFGGANSVNYTTNIRFIQNVGGALTSI
                     PSSILKIMHDRPWEPMIKNHNLLLTIMNAVLITAEQDPQNAFLASIDGVTPSQLALEI
                     IDNSYREIITQKVMTPAYRKLLAVSTYIILRAPQLSIQHGRNFLRRMTILCSVDRLAD
                     INEIHSQPDGSFKKGQASKIEEWFSPCAIATRFDISRSAPWKIILTASAPFRFFYTKI
                     YLSSEGELPSYSAPIPPQALLTPQILATAFFPEVKKCLNWDLEHHIVFFLPVTAHSSW
                     VMTSSPPSTGMTYRLPDTSTAAPLFVTFVNSSCNSLPQIARTAKMEDGHLNGRAKTCI
                     YCNHLIVQYGLRGFQDAFFIDSAYVQSELLAGANSSIAFFKSMNPEFYNYALLGPHGT
                     AVRILGLDRSIIVFDKAYIIGIVVGALVGLVALWSAIRAIYKFCLSSATQFRRVRLPS
                     DEESEL"
     gene            complement(33573..34667)
                     /locus_tag="GaHV1gp17"
                     /db_xref="GeneID:3239035"
     CDS             complement(33573..34667)
                     /locus_tag="GaHV1gp17"
                     /note="UL23-like"
                     /codon_start=1
                     /product="Thymidine kinase"
                     /protein_id="YP_182352.1"
                     /db_xref="GI:57790948"
                     /db_xref="GeneID:3239035"
                     /translation="MAVAGAVKTSGGVQFCSEFENDDSDFRRVVLLYVDGPFGVGKTV
                     TAKTLMQMPNWRGCRLYLAEPMQAWRQWFGGADMIKEINEIQTLKASGKLECREASPV
                     AVAEVQMTIAAPLRIMNHVIYNYLGSERCYSAAASGPDDVLFLVDRHPLAACLCFPVA
                     QYLSGALEFGDLITLLSGIPDIPTHSNIVLMDLDICEQARRIIQRGRPGETVDWTYLC
                     ALRNSYICLMNTTTYLQRTSYPALLKEQEALTSATLLKFKRECLETATVPEINPSIDQ
                     TLFAILAFDQQNVHGERLKTVLSFVVQKLATVLKNLCIFYLPAHGLTPEACALKCLEF
                     AETASSLTTKRAAIASLIDAVERYNADMGS"
     gene            34556..35419
                     /locus_tag="GaHV1gp18"
                     /db_xref="GeneID:3239036"
     CDS             34556..35419
                     /locus_tag="GaHV1gp18"
                     /note="UL24-like; multiple transcripts"
                     /codon_start=1
                     /product="putative membrane protein"
                     /protein_id="YP_182353.1"
                     /db_xref="GI:57790949"
                     /db_xref="GeneID:3239036"
                     /translation="MARRRKEVQRGESRSHRSRTRSKTAHHRKFSRRQLRPSLRARLN
                     AGIRCHNRFYRALVRSLEEVFEGGGDGRLAYTIIPQCKPAGGKIVVMFEVNLGLRKPD
                     CICLLETQHEMKCIVIELKTCRFSKSLMTESKLRQGYTGTLQLRDSARLLENLAVPGT
                     EKVKILSLLVFVAQRGMNILAVKTVGETVINVSSELFFVTLATRSQYLKTFCAKLEPR
                     VSHARSKYQQESAKNADLASPAPSALQTVAALFSSRVGKESATKPASYSTSTEESKNL
                     SEPCFDPDSNL"
     gene            35392..37110
                     /locus_tag="GaHV1gp19"
                     /db_xref="GeneID:3239021"
     CDS             35392..37110
                     /locus_tag="GaHV1gp19"
                     /note="UL25-like"
                     /codon_start=1
                     /product="DNA packaging protein"
                     /protein_id="YP_182354.1"
                     /db_xref="GI:57790950"
                     /db_xref="GeneID:3239021"
                     /translation="MFRPRFEPMNLPKDSNKPSTLMVLADRLNFISCAEGSSKYASKL
                     FEGTLIDAEIMTNRARIEDLERRNRAAKAALEQLENMSATVPVHVSSALQTIEYPLET
                     VIDVLDDLAQRAVQEKDIVGSYKTLDIRAPGEDVPANVIWIVKNGEPLTFNTDFQVDF
                     LTTSFAIAGNGRLGFGSWFRALQTQLLDNNKAIARVLNVMGDTRISGRFMKTAIRALR
                     SAMEIYAGTRQYSGFEATVLCLLHYSRSRQSASNIRHGLDVSIFEDALRHVPTYLNYM
                     LEDIRAEWGSVTFSFDRSKLPVNFFSPIDGRKYSNGVFDPHIVYQLLKRTGTLSTTVR
                     DITKETLLPIDPDFVRFDDPIAALSISFFPSRRTPLILHEDDPLVRTVIDSISLLLVL
                     QKLMFNSNVYTSTHLNRFQPSAFFELPLGTQSEQEAAKWPVAPGSRPQATASTFDDNG
                     QDMASRDNNLFFLFEKYVVPMYRYDNRCEVTGFFPGLAALCITGRVKGIPTAVRLGEY
                     YSSLCNLIELDLRKTSHVGSGAAAVLAVHDSLTGDVEEGVSRLLEVFDAKKAFERNIE
                     DIQRGV"
     gene            37288..39048
                     /locus_tag="GaHV1gp20"
                     /db_xref="GeneID:3239022"
     CDS             37288..39048
                     /locus_tag="GaHV1gp20"
                     /note="UL26-like"
                     /codon_start=1
                     /product="ICP35 maturational protease; capsid protein"
                     /protein_id="YP_182355.1"
                     /db_xref="GI:57790951"
                     /db_xref="GeneID:3239022"
                     /translation="MSENVDIKYIFVAGYLVVYDHQESAGREYELTREQSKSALPVLP
                     GTIPINIDHESSCVVGTVLTILDLPRGLFCLGVVSTALAPIFLSYVQDDALFANAEEG
                     MVLTETEKFLYLLSNILPSLSLSSRRLEKNEVPGKDFFAHVALCELGRREGTVAIYGA
                     TASEAIGAFDDLSAPIKEQLYEIATREKCAEVPRELSRPEITRVLMKKFIHGAFLMDR
                     GTCLKTRREMAAVYNPKYLQANEVITIGIKEHSEETPENAIKDRSVSTQTAPSFDISE
                     SQQPSGQTHVPAMESATCSGQFLQTKNGASPSASREDMVYVPFEKYASLLAASARRDN
                     DRRPVSPSREFSRRSRDSTHECSPGRDIWPRGFERHPRLESFMGPGMNHTYRPALYED
                     PNFCGRFPYIPYQSPASTYPVHPNYYSSNFGQFPGAGTYPIQYPSLHEQTVVSRLDAL
                     ISALEKNNKRDSEYSENNPRKRSARTISENDPYFPGEMVPAKKITTEQQLCEKKEPVG
                     SGINDILQGILTLQKEVAGLKSASNADSSSERKEELENSNQESARETVDASMPKRLKD
                     AQTKLKRKKEAAAFAQMMAD"
     gene            complement(39096..41747)
                     /locus_tag="GaHV1gp21"
                     /db_xref="GeneID:3239023"
     CDS             complement(39096..41747)
                     /locus_tag="GaHV1gp21"
                     /note="UL27-like"
                     /codon_start=1
                     /product="glycoprotein B"
                     /protein_id="YP_182356.1"
                     /db_xref="GI:57790952"
                     /db_xref="GeneID:3239023"
                     /translation="MQSYIAVNIDMASLKMLICVCVAILIPSTLSQDSHGIAGIIDPR
                     DTASMDVGKISFSEAIGSGAPKEPQIRNRIFACSSPTGASVARLAQPRHCHRHADSTN
                     MTEGIAVVFKQNIAPYVFNVTLYYKHITTVTTWALFSRPQITNEYVTRVPIDYHEIVR
                     IDRSGECSSKATYHKNFMFFEAYDNDEAEKKLPLVPSLLRSTVSKAFHTTNFTKRHQT
                     LGYRTSTSVDCVVEYLQARSVYPYDYFGMATGDTVEISPFYTKNTTGPRRHSVYRDYR
                     FLEIANYQVRDLETGQIRPPKKRNFLTDEQFTIGWDAMEEKESVCTLSKWIEVPEAVR
                     VSYKNSYHFSLKDMTMTFSSGKQPFNISRLHLAECVPTIATEAIDGIFARKYSSTHVR
                     SGDIEYYLGSGGFLIAFQKLMSHGLAEMYLEEAQRQNHLPRGRERRQAAGRRTASLQS
                     GPQGDRITTHSSATFAMLQFAYDKIQAHVNELIGNLLEAWCELQNRQLIVWHEMKKLN
                     PNSLMTSLFGQPVSARLLGDIVAVSKCIEIPIENIRMQDSMRMPGDPTMCYTRPVLIF
                     RYSSSPESQFSANSTENHNLDILGQLGEHNEILQGRNLIEPCMINHRRYFLLGENYLL
                     YEDYTFVRQVNASEIEEVSIFINLNATILEDLDFVPVEVYTREELRDTGTLNYDDVVR
                     YQNIYNKRFRDIDTVIRGDRGDAIFRAIADFFGNTLGEVGKALGTVVMTAAAAVISTV
                     SGIASFLSNPFAALGIGIAVVVSIILGLLAFKYVMNLKSNPVQVLFPGAVPPAGTPPR
                     PSRRYYKDEEEVEEDSDEDDRILATRVLKGLELLHKDEQKARRQKARFSAFAKNMRNL
                     FRRKPRTKEDDYPLLEYPSWAEESEDE"
     gene            complement(41719..44013)
                     /locus_tag="GaHV1gp22"
                     /db_xref="GeneID:3239026"
     CDS             complement(41719..44013)
                     /locus_tag="GaHV1gp22"
                     /note="UL28-like"
                     /codon_start=1
                     /product="ICP18.5; DNA binding activity"
                     /protein_id="YP_182357.1"
                     /db_xref="GI:57790953"
                     /db_xref="GeneID:3239026"
                     /translation="MAEETQLRLMALAGQLQTLLFQIDILKRCDPEILLQKRLRSRIK
                     HNALMALYIHSLLSNELSMQVNYRLTLQTYCVWLWLRRACSEIAALCNEIDKYSVLKD
                     RKCFFEATLGYGKGFICPLHAEVQLQLYGMSSIISKELVLINDVENFMKQLNYCHCVV
                     SCKNAIEALNTIDEFLVLSSGGSLVAAPDTYDHGQPCYVCLEELSVTANQGETIYRRL
                     GYKICDHLTRQFPVNVSTDDLKRHLPFLRDVDPEKLKNVLSNETRIEAENHVEAGRTL
                     SSSPGESEASKILNKYDVFTEPPGPVYQLSELQYWLASGKRTPSGVESQTTTSQSVLK
                     QLDKDLSELFKRAEDFEQECIRLERTLFEKVHAHFHRVAQAELISPQHSLVDTLITGV
                     LATSPDTEIAALIKACYDHHLSLPLFRRLRNPEKVDTDALEELVEKLRGSDKETQPVT
                     EGTSTSDLTANLRGTIERDEDSIEVLLKKAERDLDVRQKNYVEKLSARSFSNLDRCIK
                     IQRAELEKLMRVNIYGETLPVMYVTLKNAFLARRAFLDIVCAEESLHSKILRIDQNDG
                     RAYDWHQYIRSSITRYQIDQTMLPRLTNRFFEILSGPLFKHHKERFPQPPNTSIYFSV
                     ENVGLLPHLKEELANFTKRHRSCDWMTSEFRRFYNFAGISNSTAIQRAACGYIREALF
                     ATTAFEKIFHSGNTKLLRADCVEFDLDGPILENGLYLTFEEEHPLVAVWGVDDRGKLG
                     PASTIIVEKDLYAVLYAILHRREH"
     gene            complement(44095..47094)
                     /locus_tag="GaHV1gp23"
                     /db_xref="GeneID:3239027"
     CDS             complement(44095..47094)
                     /locus_tag="GaHV1gp23"
                     /note="UL29-like"
                     /codon_start=1
                     /product="ICP8; ssDNA binding protein"
                     /protein_id="YP_182358.1"
                     /db_xref="GI:57790954"
                     /db_xref="GeneID:3239027"
                     /translation="MEKSSSGTTKGGKSDGGPWCIGPIGYVYARPREEIDGKEWKILC
                     AKSQDQPSCAIAPLIRGLTVESDFKPNVAAVIGTKSSGVVGGNCTAILSPCHFSTTVY
                     IFHGGECIPPTSFTPNLTKICEDARERFGFSSLPPNGPVPNAIETTGEEICKSLNMDP
                     DKTMLYLVVAEPFCEAVYVCNTYIHYGSVETLYINSKHVTRIPIYPVQMYMPDIALRI
                     CRNPFDSNSRNIGEGCIYPTPLFNKALNRLIHGATLGTQGQSLRTRDLEAVARGAAML
                     AFDGSFEGCVLTSDKTFTELAQNIQQTGPPKQNVEVERRAACSLAAELALATRLSVSC
                     APYPFDNGCGLPYEEWPLFCDCKTQMERVQALDRFSAELAGIVGAAIFSNNSPLYASE
                     VVDGGAPEPGERASSGLTRFYLTCGLHLLGCPQVDYSGKRVWEGTCPSPLTPQNTFEY
                     DPEHLAYACGFSPELLSRIIFYLEKCSKQLSTRPNMNLISISNSGKAPCTGAVPECRW
                     CNDESRNHCIRYTMQRLRTRFPIPRTMRRSPIAVIGAVDGDYTDCDILGNFAPYSQLK
                     RAGDGEPAKAVMNDTYRGIGWRVFQYLVSEGLINKDTGEDTHNISSLAELKTVFEKIQ
                     NFVGSECSKFISALSGVRAYHYKEHLSSIVHTFGSPEPYSSAYCPVLSLLCAQTRSIL
                     FQDLILSQIHGTFDTRQPESKMFRSSAMPALRSAFNGMLDKGFLSGKYEPFSISVPCV
                     NAPDTMRPNTEQAIAQYEYSLSRGQVLKLKEFKVKNRVVFNGSSTSNSCRVVLSSKPI
                     VMLGIMISKYVGQQNSTTVFQSGNWGSLIGNSGSQSVNSALTNDPVRKFALACKRVGT
                     ILSSGQVASGFQENTIASQVRSLIDAGGSPTSIYTAVLRVLGEGMKDITAETWMAITD
                     DKYLVNILVELREDISGSQNGWSVATAQSMLSELEGKDTCPENAGEMLVWADEDEYTN
                     TGDISEDIELGAPSAKKPSLSADILFC"
     gene            47271..50294
                     /locus_tag="GaHV1gp24"
                     /db_xref="GeneID:3239048"
     CDS             47271..50294
                     /locus_tag="GaHV1gp24"
                     /note="UL30-like"
                     /codon_start=1
                     /product="DNA polymerase"
                     /protein_id="YP_182359.1"
                     /db_xref="GI:57790955"
                     /db_xref="GeneID:3239048"
                     /translation="MDTFSSAGTGAARVAPIIGLGPHSGASYYTSVREFPYVCPTCIN
                     GGGRIGTQIGRATSKPTFYHNERQLDILTSTHGAWPVRMKYWNAGPGMTHHNKGDVKF
                     YEFHVYDLFENTEIAQSCVRWMHSRFLDTLKPTGTVITLVGNSACGKRVAVHVYGSLP
                     YFFVKKREIDQAAKVTNSEELAHALALATRKTSLKNSPFLAVSAESFCIDVVRRRDIY
                     YSESEEEDFYRVKVCNGKVMKFICDNFFPSVPKYESNVDAITRFILDNNLTSFGWYRF
                     RAQGGALQIRDPGQHATSADVEINCTASNLELGNNVSWPDYKLLCFDIECKAGGANEF
                     AFPSAEKVEDLVIQISAVTYSLLTKEKEQEIIFSLGTCELSEDCSDGITVCKCGSEFE
                     LLLCFMTFFKQYSPEFVSGYNILGFDWAYLSNKLSKVYGMRLDGYGKANSWGTFKLQD
                     PSARGLGRFKKVKINGVVNIDMFTISYEKLKLPSYKLNAVAECVLGEQKIDLAYKDIP
                     VMFAAGPKERGKIGEYCLQDSRLSGSLFFKFSPHLEMSAVAKLACIPLTRAIGDGQQL
                     RVYTCLLQRSTASGFVLPDKKSAFSFGSTLASDASDAPATRNVGYQGAKVLDPEIGFH
                     VTPVVVFDFASLYPSIIQSNNLCYSTLTHDPAALAGLQPEKDFFQIDVQGRKFYFVRE
                     HIRKSLLSDLLGDWLSMRKAVRAKIKTAETEEERILLDKQQAALSCLELCYGFTGVMH
                     GMLPCLEVASTVTAIGRDMLLRTKAHIEKEWRSGNQFAEKFLPGSERIQLNQYSVRVI
                     NGETDSAYCEVYRSLHLNFNSSWWLHGRIDLNKRFLEVRVKLEWKRFSCALLLIGKEK
                     YIGVMHGGKMLMKGVDLVRKTNCKFVNTTASRLVNLLFEDDEIAMAADTARAGFEDFD
                     CLPSGLTKLGRLIAEARLAITGNGLNIRDFIMTAELSRAVDNYASLKLPHLTVYQKKA
                     APREELPPIKERIEYVIIEPGQSVPNDPATESFPN"
     gene            complement(50464..51483)
                     /locus_tag="GaHV1gp25"
                     /db_xref="GeneID:3239096"
     CDS             complement(50464..51483)
                     /locus_tag="GaHV1gp25"
                     /note="UL31-like"
                     /codon_start=1
                     /product="nuclear phosphoprotein"
                     /protein_id="YP_182360.1"
                     /db_xref="GI:57790956"
                     /db_xref="GeneID:3239096"
                     /translation="MSDFRSRAAALRIRREGITGAIERHRYISYLRSKRRSSRSRANL
                     DTRRTFFDAFFKLTASSPEDTISLLRTMTIPVIRQENISLPYNVNASFAPGDCISLSE
                     MGYTVGPGGCCSLCSYGWSNAPPLDLPALELAFLHHLSSVVEFKELVASLRVFSGESV
                     VGSGAYENEFLLDTIKNLLAQATLFYAYYTVKGGLSQDFTVLLVNDPRSKKFPSGYLM
                     YFVFKQSTPLHLGAKLLKQLIFNCPGYTWHVDVFAGTFLLIVSKEDGPGSSEHHRVKL
                     TPDSVYRRYCDILVTDEKIHEYTKLYSTFATYSPPITSGWIQMSRCFVQEPLQLSQKT
                     VFSLE"
     gene            complement(51476..53224)
                     /locus_tag="GaHV1gp26"
                     /db_xref="GeneID:3239091"
     CDS             complement(51476..53224)
                     /locus_tag="GaHV1gp26"
                     /note="UL32-like"
                     /codon_start=1
                     /product="major envelope protein"
                     /protein_id="YP_182361.1"
                     /db_xref="GI:57790957"
                     /db_xref="GeneID:3239091"
                     /translation="MTSKRSTAETRTELSKGWKAGVLSKLYTGYDPAILTFNDKLSDE
                     LLYGAHLIEIYHEESTEQAEEQNRIPDIDSFVETMADLYTLDKSCAVCKIITKYQKKF
                     PVTPEWMVDYSLLCFKSQSIPLCATSTFITAFEFIFIMDKHYLHSHSTSLVGAISRRE
                     FSLGDIQKHFFFNGCFKAVEGGLDSKIDLNNYSFLVQSVARYALLSTRYQEALRAKIA
                     PVSGASADFNFPKSSGMAVALLKWREYARPLECFCSAQCMLKRKNTETASFAFRTCAQ
                     KAALEDISTESKYVEGGPSETLTTPSKWGFTDLTALLIAGTAGMPNRELDASCSDEPE
                     YDDTNDNGENFVAPIIRTRNTVVENFHATLIQQVKNTRLPKTAKQYICDNTKPSLAIG
                     PILASILPHPTSRGDTGGECVLCNLMLTREHWHALRKLKSKVVGCSNVNSSLFDGIEP
                     ALETFEDYTALNDGGRMLTLLRMAGANAIYKHFFCDPLCAVNTLRVNPKVLWEGQPKD
                     PELLQLYKAEIATANIFQERVCRGLWILAFTFKAYQLSPPRPTALNSFIRGAETYLKR
                     HGISCIALEHALTRYV"
     gene            53223..53582
                     /locus_tag="GaHV1gp27"
                     /db_xref="GeneID:3239092"
     CDS             53223..53582
                     /locus_tag="GaHV1gp27"
                     /note="UL33-like"
                     /codon_start=1
                     /product="Capsid maturation; DNA packaging"
                     /protein_id="YP_182362.1"
                     /db_xref="GI:57790958"
                     /db_xref="GeneID:3239092"
                     /translation="MASTVPRRLSELVDEEELAERPLSELFRKYIGSAGSPVYEIWFY
                     DLSPPEIEVALPTTDAKLNYLAHTANVAAELRYRNLDGKRMCAHAELIARRRERFAQI
                     LSKFLDLHQILGALEPC"
     gene            53617..54489
                     /locus_tag="GaHV1gp28"
                     /db_xref="GeneID:3239093"
     CDS             53617..54489
                     /locus_tag="GaHV1gp28"
                     /note="UL34-like"
                     /codon_start=1
                     /product="membrane-associate phosphoprotein"
                     /protein_id="YP_182363.1"
                     /db_xref="GI:57790959"
                     /db_xref="GeneID:3239093"
                     /translation="MVLRRIQKIIKKAMKPQGARNQGDKYCQLVRFVNAGLSLAGTTA
                     SLVYTRDNARLAPTGDIFTLLAKLDGPPIPAEYILEAMNSFLNIGESWLRIQNTGQAV
                     IVAGCFTKTANCKDQIWPASSPTISLAAAKSLWVSSSSVKEMKRLQKLKNAPLATMMY
                     ISFYRGSRTDITIRFAFYRSDSEPNLIKITRRVQEAIDSAEQEDSYKTAALLKKTLME
                     TTSEMPTSHSVAESKPSRSIFERVTTYFRIHVKCLNPRSFSLQPLMWVLMGVAWPAFL
                     TLLIFYLIRVQATS"
     gene            54515..54889
                     /locus_tag="GaHV1gp29"
                     /db_xref="GeneID:3239060"
     CDS             54515..54889
                     /locus_tag="GaHV1gp29"
                     /note="UL35-like"
                     /codon_start=1
                     /product="VP26; capsid assembly protein"
                     /protein_id="YP_182364.1"
                     /db_xref="GI:57790960"
                     /db_xref="GeneID:3239060"
                     /translation="MSRQSNSHSTPQPQDRVNAAAEMLKAFLLTPPRDRAPDYMQTLN
                     GITLDQLTEVARALKNEIPREDTVRQNILRNNITLALMALNRAPMLRDRLNIRPVFAR
                     LSGPQGLWTFGVRQRTRPRPRR"
     gene            complement(54914..62584)
                     /locus_tag="GaHV1gp30"
                     /db_xref="GeneID:3239061"
     CDS             complement(54914..62584)
                     /locus_tag="GaHV1gp30"
                     /note="UL36-like"
                     /codon_start=1
                     /product="ICP1/2; Large tegument protein"
                     /protein_id="YP_182365.1"
                     /db_xref="GI:57790961"
                     /db_xref="GeneID:3239061"
                     /translation="MNLLDTICVWRRPPPSCGGANATGSDSMLSADSLDAILDQGAEI
                     TRTGKAKVEDKSKKCSFRMIDCHELPRLWRSSWDEPDMLMIPSIPYGNVGYDMEVTIE
                     GFPSSMNIRGITKIIAKKIRKGLGFIMIIGDRGVAAVCSGGKDDPVYIFDSHGWEMSS
                     AYVCQLRRIDDLPEFVRAYVKNMSGVAIDMNFLYWFNADGWDEEKVSEKTLQEIIAAS
                     VMASYGASDAELSSVTLSTQIIHPFPAHVYALGLNPEFSQKNLFELADRRKAIAPWSV
                     PVRPRSKKRQKPRPKNPDQIGSSEKLTNLTPRKQRKHSVRSDPEAQSNTKPHSARRKL
                     SWNLLTAEDTNPSATIELGSITPIKNALEDPLKWLPAPQETFEPALTRFLRSGILREK
                     VRITCNRILFFIIENGVSTKNLESTVDLLIDPLATLLARIGEKNISNILTTTRLRYQD
                     LIEKKHLLLELCHSNSEGGSVLLRKTQQVSLSLLTQTEILIAKLNQIADSAERDQLPT
                     AYEQLSEELLECSNKTSILIEDVNSHGHKITDVVERAAKSVIESEARFADAKIAVLSL
                     LANTWTVIDEICNIGVDVINIQATQTPDIPQAIIQGLRKFTGLDVQDINRKLDDAIIR
                     IEDAAVKFLKKYAGAIDYSISALSSGVGGVLGRFSIPTLFVENAVNWLKNIEEIERRF
                     QLIRQLAGTPSKNLQVLFTRKPLRIFRDLVIDGKDLTTDEKLKRWSLHLFEAHAEGLV
                     PSPTKWISAIHDINAIAQSFGLTENMLAELENELEGVEAITAPPQVRLQYVLHTQESI
                     KVAKAARTTVEQSRRLDALEDRASRLIDQFSKEIRKEETAHEETKRTVTQILRPLKKF
                     EGLRNIKSALQTRNIPQEEVINLARNDDFIGKHVRDDFENLLEEYGRAFGSLNTTDLH
                     DLVDAIRFTATLLSGGKNKHALNRAFEVFLDHAERLLFVIETAKANGDADGFSRARQE
                     VEAVIHDVQNNRGASQIPQFLFSIRDNLYELESEAYQRARKKQLSDVIERLTKDILNA
                     TEKLNVPELRDRQIADSATVLVERVKKEVAQLDLTNEERFSPELLSLEKACSNLSEAA
                     HNAILAIEEIEWLEATKAALLQDRGSAKFSADDWETIYDLRPHVNSAHKAHTELKHLA
                     QNVVNDWLATGTKLLRSFFSFNPYSGNAEAGQGNKIAVAPIAASTWVHSFPLVSKYYE
                     TLFGAKVEGLTTVCAIAKDILETAEVTVEGSQIDTRGVVFRLSEQLMRIPELSEFVDF
                     YLQAHEQFIEFSSKIQTIKEKAILLQDELKKELQLAEESAQIERSPENAKKRLDHGEV
                     IPTALIALKELPDSLHSDDVTVFDHTAYQDASHRALRDVKLFLSAEINKAEQQKKNTD
                     GKIKNMLEQLWSVREEEVLRMQKGLKKLKGLLLGRVPKEVAPGIERAESLEDIIILFL
                     NLFREVEEKSNSTGITSVDPKSLEWMFSSAHILDTCELVNSIDERGPLEDFKKRLDEL
                     KRLYEEADAGLKDLEAYYKYFLSAATSFKETSGKEKDTSEESWGAYVNAVHNLKESRE
                     RLASRLQMVEAQVTSTPEIKKYQKDISEYTPILQKAEENIITLTNAMRTFDEVIFKAK
                     TEMHFKALKSLHLELTAIFESVPKWYRAKYEDIKKLILLRLELYLAYKALGIAFSDDI
                     IPRLSSAETPFSSRVRELARASSYMRQNKKAVMTVTFHHLGTIGSVMVTDNGMPLEYT
                     LCYRTATAKAAALWSAALCTSSDQSEPLSLELENPKDNELVKKLSVRQNAALSLVAAT
                     LWMRARTSDIEAGFHSYTIFCSTRTWPSSNKQTDTPMVAACTIYSALTYLTLSKTLGS
                     ARDVIIDEMGNFIPHTDLDKINQKNQFDKAVRIYSITAIDILILLTACEPAHLVYFGR
                     LNYLKQTEYIVNTLDVVLSRAVREKVGITSLDPYQRKTQNKKALSFPLSKGRQHFDPS
                     AGACFVIDPKDWLSQPPPSSILRFLDPWKRFPSVRSGICMLEKFCSGEEYETSAFLMI
                     LALKCIPRNILEALWVSMGPHDDIDGEPIDTMIHYMVSRSSPSCDYDFSPNSDLSRVF
                     EAPDDKLFGTVDRAGIYSLREEPHKSIWDLTAFDIAIISLLFGAPVVIAYEAGELSSN
                     NGLVLFSTIFDGRKTNPLESALSSTTAKTAIQLGDIIAGDANPIENACLASQIAELST
                     VLSSKPLKHAPSLLFAIDRGNKITQILVSLETAPSPFVLRLHGDPKYEDLPVKFSDTG
                     TFSSNLGDPNYDTSLYSVASPVQSGTESELSEFEQVLSETCDWKIQSPSITSDPSDNF
                     AVITDETNLEHPTDPEPKDRSHLATTRKTSEHEGPPESITSHRDKHDTAEAKQTHCSD
                     NEDIAHFPTYSYTWDKEVDPPEGESSDEDFTPAYVKGSHKLHEESSRRADEHKKGRIE
                     EGERLVRDTQALDTYLRKLDNALRDGTITPYLKSIQTPPDSSSEEDDAVNEISSGTSI
                     NDKAPSEDLASDAEESKAGEREILSPLPPTARSDIYASLSVTCRMVLKGIKHARDYAL
                     DQQARIADETHKIKIILG"
     gene            complement(63209..65881)
                     /locus_tag="GaHV1gp31"
                     /db_xref="GeneID:3239062"
     CDS             complement(63209..65881)
                     /locus_tag="GaHV1gp31"
                     /note="UL37-like"
                     /codon_start=1
                     /product="ICP7; tegument protein"
                     /protein_id="YP_182366.1"
                     /db_xref="GI:57790962"
                     /db_xref="GeneID:3239062"
                     /translation="MQAITDSLKACLEAVHTDCSKVPGVTSALTGILISRNRIPLEDL
                     EKVEARKNMVETIMLACTMAPPAVADVTLKLFARSLISRISVPWNSGEDFRIIQYLRE
                     AFTGLQHDLETAVRKEFPGLNDPNVEYWSLISGWLTEFGSLARLVVDERQLFETSGDR
                     LEPTKLLSPLIENYPLLYDHQMVQDGIQYLGTKLQGLVGYHAMLNYITASTGLPKTKA
                     LMTLSMVREYFEPTVKPPYRKFPQTALAAFDLDTDSAKSWIAKDLDSRYFSISQLYAN
                     AAYSRDPLLVLGDPPKTHVPGHVVCWRHDLDSLLTIPIKRLALDVPTIVQLFEDAPNN
                     LTEEQKETLTAYTTSTADMMGRSPDLAATGGPEEVIRTLVLRGFTKSNCELYIQKAEA
                     LWGEDTDGTIIGDFLGAVVYTSLIGLAAHSMYTYNPRTLQYSGHYAGLISDWGDPYSH
                     LLRRVGVSESELLLPLRSFAPAPSKNALNIIRDTLASFIDGSDGGPEALGNLGVFNFV
                     QHLISDLGGKTQENLDWLERREKAKDKGYASADKQSYTYGFDQTVKLVQAIEVGGAEP
                     EEICSRNGTDPKIDMQLFSNLSVATVLRDIVYAVSTYPFTVDAVQHAVKLLSGIEIRA
                     LRKPSDTQKYRRAILEFQLAVSPFITKTNPTEKISIESASAIEKALLKISDACDRSLD
                     TLPETFKKTVQPVPAVDTMRSKFISQAFEQAATRDLEEVSKTLNNASMQISTAVQILL
                     SKTANIRPLLSQSANADFLGNVSFSSCRDKKELGHWKDDTVMQAIWKAVNFAETAIRH
                     TEKAIRALDSTKVKTHALETTYWQLAGYAQTRSHICRKVAEELSGIADARNTVVQRSW
                     TLCRSLAGVGVKRARDVVKAWKTFSDNEAALETS"
     gene            66045..67283
                     /locus_tag="GaHV1gp32"
                     /db_xref="GeneID:3239082"
     CDS             66045..67283
                     /locus_tag="GaHV1gp32"
                     /note="UL38-like"
                     /codon_start=1
                     /product="ICP32; VP19c; capsid assembly protein"
                     /protein_id="YP_182367.1"
                     /db_xref="GI:57790963"
                     /db_xref="GeneID:3239082"
                     /translation="MSGLLARNGSNDKIRAPERGLSGFANTRTHPYLQSVLPRRTHQH
                     NLLSAALGRLTTGRNFSHGLGTRPGKFFIGSGPRNPEETNNATLGKEDTRAIASKPLL
                     DVESTRTNDVISLTQITVIDLCQPGVEESGSLMLFLKGVKDLLKILGSRPAREQIVRD
                     LETAFINLNRACGLSVTGESAVKSFELSAVSLSFVAAAGAAHYRNNCGVEALRAFVIA
                     NYKDSAITEKLANFDALLLATTEARAYPHFFLSLGGGLIKATESEPVTCMRLLVRGTH
                     EAAAAGDLLRKNVPYSTFHACLLLDLDEGFCPPRTKINAEDGVYFLHLLFLYSTDMGH
                     PRYELYVAKTSLPESCMRDILNERFTRRRINNTIASLTHMQAQERQAFPPFNIAEAAV
                     AARMDLRRERSRHPLDPLRS"
     gene            67618..69975
                     /locus_tag="GaHV1gp33"
                     /db_xref="GeneID:3239051"
     CDS             67618..69975
                     /locus_tag="GaHV1gp33"
                     /note="UL39-like"
                     /codon_start=1
                     /product="ICP6; ribonucleotide reductase large subunit;
                     protein kinase activity"
                     /protein_id="YP_182368.1"
                     /db_xref="GI:57790964"
                     /db_xref="GeneID:3239051"
                     /translation="MLSFFDELESIAHLEECLRDIETRMRTSGFDPKSIIRDDFDIRD
                     GREGLANRISMLVDGFKVSVLFNVELYRLLAELVHLRIRTKAVSFSEWLDTRGLSADC
                     KQFILENAEHISAVVKDFYNGTYHQLARVGLQSAQKYESLYLGKLGNGKLESMGQFFT
                     RLSAEAARGAFNIPQFAQALEVDGQVTPADVFTRFFTCLSSQLIVPPTPVMLFGGTSL
                     AAYASCFLIDSSGRNTERRSMSLPEEVIPIMNNRGGIGISLPCLGAPQNESGCLGFLK
                     ALDSLVAASNGAAKRPTGLCVYFEPWHCDTLKILKIRGSSAGNEEFRCDNIFTAIWMP
                     DLFMKRLQQPGSKWTLFDHRGEHLSNLFGEEFEKEYERLERKMLEWPLSLSPRLCSDN
                     QKCSSTGTPFVVFKDAFNRHYFYNMQHRALKCSNLCTEIAHMADSDTVGVCNLISINL
                     AAMVKNARAGLAGKPGSFFDYELLRETARTATIFANVMISLGNMPSQRAQSGNHRLRS
                     LGVGVQGLHTACLMQGFGMTSVEGFEFNDTVFELLALETTGISCRLCELGLPPFDKYR
                     ESYYALGWLHIDGWPNTKLRYKNEWDSLRHRIDPSGLYNCQTVALMPTASSSQITEVS
                     EGFQPVFGNMFSKISTTGEEVRPHLALMDAIDELYSDQGEKQAFLANLKKHQWSVRAA
                     LGSAWSESHVLAKFQTAFELDQEKLLYLSARRAPFIDHSQSNTLYITEDVDGTLSASR
                     VSRLLQVAFKYGLKTAMYYCKVRKITNNGVFVGSCGDSLICSACQ"
     gene            69986..70918
                     /locus_tag="GaHV1gp34"
                     /db_xref="GeneID:3239052"
     CDS             69986..70918
                     /locus_tag="GaHV1gp34"
                     /note="UL40-like"
                     /codon_start=1
                     /product="Ribonucleotide reductase small subunit"
                     /protein_id="YP_182369.1"
                     /db_xref="GI:57790965"
                     /db_xref="GeneID:3239052"
                     /translation="MAEYQSTDYYYLPQCDDIRELRDLSIANNWNEFELCYSRDEKDV
                     DLLTPEELDFYKLVFAFLAAADDLINLDIGNLMTLFLHKDIQHYYAEQIRIETVHSRT
                     YSLVQMILFKGDLHARDRYVTEAIKDPAIKKKIDWLNRVQVETDLTLPEKYILMILLE
                     GIFFVASFAAIAFLRRRNIFVVMCQSNDLISRDEAVHTTASCRIYNNWLGDHKKPSAK
                     RIHQLFKEAIEIECNFLASRAPQASRLIDLEAIQSFVRYSGDRLLTAIGVPTIFDEPP
                     PDPSFPLTLMSIDKNVNFFEHRSTAYNGNVINDL"
     gene            complement(70980..72176)
                     /locus_tag="GaHV1gp35"
                     /db_xref="GeneID:3239053"
     CDS             complement(70980..72176)
                     /locus_tag="GaHV1gp35"
                     /note="UL41-like"
                     /codon_start=1
                     /product="virion host shut-off protein; vhs"
                     /protein_id="YP_182370.1"
                     /db_xref="GI:57790966"
                     /db_xref="GeneID:3239053"
                     /translation="MGILGMRRFIRNHGLSVHLSLKIEKGFYLPLAVDTWNVLFLILR
                     RIDPDGNMGCMERTFKSLVFLFSLLSRKSCYPVFVVDGGRRREYKEPKHLSQEESVPT
                     APAARRCSDIKEPKDCIYKTRRKIRPPHYKLCWDLITTAGFDTVYVQGMEADYACANL
                     FHTRTVAYVLSSDSDLVFMGCDVITDLTPAFPVAIFYKSIIEYLGMSGEEFANACVDC
                     HTNIHSTDSIYSFSARLAEWRDHEKNENDTKKCVEQRGVLPADSDVFGIKTDVREPLP
                     GRYVYVLTQFPQEPPDDGNSDIDYRPQDPSVNNGARNEKNDEFLSYVLSVIGPREING
                     RHKLLKRVPVVQEQLDMIAVYEVLCKYFSNDAPKYFSELIKKGHLKPLPSLQEVICGK
                     NEQEQV"
     gene            72398..73696
                     /locus_tag="GaHV1gp36"
                     /db_xref="GeneID:3239054"
     CDS             72398..73696
                     /locus_tag="GaHV1gp36"
                     /note="UL42-like"
                     /codon_start=1
                     /product="DNA polymerase processivity factor"
                     /protein_id="YP_182371.1"
                     /db_xref="GI:57790967"
                     /db_xref="GeneID:3239054"
                     /translation="MFRDTGKGTDVHTNYVRWKMDLDTATRSKCLLRLTLGKHGISVV
                     SPIAKNMRGILQHSVLAFMNDCIVISCSAPFGMAFLKIKWQLFDSFEYLSDDESILPI
                     MFNNTIHQRPGDLLDFLWDSKKKTVGIPTLATFTISESFKSDETRAVLRLKVCREIEE
                     SASCPQNTEISTKFKYSSSDGPPIYLPRSDKACRASLEQYSFNEITKWLSKIPKDTQL
                     QSHSQESMSRSRPAEDEQRLTFNAKWFGDQTSIVSSASILSQLCGHEPAPKKRELSSR
                     AIGKKLKEARIIAVHGDKDACPIVVSLSRPGSLKQSLGWLKSGPWGPPCLTFYKDSVN
                     SLGVELSERGGEELAAGIFFLSAFSADGAIFEQCHDDSDTAMHEFLAEEERLIQQTTL
                     SHSNSSKKRSLENYEDTDISPSHHPQKRGKLKNGSLARKN"
     gene            73786..74973
                     /locus_tag="GaHV1gp37"
                     /db_xref="GeneID:3239055"
     CDS             73786..74973
                     /locus_tag="GaHV1gp37"
                     /note="UL43-like"
                     /codon_start=1
                     /product="putative membrane-associated protein"
                     /protein_id="YP_182372.1"
                     /db_xref="GI:57790968"
                     /db_xref="GeneID:3239055"
                     /translation="MTGATIIDPFAPPKGKWCPFNLNGIVFSLMMFIIFLAWILCIDY
                     GLALAYITWAKLSTKEARFGWMIGLLVATITASFLDIQYSAHKTVRIYFLVMLSMASA
                     VIIISLIHSNSPNAAIVMGLFSVLSEVCLILILGFQLRPAIFCSINMTWLFLEAMLLN
                     LTVLSWNLMHLRVNPRYLEPLALFTINIVGIQSLSFYLLKSDFFKTSMITLTGSIEPF
                     SEDNTIYTPPRQHKDTRPSLNDGPTRWCGYCILVSTTLVTAAFACTLSLPFLGKDLGT
                     VRIGMQTNFKILMVACGSVLAFGSTCIGKLCKIHIVVWFVISILLTFVSLLSLIKLIE
                     DPAGIPFGVILASVSCLFQVGALFFRELKTATHTQGWISCALLFCSLFIPIAAPLVCE
                     YKL"
     gene            75683..76927
                     /locus_tag="GaHV1gp38"
                     /db_xref="GeneID:3239056"
     CDS             75683..76927
                     /locus_tag="GaHV1gp38"
                     /note="UL44-like"
                     /codon_start=1
                     /product="glycoprotein C"
                     /protein_id="YP_182373.1"
                     /db_xref="GI:57790969"
                     /db_xref="GeneID:3239056"
                     /translation="MQHQSTALVSSILLLLSLQSLAFEFFCDPPHVFRGQLGDPILLQ
                     CFSDRPLTHEESVKVEVIRHPASLVETALSAYGIPPSLDPWRATPRTLYTYDAATDSI
                     KDLGYIGEDGINPPYLDDCRSGFFNVSIKSSMRSHMARYQWTASRGSTKLNSSFIDVF
                     LARPPTTVRIKSEELYEDSDKASHLSVEALGAYPPSAALGTWMIHNASLAEKYSLERR
                     VLYASGENGSVDQTWELEIRGEASQPLPSKIQFVYRWTPPEDFEMLRPETRLLRLTPS
                     WISKPRITVQFVPPAYALCRAANIIDGRGFIEWIVDNRISTSPHQTFVLDEPEGKNIV
                     TLMDVIKLPPEDTFQSASNYVCVIRGYEHAYRYLNASLMIDNLPMRQGFPAVAAIFII
                     ISIAFVGGLLVACLGAWCWKTT"
     gene            complement(77013..78611)
                     /locus_tag="GaHV1gp39"
                     /db_xref="GeneID:3239057"
     CDS             complement(77013..78611)
                     /locus_tag="GaHV1gp39"
                     /note="UL21-like"
                     /codon_start=1
                     /product="tegument protein"
                     /protein_id="YP_182374.1"
                     /db_xref="GI:57790970"
                     /db_xref="GeneID:3239057"
                     /translation="MEVAFQEVSKRGSKSPARYIDHHSGRLYIIYGGCIYSISTRGPI
                     KNITKFGFRIKHPTMCAIINTELNRLNGMPFDRQEEEYIFTSHLGEISESPHDELIDN
                     FTVEIRRPILCKIFVGLQVSETLEIRVGEVSLRNKVLRLFRTPDLINTTTGFRYQVDS
                     SALVLTQAHITTLPKFIEEDLEDLFLNSLTREPIHEQSQIFTPIIITGGKIISTVAVG
                     NEKKALRGCKKKTILSDHVQVKHIYPDQMFDEDVENFWECWKVLKRLWKMLMIVDAAT
                     ISRHGLLATIGLSWETDGAKLKSTLRDEADILVTLPYPGQRCLSKASFGRSSVIPYTL
                     FNYLLMLGHYPCHFDEITVVCERYIEKSGLKKIQSPETLQLQELSEVVLNILKTLLAT
                     HYVLQDALVSCCLNPKVQPKPRCSYPPESIPLIPETAVLLDAAKTRLMKDVSTAACLR
                     TKIPQEILVNTAKRTAAALVCIYLYEEAYAASEVSEITGNFELGRKIEDLWKMTKEEI
                     SPIIWEYRTDLVEILKSIISFRLA"
     gene            78782..79480
                     /locus_tag="GaHV1gp40"
                     /db_xref="GeneID:3239058"
     CDS             78782..79480
                     /locus_tag="GaHV1gp40"
                     /note="UL20-like"
                     /codon_start=1
                     /product="membrane protein"
                     /protein_id="YP_182375.1"
                     /db_xref="GI:57790971"
                     /db_xref="GeneID:3239058"
                     /translation="MTTGNEANSIRLSSVQVPGNCEIDKLLAGFDYEKERDGDYSTLN
                     EGSIFLNDRLIASGSEDTSDLQYTRMRKQTFYPSLALLLKILCCLPFFWYGNCTREKY
                     LFVNALIITALSCLEGLLISFFVYRNVKADRLPLKGPEKLIQMVLCMITAIYGAIIFS
                     RHLFADDDLAISIFAKNWTDTQEALRIGHCYLSPYFSMWAACLYFIILLYDVIDVTLP
                     LLWAWTILRTAISF"
     gene            79664..83875
                     /locus_tag="GaHV1gp41"
                     /db_xref="GeneID:3239059"
     CDS             79664..83875
                     /locus_tag="GaHV1gp41"
                     /note="UL19-like"
                     /codon_start=1
                     /product="ICP5; VP5; major capsid protein"
                     /protein_id="YP_182376.1"
                     /db_xref="GI:57790972"
                     /db_xref="GeneID:3239059"
                     /translation="MNPDNGIPHNSHHDRAAFPRSAAPFVASGELLGILRENCHAHLY
                     EWISREGDCCYRHSFDILLGSYFNTLTLTNFLETGLSVACICVKFPELRYADRGIIQF
                     VVANPMIARSDCEVPSRPSFTYISKRWSRTTLSSSLVICAPALGLLSGESLDGTEISE
                     FSRLQALNQLARNLKLTLDSFERGTINHVLRILIRKAPPLPLLRPMMAALECEREMST
                     VARANIISSMKAALCEDLFFIDKERGHETPDFARKLLALINCTLPSVTDARVTHIGPD
                     GRLIEGVIVTTEAVKGLIAARLGIETARANVPAMYSEMVLSGNSLVTALLLGKTIRNF
                     DEAAANLLSFLDGEKNLADFPEIPSNNADQVPTMSVKMSLLNVGDHLVSIEALERVYT
                     RTGVPYPLCENVDLTFFFPLGLFKPAIDRYSTSEIAPAVGAPDYRQFPPTEMYFFNKD
                     GMMVKLTFEDSLPTVAHPIAHGMLEALAELCQEPWVSNRRPAPMGFTIQRIGLNPPRL
                     LMIEFLEAVARTAPAPYPDATLINRKNPDQFSSHTNPFLPLEVHPFYDVYRVAQDLTI
                     PCDEPLFFPAEPITLAASRRLCNGDIPLPLSSVDFRLARGYCIAAGRHRLHPSTDAAI
                     ETTLSDVNYPLAFYVIEACIHGDELIFMESQRLVAQCINSYWHTSRGLAFINSYPMVT
                     YIYHNMTGMIDRDCHSRYADVMGLLHALRETIRNYTLPAEPILLRSHEELNNLMTDPA
                     LFPPMIYDCDSILRARTACATRGVTISTFGERAPTVSVREYPAQVDFTVLSNTLNHGP
                     AYTAGGRHEGGTHHDSEWTVLSKLFYYVFLPAVSRGRCCSAGVEFEMIYDLINTTRLP
                     DTVDEMDNQAGAVDRGPLADENLAPESFNTLLANGSINLVDNEALVAFIAAARRRQAV
                     HTIPLRVNYLPDPGFETIDSPRNFLVDGVLYNGIIMMNYAQYDATAIPSRYFYALPVN
                     GFFMNRTIIEASHRANVNLTNVPEDLPLVPTFLGSEVYRSIRAPSYLFASRASNYASN
                     SVAAYSLLAGYFKTSPVALVHQLKLNLHPGFALTVARQDRFAADQILFARRASESYYL
                     GSPVVTNRPENDSLVIEISQPRGHIDMGLGFTASRVPAKINTVVTDMGNHCQNLFNAR
                     YPGQFRHAEVADFIASEITDNDSTALPRAQPPILLSYEKAPIPPCIERGQLATCEFLL
                     TPVTADLAYFYTSANPRGRSSCIACTNCEDPCASETEKAMYDHSTPDAAHPSRATNNA
                     WASQKYSVGDKMYNARRGFITASDFYSPLSKFMTPSRAEDKSRCLARLMRDSSAAISS
                     VTGDTEYQFVAPPGANELVTDPCAMFQEAFPPLCSSDKVLFATYEGPNRASGSGAREN
                     HFAQYLIHDKSPIANALKTPCNTRR"
     gene            84059..85018
                     /locus_tag="GaHV1gp42"
                     /db_xref="GeneID:3239032"
     CDS             84059..85018
                     /locus_tag="GaHV1gp42"
                     /note="UL18-like"
                     /codon_start=1
                     /product="VP23; capsid protein"
                     /protein_id="YP_182377.1"
                     /db_xref="GI:57790973"
                     /db_xref="GeneID:3239032"
                     /translation="MTSGQYEIRVVLPNGLTRDEEDRLRSLRGTILMAPILRRCVFLH
                     EIDQKSFFAHGKEPDYATLLTAYRRRFPILIVCVENRELSAIALSIGYPRGISVRNTG
                     PFSLNNGDLVSLLPPITNTRFRVDLPSCGSVIEPAMTIPFEIGTELMGKIFAGMAYDF
                     CVRNQIATTRPRDIYVVTYKNKTLDLSTLPPSDAAALQDTMKSLFSSVLFSIHEGVMS
                     VLSLMPALLAGGANDPFLNAILQMQSMTRLSVQLFNPPALELPEPAGSSGRYHVFDAF
                     AAWLSMSHRLGDLFNLKPVLKVVMFYSDDSTADEGDLLNAIVP"
     gene            complement(85100..86209)
                     /locus_tag="GaHV1gp43"
                     /db_xref="GeneID:3239033"
     CDS             complement(85100..86209)
                     /locus_tag="GaHV1gp43"
                     /note="UL15a-like"
                     /codon_start=1
                     /product="terminase"
                     /protein_id="YP_182378.1"
                     /db_xref="GI:57790974"
                     /db_xref="GeneID:3239033"
                     /translation="MGFLNQTNCKLFFVSSTNTCHSNTSLLYNLKGKTNSLLNVVTYI
                     CDEHMPEIQKRTDVTTCSCYVLHKPVFVSMDSEVRNTADLFVKDSFMHEIAGGRAGKY
                     DSDRTLVPVRALDQFLIYRPSTSSKPNISGLGKILTVYVDPAFTTNRSASGTGIALVT
                     ALRDSMVLMGAEHFYLDALTGEAALEIAQCVYLCIAYCCLIHAGAFREIRIAVEGNSS
                     QDSAAAIAGNLTELLDSLRRRLGFSLTFAHSRQPGTAMAHPFYLLNKQKSRAFDLFVS
                     LFNSGRFMASQELVSNTLVLSKDPCEYLVDQIRNITVTHGQGPDSFRTFSGKQGRVPD
                     DMLVAAVMSTYLALEGSPTAGYHPIAPIGRRQRPA"
     gene            86355..88508
                     /locus_tag="GaHV1gp44"
                     /db_xref="GeneID:3239034"
     CDS             86355..88508
                     /locus_tag="GaHV1gp44"
                     /note="UL17-like"
                     /codon_start=1
                     /product="tegument protein"
                     /protein_id="YP_182379.1"
                     /db_xref="GI:57790975"
                     /db_xref="GeneID:3239034"
                     /translation="MEVHVLAATSKLLSCGEQEGGPAPILSHLVLSTQCLEGFEVPVH
                     LLSDNKFYTEIQIRHHGCFDCTEWKQVFSTFVGHRALDKILLPELGNCQERPFRITYD
                     GGNDWGGLFITIPVYCDAEKMTYDDFTAVAIRIAIGAALEEYYELLFTYGELVNSSTR
                     YNVDSARLEALSCQLLEYSPSHLNEAQTKYFRDIKKRLSELLGKNRQYVISAAEYLSN
                     NLQRFDAPPDTSAKQATIKERIDESTHLLKQVAGASMLPMKKYTPVPQGSENLRAVAQ
                     GLSALVKTLGTRGTEKIADARFSSNTATSELEPPGCSRGFEKAAPPMPDIRNVIMTDR
                     QKTTMSITSRSVTYYTMYDCLAAACEIMEAENNSTRRSWSLGKISIVLMSCYNSGAPI
                     MVVNYSQDSLKLCYPKVRSGASILATIMRPLGETSVQNLTEAAQQEIVKNAPCFQCPL
                     KALKDPDSLTKLFAVDCEQLLLYSFQARVAAAFTAAVSEAIVRATHTESNTTRLGQLI
                     NYDIPLYQPFDSLEANWPTQIARMASDLMAVLCITLQSERLSVFMKSGIWRAILAMLI
                     RKENHRRPYLAPVHVEDDVYLFDYFRFGSSNIVRITTEPVVLKARKPKIDGLYELDFI
                     ASPPSGLHPWTKQKFRPGEFHSYICVGFNSALNALLIFPGGFGLEFDFGEALKEVWED
                     HLDHLVLKRFSRRAPYYPESYLPSCEFMQKINTAG"
     gene            complement(88595..89761)
                     /locus_tag="GaHV1gp45"
                     /db_xref="GeneID:3239089"
     CDS             complement(88595..89761)
                     /locus_tag="GaHV1gp45"
                     /note="UL15b-like"
                     /codon_start=1
                     /product="terminase"
                     /protein_id="YP_182380.1"
                     /db_xref="GI:57790976"
                     /db_xref="GeneID:3239089"
                     /translation="MLGKESVEIVKRYRDALRKRTMERGPDDVDGQEMSDSNFITTAS
                     ICDRNDSARDTMNSPASRFQFAIDVPQRHQACIAPIGSFHNCCAISRAFSYMASEIIY
                     ENLASYSTKYTDTDAALNDLQVSPKRQLFTGAAEDSILPALRQKLANLNFARFAPSDS
                     LIHDKAFDGIMNGYRGFVKSDEFSQLNNFIYRFHTLLKKSFSGQASNDYKRAKLEKTT
                     SEQRDGTLELFQKMILMHATYFASSICLGEGSTERSNRYLSTVFNTSLFSENIIQHFR
                     QRTTVFLVPRRHGKTWFLVPLISLLVSSFEGIRIGYTAHLRKATEPVFIEIFTRLYKW
                     FGAKQVEQVKGETITFTFRNGNKSAIVFASSQNTNVSILYIYLVLTVIHLTTNC"
     gene            89595..90356
                     /locus_tag="GaHV1gp46"
                     /db_xref="GeneID:3239090"
     CDS             89595..90356
                     /locus_tag="GaHV1gp46"
                     /note="UL14-like"
                     /codon_start=1
                     /product="minor tegument protein"
                     /protein_id="YP_182381.1"
                     /db_xref="GI:57790977"
                     /db_xref="GeneID:3239090"
                     /translation="MVSLAESFLSHILAVVIKLESLISCPSTSSGPRSIVRLRKASRY
                     LLTISTDSFPSMSSARDYRNRARAEVMNYIKGQAYKAAVIEMMSLKVPRMHPALRYFL
                     ASAREQEAVSEINVRSNKRLSSVRCHVARIKAATESQRALRLELDGYRRYLRNDFLET
                     FAQESEAIADAELDLQRAEEEIALYISGDPDRRDSLDCEEDDLLLKWQLENVNPPTLL
                     PSPHAPSPVSRGNSPRTPPTPSPTFQEDECPVEEY"
     gene            90212..91609
                     /locus_tag="GaHV1gp47"
                     /db_xref="GeneID:3239069"
     CDS             90212..91609
                     /locus_tag="GaHV1gp47"
                     /note="UL13-like"
                     /codon_start=1
                     /product="serine threonine protein kinase"
                     /protein_id="YP_182382.1"
                     /db_xref="GI:57790978"
                     /db_xref="GeneID:3239069"
                     /translation="MATRKRKSSDATAITTCTKSRQSRELAKNSTDSQSNFSRRRMPS
                     RRILSNDDGIDLEHIAPVSEDLTKESRQLAIYIMPKPNKICLKVNPKMSYRWFNLEGS
                     TVIGNGGYGSVQYAPKYHMAVKIFESDGHFRWELAMSLILSNAARRPELSDIAKHFLQ
                     IYAFSKIERAFVMEPLSHDLKTYAKRYKDNFTMETLNTLTSEFKGLAKALAFLNIDCG
                     LVHMDVKSNNILVKCDANGKLSRLVLADFSLTGPNTNSILNQSMMVCPSRGVVEGLKI
                     IDSTTVKNHIPSDSFIIYNGHCRAPEVIINYCNGKRYRDQPMDALETLGLDLFSLGQV
                     VQEILFEGILCRSREFSFKPKPNTIHEKLSHDYMMRVLAYRIVLSDNLISRGCDLSFT
                     GPLSGTVESVNASLFRELDRILFQSHVEMYERIDLREKLLNVIIPPETRGLCTLAGLL
                     CHWDADLRRSAVTFF"
     gene            91789..93369
                     /locus_tag="GaHV1gp48"
                     /db_xref="GeneID:3239070"
     CDS             91789..93369
                     /locus_tag="GaHV1gp48"
                     /note="UL12-like"
                     /codon_start=1
                     /product="ICP18; Alkaline nuclease"
                     /protein_id="YP_182383.1"
                     /db_xref="GI:57790979"
                     /db_xref="GeneID:3239070"
                     /translation="MTSVQDQSPLNENMQCQKTLELSVGMQIPKELPGVAMFTFYDYL
                     ADLARGGHAQSDILQQEPLHHRLAYISHLFSWLEKEGFAYGILNKFFGSERALSASEI
                     SSNLSQQQINEILFFIESETKQQASCDLWKVLRQFLLTASTLKWMKNKPCSKPEWFKV
                     QEFKGGHLGYATQSMPLIFGNTNESCARSLLLGYVTGEAWKTSEDREEFYKFDDGHPP
                     EEAFTCGLLLDKRSGMLGASMDMAIVKRRKQCARKVEIYEIKCRAKYVFSVENQTHPL
                     SQLYDKMLQHPCENSIRDFLLGISSPGVEFVEESGIPTASEALLTCDKTWKTDRWKKN
                     LRERACLMEKRHLSLNRTNNSSVFLFESPCLETNTIRPVQWPDGENNIELPIFINPKH
                     QNFKQIFVQTYVLAEYFETIPISPFLVTFIGRNRKTVERGRVFKLEHTLDGIEEPVEL
                     NCKHAIPVLLIITPTTIDRNHFSDLDSLGREAFEFSVKETWAKVSVDTSENVAAPAVQ
                     SPAGVTQDPENLESACPY"
     gene            93258..93500
                     /locus_tag="GaHV1gp49"
                     /db_xref="GeneID:3239071"
     CDS             93258..93500
                     /locus_tag="GaHV1gp49"
                     /note="UL11-like"
                     /codon_start=1
                     /product="myristylated tegument protein"
                     /protein_id="YP_182384.1"
                     /db_xref="GI:57790980"
                     /db_xref="GeneID:3239071"
                     /translation="MGQGLCGHLGECCCPCCSKSCGGDTRSRKSGERLSLLDDSFDEF
                     TITEDMPMIQGGKKKEKRSKKEAEPIVVEPVAARRH"
     gene            complement(93577..94758)
                     /locus_tag="GaHV1gp50"
                     /db_xref="GeneID:3239043"
     CDS             complement(93577..94758)
                     /locus_tag="GaHV1gp50"
                     /note="UL10-like"
                     /codon_start=1
                     /product="glycoprotein M"
                     /protein_id="YP_182385.1"
                     /db_xref="GI:57790981"
                     /db_xref="GeneID:3239043"
                     /translation="MSGYYYSGQESRLERIAWRMWLIEVISFVVLVLISLASAFSALS
                     PQAGFPCFFGNVAGGHLKPATPLINQPGLLRANEDGLFFISSPGMIFTVYATMAVWIL
                     LAIYVTLGAVRAKTCNHDRSYGASELTSAVISTPALMSIIITVWAWQLFVLLLSYRQL
                     TLSAVTFCIIFVSGIVFLGTFASSGKTPDQYSVFNSQLKSACPEVHCVVSPFKAVVLN
                     VYASIMGVWGLIMALSGALVMTVNFGVSVPASTLGAMIAFLIIGIIYLIVTELVLAKY
                     VHVLIGPHFGLIIALGMLGTASLHYANTLDSGTHPNWKPAAAGILGVFALLVLVLAIL
                     RVVRAYRYHQYRQTDFIRKVTTVATEALDKTVKRKTRREKYKSRRDKHVYETVPYDDE
                     L"
     gene            94707..97385
                     /locus_tag="GaHV1gp51"
                     /db_xref="GeneID:3239044"
     CDS             94707..97385
                     /locus_tag="GaHV1gp51"
                     /note="UL9-like"
                     /codon_start=1
                     /product="ICP9; replication origin-binding protein; ORI"
                     /protein_id="YP_182386.1"
                     /db_xref="GI:57790982"
                     /db_xref="GeneID:3239044"
                     /translation="MQSSLNAIPVHYSSSRSFSALCELAPTSLSGRNDMSPNNFAPGE
                     QLWLSPSVGLARRLYGCDLSDRLLSNPTMSRLSLDQQHGHPVTFPPPSRSRPVLIARA
                     PMGSGKTTALIEWLAGFLDHQDRSAIVVSCRKSFTNSLCRRFQRDGLVGFATYLDCEK
                     YIIDEISHRRLLVQLESLPRVSSVLLDHYDVLVVDEVMSLMNQFFSPTVRKLRETEAL
                     FSLLLSKCQYIVAMDATINATLVEMLADLRGAENIHVIVNDFVSSGFANRQCTMLNAL
                     GAAIPASLLKPSEGNEDKGLEDNKSTAQVDPSLLEGSFFHEMQARLLRGENICVFSST
                     LSFSNVVAFFCSEILSPGTVLLLNSNSPHVDTTNWGRFRAVIYTTVVTVGLSFDSCHF
                     HSMFAFVKPTIHGPDMMAVYQAMGRVRRLLHDKLFIYLDVSGAWGAPIFTPMILNSEF
                     STTPWPVDITVPADAMCVKFKNRCRQINNHRDGVFTRFKNKHYVERCTLTSANDSFSL
                     LHTLLVNNKINVEIMSVDSSDPKLENLGQFISGLRADSYRNRAPLKHLYSALEKYEKS
                     QDIFCLPSNPTPEETALMLMESENVNQFIARFFELDRSLENFGEDLQAFLQQLGDKSK
                     TIDALINAAVVETGCTCDEDEWFQINTEALSKDRDSKLDSWISYYLDGPFVCLSNGRP
                     AVIEVCNETEVKNRRNLLRLCINIARTIGWKPSADPNETEIELDVIVKAVNDALNAGM
                     GNCMLEYLRLNITEPSWLTGPIRNLQCYLGEKKMSRRERKTSDPLEMAAVKILRTLWA
                     ELFDVRVFKSQKTFPGTARVKNLRKEELCALLDRIHVPYDRKETHKQLYAKLMCHREQ
                     FKGSRLSFRTAAWTRFLKGRCLEDFHLMTPISSHHV"
     gene            97378..99765
                     /locus_tag="GaHV1gp52"
                     /db_xref="GeneID:3239045"
     CDS             97378..99765
                     /locus_tag="GaHV1gp52"
                     /note="UL8-like"
                     /codon_start=1
                     /product="heliase primase subunit"
                     /protein_id="YP_182387.1"
                     /db_xref="GI:57790983"
                     /db_xref="GeneID:3239045"
                     /translation="MYDESILYGYLWGISIYTIETKQNASGNITDMWVLYELAVHDST
                     KGAHEVLYASLQFEESDLSVASWPHPALNARLLTDFVGAVKNFHQRVYKLNAKTINFG
                     WILSCSTSSQIALRLVTGRLLHEIRRALTLPEFYSPSIFYVCKDSGLITKVCEDKSKP
                     RMATASYAALNASSNFQANYIERNLQAGHCCELRNFGWARIQAISSGKINPRSMTAEW
                     VWAGGKWIDGRGNEAFSETGTDPTSDDGLAVPFALTPAKTIYGPTWFVPRRMLVASLV
                     PKEFEYAIYLKDGSTIISLVCAIINLYCRFYQGNIVAQSTFLKPIILFLFPTSSSRMD
                     GSEKVSSIKDSYMYTPGFPSINFVPITTQNMSKMGALNACRIVSLVEGLWPAYNIRAL
                     LMLDRGDRAKHGSQITTLPRDLESTLEVYPAGKISTIADLPTVISGRILKMDFSAFFP
                     CLYMACGGGSQALCRIIEARLNREPQSEKLKAALVALVGGLKYTDPSKYKLVIALCNS
                     IALAVENAANSLQFGIAIYMKDGFIGAFDKHSSTSAEELRSKCEWAAIEELQKILLEC
                     GQAITGMPTLKLRLEGEFTEGLLLNCNKYWLHNRNTGKSFICGIPGLREENGLSVLTE
                     RTACELLAGIYTANTVSTATETLTRILDGYAFSAFEARGDINFWQETLKSSFTPCISD
                     SAAIRSASFMTRPDELEGETHFVYLTPTNLSSHGSANAGGKVIYPSSLAEENFCIKIC
                     YSAHLIPKMSAMVELVQNMVWLKFYHNSVDNDEETRGKLLKTCDYDYERTSFLFS"
     gene            complement(99813..100889)
                     /locus_tag="GaHV1gp53"
                     /db_xref="GeneID:3239028"
     CDS             complement(99813..100889)
                     /locus_tag="GaHV1gp53"
                     /note="UL7-like"
                     /codon_start=1
                     /product="putative protein; DNA packaging"
                     /protein_id="YP_182388.1"
                     /db_xref="GI:57790984"
                     /db_xref="GeneID:3239028"
                     /translation="MSDVRAPIGKMNDGMEELKETGEPILEAATENRPTRKLVSWAEE
                     AFNAICRHQKKVGPIRLEDIAEEPEHGPTLEELERLASSGESTSQLIKEISRQAIPRF
                     FFEVRSTPGAPALFASDSITYMDIQMDGEKIILELISGAVVDIEEYFCACVRLDDHAG
                     FIFSVITASEDRVATVHVTWPDFLNRIHRIMPQKFEDFALCLICMYLENIDPIKVTQE
                     HCYKLRSAIARVARTISINDKVRELLVNGGEWLLNTLLLMHDLPPFDPGLVLPHYRVA
                     QPLMQITAPIGEELISSLYSTHALMIMNLPSNENERAIILESRNSTLNRVYGNGNFFT
                     RVLRLWWNDRKLHRSAYKLYDTYF"
     gene            complement(100666..102807)
                     /locus_tag="GaHV1gp54"
                     /db_xref="GeneID:3239029"
     CDS             complement(100666..102807)
                     /locus_tag="GaHV1gp54"
                     /note="UL6-like"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="YP_182389.1"
                     /db_xref="GI:57790985"
                     /db_xref="GeneID:3239029"
                     /translation="MDMPFSQLRQVPCAFDIDNLIAVLEPILTGEPDDWIIIHPTKRT
                     MGFREILLGASTYTSGQGVYNSVRATESVVRQIQVAVLRNILDGCRFEDVERDWDTHI
                     RTRGLTPDELAARYCHNSEDGIRVAEQAFELWSFLLQTVLLDFVRGVSELSLRGLSEA
                     GKAPSYVRYIDWITCLGMVPLVRERKPQEKRPTGSDLGNEDLESTTTEIHHHLHVAPS
                     LFARGFEMLKYLRAVLGAVHILEYERTLIIMNVKTSEIRAYDGNTGELGECMVVWEPL
                     VTDRGVLFDSPMQRLHGPVLKAQAMREHAKLCQLVNTAPIKVLLGLRTENAQDPDHVT
                     KVVDKALGEGVEEAGTSAAARLIKFIIDIQNMRKVGDVADVVDSYLRENVSNIERQLV
                     LDPTRVGCGGRAAAQGQRPIDNAEDRMGNAVRAAVNTSVGKVVNTLFKTVSDLKESNK
                     NLVYSNGKMKKELVEARMESARRTERTQANYDRCPAWETLGGIEEAWECKETLESLSK
                     LPENLSYNLVDVSKDMNDQQYIANSFLARYIPPYLEEETRLSALWEQELLRVFKIQRN
                     MNNQGEEVSLSYSTSAITLIVGPFFHKVLKASRLGFLVSSQTTYKSEEELCQTLFASS
                     RVGSYLKDLNVRYIANVRRSCANRQDERWDGRAERDRRAYSRGSDRESADSKVSIMGR
                     RSIQRDMPASEKSRTYTIGRHRRRTRTRPYP"
     gene            102795..105317
                     /locus_tag="GaHV1gp55"
                     /db_xref="GeneID:3239030"
     CDS             102795..105317
                     /locus_tag="GaHV1gp55"
                     /note="UL5-like"
                     /codon_start=1
                     /product="helicase primase subunit"
                     /protein_id="YP_182390.1"
                     /db_xref="GI:57790986"
                     /db_xref="GeneID:3239030"
                     /translation="MACPFSGKSRREIEITTPVYLNFSAMQSIQAILSDITILSEQAV
                     HEDSKPQLSWFETVARLDEPTTLPLAELPFNVYLITGNAGSGKSTCIQTLNETLNCIV
                     TGSTRIAALNIFNKLSASYTSCPIHTIFQNFGFKGNNVQAVLGRFKFEKPHEQRSLAE
                     HQMADIYYYWDVIKDITARAIDTASPVALSVLQTLQQKTSRKFVNLAPFLISSMPPFV
                     KSNIILVDEAGVLGKHILTAIVYSWWLMNALWKTPMYQDGKKPVIVCIGSPTQTDAME
                     SSFEHRNQRHLISSSINILSNLICTPTLFSVLNIKKQWAIFINNKRCSEPAFGEVLKA
                     FEFGLPLTERHARFLDQFIVSESFIKDPSKLPGWTRLFSSHEEVKEYVSKLHAKLRAQ
                     KSEKYRVFLLPMYTIVDMAAFEKYKSLTGQETLNIDRWLQNNSSRLGNYSQSRDLDVT
                     APRFEYHRDESNEYTLVTTDASHVLNSQITVTKKVKKLIFGFEGTFEKFAHVLSEDSF
                     LKTYGEDKVEFAYHFLSTLLYYGMIKFYEFLRTEGLPEDKLTMAYDRLYSLAMPEPET
                     QNFDMGNGEKFCFNEDECPNADVNDKDDLFDIFDKSLDQFYLNYEICGSDVHGQEIFS
                     YFEQMKRIYTLRYAVLCELFGSVFTAAPFSSFVGTASFSSQEISISSFKGAVCAFAAQ
                     TDTYTLRGITRARFPGYAEDTSKAHEWAEPILQMLDLPRLVVRDQMGFVSVLCHNKAT
                     FVDNIGGQELRMAITIDHGISSSLAMTITRSQGLSLDRVAICFSHGTMKLNTAYVAMS
                     RVTSSEYLRMNLNPLRTKYEDTRQVSQHILRALRCKETRLVY"
     gene            105403..105939
                     /locus_tag="GaHV1gp56"
                     /db_xref="GeneID:3239031"
     CDS             105403..105939
                     /locus_tag="GaHV1gp56"
                     /note="UL4-like"
                     /codon_start=1
                     /product="nuclear protein"
                     /protein_id="YP_182391.1"
                     /db_xref="GI:57790987"
                     /db_xref="GeneID:3239031"
                     /translation="MIFISYVMVGVQGLGHGSATEYEQVVYSCDGGMRFICIGNKMYR
                     HQLPPGKVIVIHNPVATMIAVDCEEEFCAYCLERNGSHRGPSGETLAFQFSACWFLGR
                     GGTRERWSSGNITMMNFLGVAHLTVTIYETPEDLASSAHTTPTCSQSSPESLECPEES
                     VPRDLVEFAARHAGLLEE"
     gene            complement(106346..106936)
                     /locus_tag="GaHV1gp57"
                     /db_xref="GeneID:3239073"
     CDS             complement(106346..106936)
                     /locus_tag="GaHV1gp57"
                     /note="UL3-like"
                     /codon_start=1
                     /product="nuclear phosphoprotein"
                     /protein_id="YP_182392.1"
                     /db_xref="GI:57790988"
                     /db_xref="GeneID:3239073"
                     /translation="MGTEIPSVTEVLYGASSIDCVSGSYECHDTHSHVTPDHAKDVAV
                     QGHVKTNNTEDVESLDSCGFDSVFMIFSFGELGRRQLTDNIRKDICTSLDRVPMACTK
                     TSAFAGANRHQKSLQMFLFCKRRHAPQIRARLKDIISSRKSRKYFTQSEDGETHPGVP
                     VFFHEFVAHAPVFIPRDNLAHACRRLARHMTGGMAC"
     gene            complement(107057..107950)
                     /locus_tag="GaHV1gp58"
                     /db_xref="GeneID:3239074"
     CDS             complement(107057..107950)
                     /locus_tag="GaHV1gp58"
                     /note="UL2-like"
                     /codon_start=1
                     /product="uracil DNA glycosylate"
                     /protein_id="YP_182393.1"
                     /db_xref="GI:57790989"
                     /db_xref="GeneID:3239074"
                     /translation="MAGNEHQPLSPGLCEQPIKSPFKRPLDISSPTESNQRDTDPNAA
                     KKRRTLPPPSMTSVQLVIPSARKLVPEWTDVAIEFSIPSSWESILKPLIENEDFGETL
                     LQYSYCSRFRKIFPPKGDIFAWTRYCNPQDVRVIIVGQDPYPTEGHAHGLAFSVPRGC
                     RIPPSLRRILEALRDCYPSIPKETHGCLESWARKGVLLLNKYLTVEQGFPRSHSTIGW
                     DKFTKGVISSLLEKLSSTVLMLWGQEARRFIPRVPKNHLKLEFIHPSTCTRRPFNCRH
                     FEEANQYFESKGLSPIDWNLD"
     gene            complement(107896..108603)
                     /locus_tag="GaHV1gp59"
                     /db_xref="GeneID:3239075"
     CDS             complement(107896..108603)
                     /locus_tag="GaHV1gp59"
                     /note="UL1-like"
                     /codon_start=1
                     /product="glycoprotein L"
                     /protein_id="YP_182394.1"
                     /db_xref="GI:57790990"
                     /db_xref="GeneID:3239075"
                     /translation="MTQVKVLQDYRAEVLHLGRHIYIGTTLIRTTIHSKVRHKEYLLV
                     PVDHYICIRTTQILTTIHLEVGRKEFHLLVDVTRIVNGDLGLHMIMIFKMLTCFFLIA
                     SLMLCSSVDIPGIFRDPVSAAAAPCDSNSRDNGARIFGPLPSGDYFENLTVIIYRPLC
                     VNTEVVFYYKNGYAAKVNPYLGIRLLQDRLEATGLAAANVLARGLVDSLYKRTTINFR
                     WPETNINHYHPDYASSP"
     gene            complement(108326..109570)
                     /locus_tag="GaHV1gp60"
                     /db_xref="GeneID:3239037"
     CDS             complement(108326..109570)
                     /locus_tag="GaHV1gp60"
                     /note="UL0-like"
                     /codon_start=1
                     /product="putative protein"
                     /protein_id="YP_182395.1"
                     /db_xref="GI:57790991"
                     /db_xref="GeneID:3239037"
                     /translation="MLETFVTRQLTWRNFEALYSTLLRAKSVVYSMAIASAPEISNAR
                     HLVTRGANSALRAVELSFQDEEQMLEVFYSFLTRINGWIREFTTNHPSGYDSFLAYEQ
                     TPTVQSASGLEYRVGMAIPETIQPDMLTRPLTVDLKYFKNSAGMVSIRLPVKGESHDS
                     TDVKPVGLAHPMVKKRPTTVSDTFMLPETEEGEGNYGLASRAEVRDVYEMSWVRRVVR
                     HEIENSPAHSPPPARPSSIPPLFSAPSPTALDLRLSSLPSPSRRSPPQLSPHHPSSNY
                     DGAGQNTTGAQTRHGGIKNEPESPVAADRGILDLDSMQNRSLRMRNDDAGEGPSGLQS
                     RSTPSRPSYLYWDDSDSDDDPFKSPPQRVPTGSCRPLHLYSDDSDSDDDPFRSRAQRV
                     PSARRRNTDRERRPRSPYDNDF"
     gene            complement(110168..111514)
                     /locus_tag="GaHV1gp61"
                     /db_xref="GeneID:3239038"
     CDS             complement(110168..111514)
                     /locus_tag="GaHV1gp61"
                     /note="UL-1-like"
                     /codon_start=1
                     /product="putative protein"
                     /protein_id="YP_182396.1"
                     /db_xref="GI:57790992"
                     /db_xref="GeneID:3239038"
                     /translation="MHDVKQLGKLGEVRARHENPEEGRKISASDHSAIQHVLDNERTV
                     IRRHQSGRMSPVDEYLMVVKAATMEMLLLHKLTIKHILYILKAFVRLKEVVYDIMTRT
                     NQPELLTEKVYGGAYEIFLRFPLPVRDPESMAEDFLQFLRHSIRWCRKFKSRTNRRGH
                     KADIGYLEHRTNIQENEMRYYVNPRKMPKKDTLVRVRPVAPERYKSRREAAFKNSVGE
                     VTIKLPVRDAGDPLVSSVRPVNVSVAIPQSESWRLRAPVDNEFVVHYRHSSSSEDARL
                     STSENDSDDSMNDAAVQEALMEDADDAPFGAEDEQLSSESNDSDGNYSEYDPPPEMVE
                     GWHGGGQGGRAESPQPLADVREVEPRDPQRREEPIETIVLSSESDLSADEGENNNPMQ
                     RPTDPRVFLIRVRRAREILRNVGLDDRRIGPHRGRDRYQLRSRSRNRSRSIDGPDL"
     gene            complement(114497..118888)
                     /locus_tag="GaHV1gp62"
                     /db_xref="GeneID:3239039"
     CDS             complement(114497..118888)
                     /locus_tag="GaHV1gp62"
                     /note="ICP4a-like"
                     /codon_start=1
                     /product="major regulatory protein"
                     /protein_id="YP_182397.1"
                     /db_xref="GI:57790993"
                     /db_xref="GeneID:3239039"
                     /translation="MSSDSSTPSNLAAPIVDESGFSTGPPSDLFTFLRADKSGRYDSL
                     GSPIPNPPNAPTCETTTDSFSYSTPPLFSSEDELFHSVIAENAAQDAAQDVDGREMSL
                     RDLIAMLNDMDPENINSIEPCPNATSDVVALDINVDTDQPGVYTVIDSLAHPCETPME
                     QQHVECPCPLPAVEKTTAVRRQEVVRKSERVARSRSRRPWRDLWSNRRPVPSPQRTSK
                     DRLPKRGKREFSKKMGPSHLTSSSSSSSSSFSLSGRRGRLARRLESAGSEKSTESPDR
                     DSAQLVLPGECPDVALEPLWRVLREWVETDGTDGSVQSVTAPTELPDLGRGITLNVLS
                     RALAVDLHSSEARVFVPEAIIPSPPSRGQVYHGSGYRQSLVDDPQVREAAAEFHANPK
                     SASVYLEEYGMPVEQLERLVEEFMVHPLSRVSYGYGGPKLSPRDKRLCELCALRGPGS
                     SEGGLSRSAVPTCLPHVAHAMRDGRVSLALPHLTELVRVCRRYDHPQKTYLLAALRRA
                     FVPFVFPGAAVDPTAASASGDHPVLVGARRIARATRELEAAAKEPPAATPEKLSSSAL
                     LRHTRTCIVAAADLMAALTAIDCPPVTINPAKRRPDLYQALSRAPKTVFTWERAMPYC
                     AASLWSRLVIGSLPLPSTDDVTLLVEAMEAAVGVLGCSDEGDVRPSIAYAASGWRMIA
                     TMLGDDSAPGSEHVTDDCPADDDTHHHDRRKRRGGRRTTCRYDLPPGTPDRAAHLLLY
                     GSPGGGDGAEPSAAQESPANPWPRAPPCDEQEPLSVSPYGPEPDRPPDDDFETRKGLK
                     RKSSEDHADPIPEGNATKKTCGLQGLPDSLPPAVPETDRDNPLLPPCPITPEGPPCPP
                     REEPQQPQEPQEPQSPSFHISEIGEALFHSTPVSPTILFAPEGFIPNQGDVYRPHGKN
                     LGVALSAGEPYVPAHRARPALERLANYLRGLSSGPAGSYSATGPADWLPAFARDPVAL
                     GEFCKRISPVNRGGRCVLEERLSWTLRHPADKIYDLIILVSERAPGEFLERAYAYAAL
                     CGRACMPGGACWPESWTRGEYPYIPPDEKDPGRSVAILCTTDLGYAGAVEWMLERALS
                     TSGRACVVVDARDPGDEDSRSGPRIPTGRRGVVYARTSPPSHAYLVKLFTGPAAERLE
                     RGGLNVGHVVMDRRLTVSWPLSVGKTDNDDEGTGDREKCPPVKHPFLTHVTLRRLRDV
                     ARAMDAGWSHSEIGKASAVLYPYMAQPHVGAGAMPPCPDLSESSSTMHSSSSSSSSSC
                     SSSSSSSDSSSSEEDGDEKNEKEDRERAGGGKRRGRQRLPIRDRVYRGRDYRVRTPCA
                     DIVGGTSASFRAVAAWGRDTVIPALPLAASWSDPSKIPQEVLRIISDYYPDAPGARAR
                     RNPLHVEGLALMRARNPAPLALLLGDDYSHYHTPRNRSPMCCCWSAPRGATPESLRCT
                     GHTRTRRPRLSVSSGRGETRTLVPRLD"
     gene            122103..122939
                     /locus_tag="GaHV1gp63"
                     /db_xref="GeneID:3239087"
     CDS             122103..122939
                     /locus_tag="GaHV1gp63"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="US10b-like"
                     /codon_start=1
                     /product="tegument protein; capsid associated"
                     /protein_id="YP_182398.1"
                     /db_xref="GI:57791006"
                     /db_xref="GeneID:3239087"
                     /translation="MENMLDGCYPLALMDSDHITAHAVPRGERRRQGAAVASSESADS
                     VDPCIRIASRLWRELVEISSELKDGYGEFTSARDRRNALIAANERLRSAFLGASRATR
                     GLGLRPRWASTESVANSPTDPNNGNGLGELEEAMEGIEGDFWLDSLDGDRFEDESRTM
                     QSENMRFVIEKELLSWLSRHLPADLASAERETSRSLLAAGHWCCLWHPRPCREACLYD
                     SIYVQSLFCVGTGRVPQSEMRRREYLAALRAGAAAANSPEVSASIFARDAGIALALAR
                     RR"
     gene            complement(123306..124190)
                     /locus_tag="GaHV1gp64"
                     /db_xref="GeneID:3239049"
     CDS             complement(123306..124190)
                     /locus_tag="GaHV1gp64"
                     /note="sORF3/4a-like"
                     /codon_start=1
                     /product="putative protein"
                     /protein_id="YP_182399.1"
                     /db_xref="GI:57790995"
                     /db_xref="GeneID:3239049"
                     /translation="MSKCYCLARHLYKSPRCVGRRVAFGGLATMSRPPTSHLDLAFSA
                     AFRGTDLPGGRFWRASQSCDIFFWPDLAAVIVQAARAYFEGKERLGSLQVAEDITAHD
                     PRIAPAAKRAVAAAVGLWTALSELVGGPNGELESKVWGKQIPRAAAWEIRDVPKVPVI
                     GPDILSFFSAAVELPVLYIRARGGAHSRSAHWNNQSSAPAAGLAAIRIGMEMVRSLLV
                     IALPLSNFTLPEDLPEGSQNSIRAFVAHLMNCVATDKIMSPDVRVPVEESFYSHCLRE
                     IIMCERAFCYPCNPPPKW"
     gene            complement(124322..125011)
                     /locus_tag="GaHV1gp65"
                     /db_xref="GeneID:3239050"
     CDS             complement(124322..125011)
                     /locus_tag="GaHV1gp65"
                     /note="US2-like"
                     /codon_start=1
                     /product="virion protein"
                     /protein_id="YP_182400.1"
                     /db_xref="GI:57790996"
                     /db_xref="GeneID:3239050"
                     /translation="MAPVKVTIVSAVDSHYKLPNSRFELSDSGWKELVHAVKTMASYD
                     RPSTLSVIVRPASLYEVSGELFSLPRMCRPVIRFGEGGDPPGVSPEWSGLDAGFYHLS
                     SGAYAAKEFHLWVLGTADICMAALNLPAPKTFLITETGGKNFERGVEIFLVNGDKTTL
                     SLSHPSVWTTLAPSSLRTPWPYSTVKFLKVKPNSAAYCVSDSDDGERQPKFFLGSLFK
                     SKKPRSPRRRR"
     gene            125100..126530
                     /locus_tag="GaHV1gp66"
                     /db_xref="GeneID:3239063"
     CDS             125100..126530
                     /locus_tag="GaHV1gp66"
                     /note="US3-like"
                     /codon_start=1
                     /product="tegument associated protein kinase; PK"
                     /protein_id="YP_182401.1"
                     /db_xref="GI:57790997"
                     /db_xref="GeneID:3239063"
                     /translation="MRFRRICSRSRAEKRRRTTENPLTSKRVCVLDSFSRTMSLRPYA
                     EILPTAEGVERLAELVSVTMTERAEPVTENTAVNSIPPANENGQNFAYAGDGPSTTEK
                     VDGSHTDFDEASSDYAGPVPLAQTRLKHSDEFLQHFRVLDDLVEGAYGFICDVRRYTE
                     EEQRRRGVNSTNQGKSKCKRLIAKYVKNGTRAASQLENEILVLGRLNHENVLKIQEIL
                     RYPDNTYMLTQRYQFDLYSYMYDEAFDWKDSPMLKQTRRIMKQLMSAVSYIHSKKLIH
                     RDIKLENIFLNCDGKTVLGDFGTVTPFENEREPFEYGWVGTVATNSPEILARDSYCEI
                     TDIWSCGVVLLEMVSHEFCPIGDGGGNPHQQLLKVIDSLSVCDEEFPDPPCNLYNYLH
                     YASIDRAGHTVPSLIRNLHLPADVEYPLVKMLTFDWRLRPSAAEVLAMPLFSAEEERT
                     ITIIHGKHKPIRPEIRARVPRSMSEG"
     gene            126616..128487
                     /locus_tag="GaHV1gp67"
                     /db_xref="GeneID:3239064"
     CDS             126616..128487
                     /locus_tag="GaHV1gp67"
                     /note="sORF1-like"
                     /codon_start=1
                     /product="67Kd glycoprotein (gp67)"
                     /protein_id="YP_182402.1"
                     /db_xref="GI:57790998"
                     /db_xref="GeneID:3239064"
                     /translation="MTLPHRLTKRPFARRFCSVFVIHYSETKLDRYNKTMLLYRPDST
                     MRHSGGDANHRGIRPRRKSIGAFSAREKTGKRNALTESSSSSDMLDPFSTDKEFGGKW
                     TVDGPADITAEVLSQAWDVLQLVKHEDAEEERVTYESKPTPIQPFNAWPDGPSWNAQD
                     FTRAPIVYPSAEVLDAEALKVGAFVSRVLQCVPFTRSKKSVTVRDAQSFLGDSFWRIM
                     QNVYTVVLRQHITRLRHPSSKSIVNCNDPLWYAYANQFHWRGMRVPSLKLASPPEENI
                     QHGPMAAVFRNAGAGLFLWPAMRAAFEERDKRLLRACLSSLDIMDAAVLASFPFYWRG
                     VQDTSRFEPALGCLSEYFALVVLLAETVLATMFDHALVFMRALADGNFDDYDETRYID
                     PVKNEYLNGAEGTLLRGIVASNTALAVVCANTYSTIRKLPSVATSACNVAYRTETLKA
                     RRPGMSDIYRILQKEFFFYIAWLQRVATHANFCLNILKRSVDTGAPPFLFRASSEKRL
                     QQLNKMLCPLLVPIQYEDFSKAMGSELKREKLETFVKAISSDRDPRGSLRFLISDHAR
                     EIIADGVRFKPVIDEPVRASVALSTAAAGKVKARRLTSVRAPVPGAGAVSARRKSEI"
     gene            128651..129529
                     /locus_tag="GaHV1gp68"
                     /db_xref="GeneID:3239065"
     CDS             128651..129529
                     /locus_tag="GaHV1gp68"
                     /note="US4-like"
                     /codon_start=1
                     /product="glycoprotein G"
                     /protein_id="YP_182403.1"
                     /db_xref="GI:57790999"
                     /db_xref="GeneID:3239065"
                     /translation="MSGFSNIGSIATVSLVCSLLCASVLGAPVLDGLESSPFPFGGKI
                     IAQACNRTTIEVTVPWSDYSGRTEGVSVEVKWFYGNSNPESFVFGVDSETGSGHEDLS
                     TCWALIHNLNASVCRASDAGIPDFDKQCEKVQRRLRSGVELGSYVSGNGSLVLYPGMY
                     DAGIYAYQLSVGGKGYTGSVYLDVGPNPGCHDQYGYTYYSLADEASDLSSYDVASPEL
                     DGPMEEDYSNCLDMPPLRPWTTVCSHDVEEQENATDELYLWDEECAGPLDEYVDERSE
                     TMPRMVVFSPPSTLQQ"
     gene            129739..132696
                     /locus_tag="GaHV1gp69"
                     /db_xref="GeneID:3239066"
     CDS             129739..132696
                     /locus_tag="GaHV1gp69"
                     /note="sORF2-like"
                     /codon_start=1
                     /product="60Kd glycoprotein (gp60)"
                     /protein_id="YP_182404.1"
                     /db_xref="GI:57791000"
                     /db_xref="GeneID:3239066"
                     /translation="MGTMLVLRLFLLAVADAALPTGRFCRVWKVPPGGTIQENLAVLA
                     ESPVTGHATYPPPEGAVSFQIFADTPTLRIRYGATEDELALERGTSASDADNVTFSLS
                     YRPRPEIHGAYFTIGVFATGQSTESSYSVISRVLVNASLERSVRLETPCDENFLQNEP
                     TWGSKRWLGPPSPYVRDNDVAVLTKAQYIGECYSNSAAQTGLTSLNMTFFYSPKRIVN
                     VTWTTGGPSPSRITVYSSRENGQPVLRNVSDGFLVKYTPDIDGRAMINVIANYSPADS
                     GSVLAFTAFREGKLPSAIQLHRIDMSGTEPPGTETTFDCQKMIETPYRALGSNVPRDD
                     SIRPGATLPPFDTAAPDFDTGTSPTPTTVPEPAITTLIPRSTSDMGFFSTARATGSET
                     LSVPVQETDRTLSTTPLTLPLTPGESENTLFPTTAPGISTETPSAAHETTQTQSAETV
                     VFTQSPSTESETARSQSQEPWYFTQTPSTEQAALTQTQIAETEALFTQTPSAEQMTFT
                     QTPGAETEAPAQTPSTIPEIFTQSRSTPPETARAPSAAPEVFTQSSSTVTEVFTQTPS
                     TVPKTTLSSSTEPAIFTRTQSAGTEAFTQTSSAEPDTMRTQSTETHFFTQAPSTVPKA
                     TQTPSTEPEVLTQSPSTEPVPFTRTLGAEPEITQTPSAAPEVYTRSSSTMPETAQSTP
                     LASQNPTSSGTGTHNTEPRTYPVQTTPHTQKLYTENKTLSFPTVVSEFHEMSTAESQT
                     PLLDVKIVEVKFSNDGEVTATCVSTVKSPYRVETNWKVDLVDVMDEISGNSPAGVFNS
                     NEKWQKQLYYRVTDGRTSVQLMCLSCTSHSPEPYCLFDTSLIAREKDIAPELYFTSDP
                     QTAYCTITLPSGVVPRFEWSLNNVSLPEYLTATTVVSHTAGQSTVWKSSARAGEAWIS
                     GRGGNIYECTVLISDGTRVTTRKERCLTNTWIAVENGAAQAQLYSLFSGLVSGLCGSI
                     SALYATLWTAIYF"
     gene            132504..133808
                     /locus_tag="GaHV1gp70"
                     /db_xref="GeneID:3239067"
     CDS             132504..133808
                     /locus_tag="GaHV1gp70"
                     /note="US6-like"
                     /codon_start=1
                     /product="glycoprotein D"
                     /protein_id="YP_182405.1"
                     /db_xref="GI:57791001"
                     /db_xref="GeneID:3239067"
                     /translation="MHRPHLRRHSRYYAKGEVLNKHMDCGGKRCCSGAAVFTLFWTCV
                     RIMREHICFVRNAMDRHLFLRNAFWTIVLLSSFASQSTAAVTYDYILGRRALDALTIP
                     AVGPYNRYLTRVSRGCDVVELNPISNVDDMISAAKEKEKGGPFEASVVWFYVIKGDDG
                     EDKYCPIYRKEYRECGDVQLLSECAVQSAQMWAVDYVPSTLVSRNGAGLTIFSPTAAL
                     SGQYLLTLKIGRFAQTALVTLEVNDRCLKIGSQLNFLPSKCWTTEQYQTGFQGEHLYP
                     IADTNTRHADDVYRGYEDILQRWNNLLRKKNPSAPDPRPDSVPQEIPAVTKKAEGRTP
                     DAESSEKKAPPEDSEDDMQAEASGENPAALPEDDEVPEDTEHDDPNSDPDYYNDMPAV
                     IPVEETTKSSNAVSMPIFAAFVACAVALVGLLVWSIVKCARS"
     gene            133916..135004
                     /locus_tag="GaHV1gp71"
                     /db_xref="GeneID:3239083"
     CDS             133916..135004
                     /locus_tag="GaHV1gp71"
                     /note="US7-like"
                     /codon_start=1
                     /product="glycoprotein I"
                     /protein_id="YP_182406.1"
                     /db_xref="GI:57791002"
                     /db_xref="GeneID:3239083"
                     /translation="MASLLGTLALLAATLAPFGAMGIVITGNHVSARIDDDHIVIVAP
                     RPEATIQLQLFFMPGQRPHKPYSGTVRVAFRSDITNQCYQELSEERFENCTHRSSSVF
                     VGCKVTEYTFSASNRLTGPPHPFKLTIRNPRPNDSGMFYVIVRLDDTKEPIDVFAIQL
                     SVYQFANTAATRGLYSKASCRTFGLPTVQLEAYLRTEESWRNWQAYVATEATTTSAEA
                     TTPTPVTATSASELEAEHFTFPWLENGVDHYEPTPANENSNVTVRLGTMSPTLIGVTV
                     AAVVSATIGLVIVISIVTRNMCTPHRKLDTVSQDDEERSQTRRESRKFGPMVACEINK
                     GADQDSELVELVAIVNPSALSSPDSIKM"
     gene            135198..136697
                     /locus_tag="GaHV1gp72"
                     /db_xref="GeneID:3239084"
     CDS             135198..136697
                     /locus_tag="GaHV1gp72"
                     /note="US8-like"
                     /codon_start=1
                     /product="glycoprotein E"
                     /protein_id="YP_182407.1"
                     /db_xref="GI:57791003"
                     /db_xref="GeneID:3239084"
                     /translation="MNMLVIVLASCLARLTFATRHVLFLEGTQAVLGEDDPRNVPEGT
                     VIKWTKVLRNACKMKAADVCSSPNYCFHDLIYDGGKKDCPPAGPLSANLVILLKRGES
                     FVVLGSGLHNSNITNIMWTEYGGLLFDPVTRSDEGIYFRRISQPDLAMETTSYNVSVL
                     SHVDEKAPAPHEVEIDTIKPSEAHAHVELQMLPFHELNDNSPTYVTPVLRVFPPTEHV
                     KFNVTYSWYGFDVKEECEEVKLFEPCVYHPTDGKCQFPATNQRCLIGSVLMAEFLGAA
                     SLLDCSRDTLEDCHENRVPNLRFDSRLSESRAGLVISPLIAIPKVLIIVVSDGDILGW
                     SYTVLGKRNSPRVVVETHMPSKVPMNKVVIGSPGPMDETGNYKMYFVVAGVAATCVIL
                     TCALLVGKKKCPAHQMGTFSKTEPLYAPLPKNEFEAGGLTDDEEVIYDEVYEPLFRGY
                     CKQEFREDVNTFFGAVVEGERALNFKSAIASMADRILANKSGRRNMDSY"
     gene            136704..137486
                     /locus_tag="GaHV1gp73"
                     /db_xref="GeneID:3239085"
     CDS             136704..137486
                     /locus_tag="GaHV1gp73"
                     /note="US9-like"
                     /codon_start=1
                     /product="tegument associated phosphoprotein"
                     /protein_id="YP_182408.1"
                     /db_xref="GI:57791004"
                     /db_xref="GeneID:3239085"
                     /translation="MPFKTRGAEDAAAGKNRFKKSRNREILPTRLRGTGKKTAGLSNY
                     TQPIPWNPKFCSARGESDNHACKDTFYRRTCCASRSTVSSQPDSPHTPMPTEYGRVPS
                     AKRKKLSSSDCEGAHQPLVSCKLPDSQAAPARTYSSAQRYTVDEVSSPTPPGVDAVAD
                     LETRAELPGATTEQTESKNKLPNQQSRLKPKPTNEHVGGERCPSEGTVEAPSLGILSR
                     VGAAIANELARMRRACLPLAASAAAAGIVAWAAARALQKQGR"
     gene            137535..138419
                     /locus_tag="GaHV1gp74"
                     /db_xref="GeneID:3239086"
     CDS             137535..138419
                     /locus_tag="GaHV1gp74"
                     /note="sORF3/4b-like"
                     /codon_start=1
                     /product="putative protein"
                     /protein_id="YP_182409.1"
                     /db_xref="GI:57791005"
                     /db_xref="GeneID:3239086"
                     /translation="MSKCYCLARHLYKSPRCVGRRVAFGGLATMSRPPTSHLDLAFSA
                     AFRGTDLPGGRFWRASQSCDIFFWPDLAAVIVQAARAYFEGKERLGSLQVAEDITAHD
                     PRIAPAAKRAVAAAVGLWTALSELVGGPNGELESKVWGKQIPRAAAWEIRDVPKVPVI
                     GPDILSFFSAAVELPVLYIRARGGAHSRSAHWNNQSSAPAAGLAAIRIGMEMVRSLLV
                     IALPLSNFTLPEDLPEGSQNSIRAFVAHLMNCVATDKIMSPDVRVPVEESFYSHCLRE
                     IIMCERAFCYPCNPPPKW"
     gene            complement(138786..139622)
                     /locus_tag="GaHV1gp75"
                     /db_xref="GeneID:3239040"
     CDS             complement(138786..139622)
                     /locus_tag="GaHV1gp75"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="US10a-like"
                     /codon_start=1
                     /product="tegument protein; capsid associated"
                     /protein_id="YP_182410.1"
                     /db_xref="GI:57790994"
                     /db_xref="GeneID:3239040"
                     /translation="MENMLDGCYPLALMDSDHITAHAVPRGERRRQGAAVASSESADS
                     VDPCIRIASRLWRELVEISSELKDGYGEFTSARDRRNALIAANERLRSAFLGASRATR
                     GLGLRPRWASTESVANSPTDPNNGNGLGELEEAMEGIEGDFWLDSLDGDRFEDESRTM
                     QSENMRFVIEKELLSWLSRHLPADLASAERETSRSLLAAGHWCCLWHPRPCREACLYD
                     SIYVQSLFCVGTGRVPQSEMRRREYLAALRAGAAAANSPEVSASIFARDAGIALALAR
                     RR"
     gene            142837..147228
                     /locus_tag="GaHV1gp76"
                     /db_xref="GeneID:3239088"
     CDS             142837..147228
                     /locus_tag="GaHV1gp76"
                     /note="ICP4b-like"
                     /codon_start=1
                     /product="major regulatory protein"
                     /protein_id="YP_182411.1"
                     /db_xref="GI:57791007"
                     /db_xref="GeneID:3239088"
                     /translation="MSSDSSTPSNLAAPIVDESGFSTGPPSDLFTFLRADKSGRYDSL
                     GSPIPNPPNAPTCETTTDSFSYSTPPLFSSEDELFHSVIAENAAQDAAQDVDGREMSL
                     RDLIAMLNDMDPENINSIEPCPNATSDVVALDINVDTDQPGVYTVIDSLAHPCETPME
                     QQHVECPCPLPAVEKTTAVRRQEVVRKSERVARSRSRRPWRDLWSNRRPVPSPQRTSK
                     DRLPKRGKREFSKKMGPSHLTSSSSSSSSSFSLSGRRGRLARRLESAGSEKSTESPDR
                     DSAQLVLPGECPDVALEPLWRVLREWVETDGTDGSVQSVTAPTELPDLGRGITLNVLS
                     RALAVDLHSSEARVFVPEAIIPSPPSRGQVYHGSGYRQSLVDDPQVREAAAEFHANPK
                     SASVYLEEYGMPVEQLERLVEEFMVHPLSRVSYGYGGPKLSPRDKRLCELCALRGPGS
                     SEGGLSRSAVPTCLPHVAHAMRDGRVSLALPHLTELVRVCRRYDHPQKTYLLAALRRA
                     FVPFVFPGAAVDPTAASASGDHPVLVGARRIARATRELEAAAKEPPAATPEKLSSSAL
                     LRHTRTCIVAAADLMAALTAIDCPPVTINPAKRRPDLYQALSRAPKTVFTWERAMPYC
                     AASLWSRLVIGSLPLPSTDDVTLLVEAMEAAVGVLGCSDEGDVRPSIAYAASGWRMIA
                     TMLGDDSAPGSEHVTDDCPADDDTHHHDRRKRRGGRRTTCRYDLPPGTPDRAAHLLLY
                     GSPGGGDGAEPSAAQESPANPWPRAPPCDEQEPLSVSPYGPEPDRPPDDDFETRKGLK
                     RKSSEDHADPIPEGNATKKTCGLQGLPDSLPPAVPETDRDNPLLPPCPITPEGPPCPP
                     REEPQQPQEPQEPQSPSFHISEIGEALFHSTPVSPTILFAPEGFIPNQGDVYRPHGKN
                     LGVALSAGEPYVPAHRARPALERLANYLRGLSSGPAGSYSATGPADWLPAFARDPVAL
                     GEFCKRISPVNRGGRCVLEERLSWTLRHPADKIYDLIILVSERAPGEFLERAYAYAAL
                     CGRACMPGGACWPESWTRGEYPYIPPDEKDPGRSVAILCTTDLGYAGAVEWMLERALS
                     TSGRACVVVDARDPGDEDSRSGPRIPTGRRGVVYARTSPPSHAYLVKLFTGPAAERLE
                     RGGLNVGHVVMDRRLTVSWPLSVGKTDNDDEGTGDREKCPPVKHPFLTHVTLRRLRDV
                     ARAMDAGWSHSEIGKASAVLYPYMAQPHVGAGAMPPCPDLSESSSTMHSSSSSSSSSC
                     SSSSSSSDSSSSEEDGDEKNEKEDRERAGGGKRRGRQRLPIRDRVYRGRDYRVRTPCA
                     DIVGGTSASFRAVAAWGRDTVIPALPLAASWSDPSKIPQEVLRIISDYYPDAPGARAR
                     RNPLHVEGLALMRARNPAPLALLLGDDYSHYHTPRNRSPMCCCWSAPRGATPESLRCT
                     GHTRTRRPRLSVSSGRGETRTLVPRLD"
ORIGIN      
        1 ggattcgaaa cccctcgcgg ccgcgaccga acggcgaaaa aaatttcacc tcaatagaag
       61 cgaacgggcg ctggcgagat tcggcccaaa tcctcggata aattttcgcc tcgaaatggc
      121 gcgtttggcc ccctgccagc gcggccctgc gttcgtgcgc agcaccccct gccccgcggc
      181 aatcgctccc ctactttctg ttttacttcc ttggtatttc tacgcatcct gttttcccag
      241 aaccgaggcg tggtgttgct aagcagctcc tcggcatccg gtatatgcgg gcaagcaccc
      301 agcgcgagcg ccattaaaag cgcggcagcg cacagcagcc acactcccta cctcgctccg
      361 cttcttcccc gtctctctcc actgtcctct actgctgccc cttcccattg accctttccg
      421 ctcttccaca gggacgtcca ctcattggtt ctttgttctc tcttacaggg ttcgcagtgc
      481 gcttgtctct gacgggaccg cccgccgttg gatttcgcga ggctccgcag aggagactga
      541 ttggggaatg attgggaagc ttgtgccaat tccattcctc tttctgtctc caccgctgtg
      601 ccattcgcct ctttcctgtg ggtctcttcc aggtgctagg acgcgacccc tgcctaagcg
      661 aggctccgca ccggagactc agatgggaat gactgccgtg ttgggaccat tccattccta
      721 tctccctctc cgatgcggcg cccgccgtac cctaccgttc cgctttctgg ttgcgcaaat
      781 cgctctggcg gtgagcggcc caaatcctcg gctgaattgc aggctgcaat gacttcctga
      841 tttaattaat ttatccgagg atttgggccg aatctcgcca gcgcccgttc gcttctattg
      901 aggtgaaatt tttttcgccg ttcggtcgcg gccgcgaggg gtttcgaata ggatcagaga
      961 ccgcctccaa tccctctcgc ccccgcgctt tgctctgtgc cgcacacccc accctcctcg
     1021 ccgagcggct gccacattcc ctctctccga tagatccgat gcctctgggg gtccgtgcca
     1081 ggccggtctg atctgtgctt taacgctgac agccgagaat gtgcacgaag ccgccgggtt
     1141 ggcatgtacc tccgcggtcc ctgccttccc ccccacctcc ccccctcagc cgccacgcta
     1201 tccaagctct ccgaggtatc tgggtgccgc cagggttcct ccgcgtgtac tgagatccct
     1261 gaggggccta cccagatctt cggagccttg gcataccgcc ggcgcgcccc gctctccagc
     1321 atcttttacg tcccctactt gctgagaggt ggcccgcgct tgctttccgc tcaactgcct
     1381 tttagctcca cagctctaaa ccccggttct acgatactag ccgcggaagg ctgtgcgata
     1441 ggagccgagt acacttaagt ttatccgctc ctacgcagta gcctccgcca gctagcgtgt
     1501 agatactcca tcgatgcggg acagcaaagg tgcaggacgg caggacggcg acatttgact
     1561 ggcaggtagt ggcgttgcgg gaaagccgta ctgcccgctc ccgccggaga ccgagttact
     1621 gcgtttagag ctatcttgtc tctgggtggg ttcggagagt gcgggatttt cgggcatcta
     1681 gtctctgccc agtcgaggat ggtccatcca gctgtcgtgt atgtatagcg agcaatgacc
     1741 gtgtggttcc ctcatcacgg agtgctcgtt atgcatagat gcctgcgggc taggtcgcac
     1801 ttgctgggca gcggctaaac tggctagcct gcaaatagcc ctccgacctc tcagtcgacc
     1861 ctcactttag ggtcattgtc ggagcttttc cgcacaaagt acaagcccat tcactcgccc
     1921 tctgataaac tcaccagttt gctagccagt aacggttagt ttaacagtgg gcgcatgaaa
     1981 gggctacact gtaatccata cattcctttt taggatttgc atattccttt gcctgtgata
     2041 ccgttaccgc cgacggtagg tctagggtgt ggatacttct tgacctctct ttcggccgtc
     2101 acagtatctt ctggatatcc tcctcagcca tctcgacggc gggcttccca gcggccggta
     2161 ttcctaacca tgtctttgac gtagggaaat ccggtgataa aagttgaccg gtccctgctc
     2221 caaaggcacc gttgtggagc ctgcgatact gcactctctc tagtctagcc tccagcgccg
     2281 tggattggga tgcgggatat ctgcacgagg tcactctttc ctaatagtca tcgcatactt
     2341 tctctgggta actgaccttc acagaaagta cgcgatggca gaaggaaagt ctggtaaccg
     2401 cactttttta ttttttataa atcttcggtc agatgtgctt caaactgatc ccagtgaaat
     2461 gttgcggtag agactcagtg gatctggtcg gctcagtgaa aaacctgcac tgatctgtcc
     2521 aggtgcactg aagttcgact cgcatgtctc cgtgggtagt atatattttc ccctgaacag
     2581 tggccagtgt acacttttca atatactcct ctgttcagtg ggtaatacat tttaccctgt
     2641 tttaccctgt cggctgttgt gtttacagag ttccttaacg tgactggcgt acctctccat
     2701 tgcgagttgt tggcagctgt gactggggat gcagttttaa tctagtcata tgtctcccaa
     2761 gtcacaggaa cttaacaatt cgatcataca actgctatac agaacgagag caagtgctat
     2821 tcgtgccaat gcagtttcgc gttttcatta caaagacgtg acagtgcgtt gacaggaagt
     2881 gttctgcttt ctcgcgtcgc ctgcagttcg gctccatcat cgggcccgat ttatttaagg
     2941 taaacggtcg aggttctggt tatagtgctc aaacctcaaa agttagggga gttttcagca
     3001 caataaccaa gaatcttgct cgtactgcac gagcggaaca atggcctaca aaggtcgctg
     3061 cggcctgaag actacgtgac ttgccagcat cggaaatctt ccatacagtg taagcacagg
     3121 ccgcgagcta tgttttaata aaaaaacaaa cttttgaaag cactaagttt gtgttgagtt
     3181 ttacttcctg gcggtattgg gtgtatgcct gtgatgtatg cacctcctga caagtgatca
     3241 ctgagatgat agctttaatc ccgaatttgg accccaagca ggcatataat ataaatttta
     3301 agggtggaaa ctctgtaacc tttattgcgc aggccacaat tactgacttg ttctaggcct
     3361 acggctgcgg gagggttatg gagttcacgg tttcctcgtt ggaaacctta caaaagttga
     3421 gggacataat cacgcccggt gggtgctcct tgttttccca agcaggcata taatataaat
     3481 tttaagggtg ggaaactctg taaactttat tgcgcaggcc acaattactg acttgttcta
     3541 ggcccacggt tgcggggggg ttatggagtt cacggtttcc tcgttggaaa ccttacaaaa
     3601 gttgagggac ataatcacgc ccggtgggtg ctccttgttt tcccatctcc catggcaggc
     3661 cctgaagctt ttaacaaaaa caaccctgtg ggcctgccca gtaccctggc taatgcctgt
     3721 gatattgtgc tttgacctca gctggaaaaa gattattgtg tactcgcgtg cacaagcatg
     3781 cctgacgatt agcatccagc atattgggta ctttaagcct ttataaacct ttatagttcc
     3841 ttagataaat attgtgtagt cgcctattta ttcttctact taactgcggc actgctaggg
     3901 gcgccgctca gtccctgcaa gtctctaaag gcatcaatga tctggcatga cagcactgcg
     3961 ctgccagttc tgcatgttta acccgcccag ctcctatgct taggttgtca aatccggatg
     4021 agtaaaagaa cacggtgcag cgcgacctgt cagttttgca ttgttaatta aaacggtgat
     4081 ggacgtaatt actcaccgcg caaaacatgc catgcatgaa atcaacggtt tccagtagtt
     4141 ctggccgtgt cagttcaata actccccaac ctttcaatct tgtgcggtgg gattcgataa
     4201 aaatgccgga atttaaacta gaacaaagcc ccatatcata gaccagctgg aagtagtcag
     4261 ttgccgtaga ataagatgct cctaacatta ctttcaggct aattgggaga aagcatgttg
     4321 gaatttcagg aatttgggtc tgtccagtcg gtccttggag tcggacacag gacaggcctt
     4381 gcgtccttac acttccagat atgatgtaat attgcaaggc ataccaaaac atataataca
     4441 gtccatattt aactaatgat aataagatgg ttgcaacaat gtcgctgacc tgcattctac
     4501 aggtgacatt atgtcaaaac gcacgtggta tcttctagta cttgtatatg gagtgttcaa
     4561 agaattaaga agtcgcctta ggcgacttcc actgaccggc ctagcctttt tagggaagct
     4621 accccttcct aatggacatt ggggaagcgg aatgaccatt aatgactacc aggatatacc
     4681 cgagtgaaca attgaaaagt ggcatgaatg acttagcatt ccaagttcac tgctgcacac
     4741 aacatgctag ttcgatcatg cactcgcaac tggtacgagc aacacagttc ttgattggcg
     4801 ttttcgccgt ctatgggtgg aaagaaaagc atgttgtgac cactgcatac tactaactaa
     4861 taaaaatgct ccatttaata acaaatgtga atagtaacca gtaacagctg tatagtacat
     4921 cttcacaaca cctgtttaaa gtataatttg gggtcatcca gatattctaa atttaccacc
     4981 ctgatgcctg tttattgtaa tggctcactc tctgtatcat tgagtgtggt atctgcgcct
     5041 ctaacaatga gttggcgctt gatataaggc attatataaa ataatctctt gattaggccg
     5101 tgctgcaatc gtaatccctg gttccagaac atgctggaaa aacttggcct ctgtttgcac
     5161 tatgtggtag taattagtat atggatggga gtttgcggtg ttccaattta tttgttcaga
     5221 cccacagcgt acgtgtaaac ccctgacaat gcagaaatac tgatgatgaa ctagtgaggt
     5281 acatcttgac ctctgactat aaagaaatac tgatgatgaa tgctgtagaa cagaactaca
     5341 tctagatctg tgtcgaaaga cagtccactg gcgaaggagt ggttgccatt tgctggaaaa
     5401 cattttcaaa atggtatttt gacaattggc atcgtgatta gagcacgtaa caccttcaaa
     5461 tcccacgtat agttcaatgg tccattccgt atttcgatgg gcatgcggaa gtcggtttgg
     5521 gagtgctggt ttcattgggg tcattcttgt tttgatggat atgatttggg agtgttctga
     5581 ccaactacat atgacgagaa atgggcacca taaataggag agggggctta acacacccat
     5641 tgttaaaaat actcataaca ttacacagct attattggag cccacttgac aggccaaaat
     5701 tgtacttcaa aaaagtaaat cttgatatcc tgtatcctcg agcgtgacta tctgtaggag
     5761 ctttgctcca tagttatggg tgcggaatgt gtcagtattt agctattgtt atatttactg
     5821 ggcagggctc gtttatttgc ccaaattgag cagctcggac tacaatacga cctacaaaga
     5881 gctgacacag cacagtctct aacagctgtt cctggagtca tttaaacaga acggtaaatt
     5941 cgaactaaat cgggacagtc ccttcgcttg cacggagtcc aggtaacact gcggatctga
     6001 caataggatt ggtaagaaca agtgaagatg ccagctcccg acacgaacta gtgacctagt
     6061 ccagacgaaa atgcttaagc ttgtccttga ttggacaagc acgatgaaaa cgaaaccctg
     6121 catagatatt ggcgagctgg ctcctttaca cactctgcgg atgtagctta gtgggcgggt
     6181 atcgggtttg gccgcgctgc cggacgctgc tttgcttctt gctctatcta ttttatagcc
     6241 gggcgctttt aaagaatgga cttcgagctt tgcatgttcc ttaattactt taattctagc
     6301 aattctttta tttttagcta tattgtatct acagtggggt ccgtcatcgt agagaagccg
     6361 cagagaggct gctatttctg cttttaatac acaacattca gaacgatgcg ggcttaagac
     6421 ggaaccgcgc ggcacaagga gcataactgc ggggtcagtg tttgttgctg cgtgattgta
     6481 attctctttt tggcactgcg aggctaggtt tgttgccgcg cgattgcagg gtttttcttt
     6541 gtgagactgg tgatggggaa aagcttgatt gtgcaatagt aaaagtgact taggtacttc
     6601 atatactggg ctgtggcatg taggcacgtc caagctcggc tctgaattca agcttctttg
     6661 tcgaaccagt tttgttttct ttttggggga gggtagcaca ctctgcccga gtctcggcat
     6721 tgacttaaca gtgatgtgaa acccggaaga tcgagcatga actaatagca ttaaagaatt
     6781 gttatccgag gaataatcgt ggacgcgaat ttactcgacc gctaaaatct ttcttctact
     6841 gagctggata cgtgaaattt ggtgagtata acctctcggg atacatagct tttaaatacg
     6901 gggcgtgcaa tattaaattc tgcactcggg gctgcaatgg agcgcggagc tttatttgac
     6961 aagaccgcca attgcaagga ctgggtctcg gtcggaacta ctgtgtgggc ggatcgatgc
     7021 agatgacggg gacgacttag tctgggatta tgaaaatagc ccatatccaa gcatagtttc
     7081 ctcactattc ccgggggaag aaacggactc ggcaatttgt aactctgttg ttgccgcaaa
     7141 cccctgtagc atacctcctg ggcggcacgt ttggcgtggc catgctgctg ttttcgtcgg
     7201 ccagacagct cctccgtccc gcgcgtggaa gttaatgctc gccttgttgc cgcggttgca
     7261 ctgataattt tctcattgct tgtagtgatc tgtgttgcgt catattgggg gtaacatgtc
     7321 ttcagaggac acatcgggat tcctaacgcc ccccgcaagt gatgacgaca ctgacccttc
     7381 cgagccacca ccaaatttat gggatcctca ccatgacgat tttccgaggg acgctgattc
     7441 cccaaaccca cttttctacc cctgggatga ctctgtgaat aatactgggg atacgggcag
     7501 taacgaagat gactatgtag atatgggagg ggtaggtgga tccgaagact atgaagacct
     7561 cggtacgggc ggggactctg actatgacaa tgtatctaca gcgaccggcg ggacgtggtt
     7621 tccttccctt acttcttggt cctctgatga ccacggccca acttctccgg aaaaccctat
     7681 gcaacaactt caagtaacaa ttcagcagga ttcagatcca cagcaggaac ccgatcccca
     7741 gcaagttccc ggtctccagc aggaacctga cccccagcaa gatccacgag agcctcatga
     7801 tcctcctccc tatagtccgc ccccagagga cccttttggg ctctcgccat ttactagtgg
     7861 gatgggcggg tttgggccac cgtggcggtc gcagccaccc tcgtatgatg aggcaatggg
     7921 ggatggacct tttactacga ctgggggtcg cgacctcgct cacgcaggcc ggtcgtcgcc
     7981 ggtctcgagg tcgatctcgg cgacgcaatt ggtgtgcagc aaagttgtgc tcagaggcat
     8041 gtttgtggca tctcttttgg gttggagtgg ccttaatgtg ttggtggctc ttgtatctta
     8101 ttttgcgcat tgtctgggga cagactccgg gataaggaag gttgtatccg catccagtac
     8161 tcctcaataa aagcgtggtg gtgctacacg atgtctgtta attttacaac tccattttac
     8221 aggtgatcta gagagacgct gagtggcact tgtcccgacg ggaccatgca gtcgaacagc
     8281 agcgatcgag gcccagtgtg atgatggtcg aggagggatg gtcgtccata gctccaggtg
     8341 atgcactgga tacagatttc attccagggc cttgtgccac gtccatacat ggtatatcca
     8401 agacagttta tttttttctg tgtggagtta atctggagga atgtagtaca ctcccacagc
     8461 atgtccaatc tcacccatat ggacatcctg agctgaaatc aggcaaatgg tacaagaggt
     8521 tttgctccgg gctaggcgaa attggagata caagccagtg tcagctgaca cgactatgct
     8581 gcacttccgg aatgccggca cagatttttg ggccttcgag attcaggtct ctgcaacaga
     8641 agccaaccca tatgcgggcc caagatttgc tcactaggcc ttgccatata ctagagttcg
     8701 atgttggcgc tgacctaatc aatcttttct tgtatatgga accatgttca gggaatcgat
     8761 attgcgtaca tttaggatac cataaaacta atgccatgcg tgttttgagc ggtggtggga
     8821 ttctatgggg cagacttccg tggaaggaca acaccgagga gcacgggtac tcgttgccta
     8881 tgcgagtatt tgggatcaaa ttgccccata aagtttatgt ggcatgtcgc tgccctgcaa
     8941 ctcggacgga actattattt ggtgaggggg gggtaggatt caacgcggaa aactttaaac
     9001 agtgcggacg gttgaaaaaa gagtgtgaat gtctgcagaa ccgttgtttt actgcacaaa
     9061 cggtgttagg tgcggcatgt aagtttactg tatactcggg caagggacga ggtcaagaaa
     9121 ttctgctata ttcaggattc atgaatgcta caacggtaat gcctgtagta ctgggtatgt
     9181 taagtagaga accccacagg tgtgcaggta cactcatact gtccaggtcc tctggaaatt
     9241 gccgtggatt tcatgagacc caacacgata ttcccactaa cccgggtctg tatcctctgt
     9301 gtaatcatga gcacccttac tatgtgacag ttacagatgt atgcggcaac tgttgttcat
     9361 ggcttgagcg ggtttttggg agaatagctg cccctgctgg tctaagctcc gtatctgtat
     9421 ccattaaagg ctccacccac agcgggactg acgtgacaga agaacgtgaa gaggacccag
     9481 ggacacagca aacctcccac gacaaattgc cggagcgcaa ccgcatggga gatcaaaatt
     9541 cgaatttgcg gggaagagat caatattggc cgcctgcccc acaccgtagt cattgtcact
     9601 cggattttat attcgatgaa cctgagccag aaagtgggga agacgtgcat aacatgcatc
     9661 ccccacgagg tgcagatgag caaacagccg cttctgtgtc agcgctaatg caaagtctag
     9721 cacaagcatt ggtgagtgca caagctatta gcagcatggt ctctggctct gcttcctcag
     9781 tgggcgtaga agtagactgt gggtacagtc agactcatat tacagagggg ccggggaggg
     9841 aacaattcgg tagagtccca gaacgagggc cagagtatcc tcaagattac tgtgatatat
     9901 atggtcctgt aagtaatggg cctgctggat acagagcagg accagatgct cctagtatac
     9961 aagataggac cttcccatgc ggcagaagat gtgacgaagc atggcttgcc ttagaagtag
    10021 ggaatatgcc ttggatttct tctggttcac atagtccacc ttctcagtat cataaccctt
    10081 atggttcaca tagtccacct tcccagtatc ataaccctta tggtacatat agtccgcctt
    10141 ctcagtctca taacccttat ggctcatata gtccaccttc ccagtatcat aacccttatg
    10201 gtacatatag tccgccttct cagtctcgta agcatgacta ttcacctcca tatccgatac
    10261 tcaaaccaaa gcctcgatta cccccaggct ttgaaaatac tgctgggatg cggcctcgat
    10321 gtccccctgg gtttgagggg cgtccataca aatctggggg catgggtaac tttcctggaa
    10381 gtgcatggac ggtaatagat agggggtcta accaatggcc agcagacgtg cgggggccat
    10441 tctcagatca acgatgggcc cccacagagc atgaaacgcg acggtttttg cgggtattac
    10501 agctgagctc tcatcatacc cataactcca ctcataaccc aaggctcata aatccataac
    10561 tcataacata aattcatact ttccggtcgt ccagggcacc acgttcatca accaaggatt
    10621 tgcagactaa ataaaaatgc tccacgttgt cggtgtccgt tgtattgtgt tctttattat
    10681 acctccgtta attttcgaga gtcggggaac attctaaaaa ttttcaaccg tgctaatact
    10741 acagtgtatt tacaaggccg gattgcaaca gtgaacgctt acatcattga gctcgcggcg
    10801 ccatctgctg accagtcaca gagatggcaa tcttcagaaa cgtaggatgg caccaattcc
    10861 aatacaatac cgccatgtgt cgataggtgt atagaactgt caaacaagtc gcaagagaaa
    10921 atttccctac tgtatactgc ggcttagagc tgcgcacaaa ccactctgca ttcctctttg
    10981 cggcacacat ttgcgtgctg cgcagaacga gtgggatttt tttagaacag gtcccaggat
    11041 agtacatgtc ccacaatgtt ctggccgggt ctattgcttt atgattcatg actatggcct
    11101 ctgatcgcgg atacacaatt cttgagaacc ggtcgaagaa ggtcagtaat aaagttaaag
    11161 gacattttgc gctactcagt gatagctcct gagatctagt ggtatctctt agttgactgc
    11221 caatgctaga gagataacac ggcaggattg gccccagatg catggctaga gattgacatg
    11281 cgcagtagat gttagagaag ataggatcgt gggggtaaat cctttcatct tcgaactgat
    11341 gccaaagcat ccatacaagt gtctcatcgc atgcaaaaag tagctcttca aatgagcagt
    11401 tcgccaaata tacagctcgt gaaatttttg ccaacctggc tatatccgga cgcgatgtcc
    11461 agcggccttt cagtgaagct gcgcgcccac aaaactgctt ccacgaagtg aatgcagcat
    11521 cggctgcaag gtcagatgat cccgaagaca aaaatgctgg aaagcagatt cctctatcac
    11581 gatcgatatc atcacaatca tcatcatcca ctgcccggtt taccatgtct aaaagacatt
    11641 tctgattttc taatcttaac tcttcagtaa tgcactttcc gagaccgcca aatgcagttg
    11701 cggccttttc aaaatattgg gccggtgtta cgtttcgcaa ctccttcgtt tcggtccgtg
    11761 atgacgttgg gcatcggaca aagtctctcc aaatcggtct tcgaagttca tcccgatttc
    11821 tttcccaaga cctgcgcgaa tgcttcaacg aaacagtaaa gataggcgcc ctatatcgct
    11881 tttctggtgt acctgcacgg cgcctgggtc taggggggat gcctcttcgg acttggatat
    11941 gcgcacggcc tctcataaac ttatttcgag ggctactgac ccgccttatg gaagaccgta
    12001 cgctcatacc tgactggttc tcgtaacggg aacgaggcct cgccattcga acagcgacgg
    12061 cgccccctgt cacttgaatc acggactcgt ttggacgtac cgcgcccaga tgaaccggga
    12121 tctggagcta ctttctgtag aatgagatct gcggcgaata caatgtgctt cgtggcggga
    12181 ttctgacctc agcgtgaacg gccatccagg gcgatctttt gtccgggccg ttgctgatct
    12241 cgcttcgcta tgagtacttg tattgaagat gctctgaacg tgtctcacgc tatctttatt
    12301 tcttccagat ttctccggtc tccatcgcag tcagtgggtt gatgtaccgc gtgcacgtca
    12361 aaaaaaatga aaccgcatac acaacggttg agacttctac ggactcagaa caggtgtcaa
    12421 gctcggagca ggtgctgaaa ggtaagctga cagtaatctg gcacgctgtt tgcgagctaa
    12481 tccacttggc ttttgaatgg tctgggccac tcccagtata cgtcataaca catacactgg
    12541 aacccacaaa ctacaattgc gatccagtag ttggtgcgaa atattcacgc agacataata
    12601 atctgcgaga acttctgcgg atccgacatg taacttaatc ccgtaatgta gtgcggcatg
    12661 ccgtctaaac cgcaaacatc cgcttagtag aacacgccct aaaatcaccc acgagtatac
    12721 tttgtacatt ctgaccgcca gatgttactc ctttcaaaca atgatactca gccgttagaa
    12781 ctagggctgt cttcaaatgg accaaattca gacacaacac cgcacaacgt gttttaacat
    12841 tttattgccg ttcaaggccc gaacaatttg ttttgtatct tctgttcgta tttaaatgca
    12901 attattacaa tgctcgcaat cgcagccacg cacaatgcac gcaagactaa gctcgaagca
    12961 atattggcaa ggcatgaagt caagatactg ggaggtttcg atgcggagac tttagtcttt
    13021 gccggagtcg tgtaacccat cagtgataag agttctagaa ccgctgagac aattacatat
    13081 acccaagcac taatttttac gtgttcatgt aaaatatatg cacacggatc atagcaaatc
    13141 cgcaatgtca tggtggacat aataagcgat gctaaatata aaccgatctc gagtgttttc
    13201 agtactaaga cccctggatt acagatgcaa aagcctagag ggtctgctac gtagttcaag
    13261 cttttgcaat ctcggacatg ttcaaattcc ctcaaaaacc gttgcatctt tgtgtatggc
    13321 acccgtaata tcagcctcga agtaaacgct gtccagtagt ttagatgata tgcatccaat
    13381 cgcaatgcgt tctcgcggca gacagagccg aacattcgcc tctggcacgg gtcagcaagt
    13441 aacatatgta caataaccgt ggaaatgcaa ctctgatctg ggaaaaccat atgtaaagag
    13501 acagtctgcc acttccatga cgaatactgt tctttggcca gtgggatcag acgagaaatg
    13561 agtacagtct cattttcaaa ataagctcct ttaacacatc tcgtctggtg gttctcgtag
    13621 ttgtttagac gctgtgtata ttttgtgagg acataaacta gtgaagaatt aaatgtagcg
    13681 gggggttggt gaacaggatt gaattcttgc tgtccgggca ggagccattt aatatttgcg
    13741 agtacgtaca agcagtcgtc ctttgagtca gtggaaattt tagagcatac ataccatacc
    13801 aagaagacta tatgtatcgt tccggttaaa attactgccc attttagaca ttctggtcgc
    13861 agcattcttt ggtcagacgc actgtaaact gagtttgcag cgtgttgcct ccgcacttag
    13921 tcgcaaagca tttggtctga aatgccgcgt agggattgcc ctgtgagtta attgcaaccg
    13981 ctacagaagt aatgacggtc tgggcagcgg cacttcgatg cgaatgttta aggcaggtaa
    14041 aagttgcgcg ccctccgcac cctcgacgat ttcgtaatag tgatgcggta atgcgcgttt
    14101 tgagcacccg cacgtctcca aaactaatgt cgctgtattc gtgcgccaac gatggaaaat
    14161 gctcttttat gtaatttgtt atggccggca gaacatatgt cgtgagcaca aagactccat
    14221 cgatcgtatc caccccggct cctgtcctgt cttcgcacgg tgctaaattg acacgactga
    14281 atgcttccgc gaggctaaga gacacagccg tttggggcaa gttgctagag ggttttgaaa
    14341 ctccccctat aacgtcagga ggacacgcga ttcgagtgac gataatattt ggggtgggat
    14401 tgtctggacg gaaagcatga aaatggaaat tattagggtc tttgtgcgct gccgcgaaag
    14461 ctactttatc tgcacagtca ggggggaaaa ttataaacgg caggagtctc ccagacatga
    14521 atccggattc agaaaccttg gcaaagaaag gtagccggag acttcgtcct ggcgagtaga
    14581 ttccagtgtc aataaagtca tagtctctga taacatcgtc taaacattca atgatttctt
    14641 cctgcagtaa aattacgtgc tgagctagct tcgcgatagt ttttactgtc tctagaccaa
    14701 acaaagcata tggggatggg attgggacgc agactctgaa cccgagcttt tctttgcatt
    14761 tgcataaggt tgaattggca cgatcccgaa atacatttaa cgcatcctgt aagtcttgaa
    14821 cagagactat ggctccatgt tcactcgcat gctcatcaca ccatgacatt tcttctaccc
    14881 agccgctatc gcagaggtac atgttctctt cgtcttctat gtcatcagaa catgtattct
    14941 ccaaaaaatc aatatccact gaggaatatt gtgcgtcatg gctctccggg gacgagcagt
    15001 gacttttgta aaagtacacg ggataggtgt catgactgat tgatgtctcc ggaaacaata
    15061 aggctattaa ttggatcaat gccacgcgca cggcccgcat cgctttatgt aaggtcaaca
    15121 tcgttatggg gccgtgatct agcttgaggg gtatgtcgat atccagtatc agggattgaa
    15181 ttgctagaga ttcgttaagg acttcattcc tattcaggta catttgtgac agaccgctgc
    15241 aagatgcccg aattttattt ttcgaactag ttccccatgc ggtttcgttc attgcactag
    15301 tccaagcaaa gtctattact ggcaacatgg cctgatctgc gaggggggca tcactgcgca
    15361 ttagtaagca ggagtcgtgt atgctggtgt cagatcttac atcagcggtt ataatcgagt
    15421 cccactcatc gctggcaatg gctgcaaaag cctgtccgtg tccagccaat gttactctgt
    15481 aaacgggaca tggtccgttc ctagctgttg gtggaggaat gcttgtgggt ttcagagaat
    15541 ggaataagag tgtcactggt cgctttccgc aaataacttg atcagatgaa acgagagaaa
    15601 gtaacctact taagggagca aaaatgatat ctcctgtctt acagtattgc ccgtcgcgct
    15661 ctcttttttg tgcaagggcg tgtggagcgg aagcatcatc tccttcctct tcttcctctt
    15721 cttcctcttc ttcctgttca ttgctagata cagtgctcac atttctgacc agcatgtcag
    15781 ccaagtgtgc cccgtagcga cagagagtat cggaatatag acggtctata cgcgttgata
    15841 catcaaatgc ggaacgacaa aaaccaagaa aattgcgccc ctgtatttca ccgtaagatt
    15901 ttatagctgc aaacttccct gctactacag ccggcaattt catgacttgc atagtcacat
    15961 gctgtctgaa gtacgaagca aaattacaac attcccttaa gcttttaaaa aaatcacttt
    16021 gagcacgagc agaactctta actggattgg tgagattttc agaaagacat tgcaagtgtt
    16081 ctctaatcac gtttcgtcca tatccttcac tgtaagctaa atatacaaat gagatgaagt
    16141 cacgagctgg aagccgcagg gcatgtctgt atttgcagat aagtgcttcc aattgttctg
    16201 aatagcccct gtcggcgcta gtacgtaatc tcaaatgatc tctgaatagc tttgcagatt
    16261 cgcgagtggc atagtagctg ctgcaccaga atttagaaaa cgcagagaag gacgttaggc
    16321 gcgctatagt caggttactc ctgttgttgc tattctccgt ttgaaatgta atgcatagat
    16381 cctttactgc ttgaaggtca aacgtcccag caataccatc gtcaggggtt gcttctaaca
    16441 agtaatatct catggctgca acaagggtaa tttctgacgg gccgaatttt gatacgaacc
    16501 aaaaggggtt cgaaaagttc gagttgtaaa gcctcctgta tgcggcaatc acccttgact
    16561 catgctgaag catcaggccc tccagggcag gtcttcctct gggtagagtc gcatgtatgg
    16621 cagaaaaagg aattttgttg gttgtatttt ctgctcggaa aattactccg agtgcctcaa
    16681 taatgtccgt gtgcaatgca aatgtttcct ccaaatccat ggtttccagt aataactttg
    16741 catcgattgg aaacccttcg gctaaggctt ctctcatagt tgcggcccct tgaccgacaa
    16801 aacgacacac aaacactggt ctagacctct gcctgtactt ctccgctccg gtattagcag
    16861 gaaggaagaa cgtgattttg agaggggaat ctttgcaaaa atcttgcgct agagcgtcaa
    16921 catgactaaa ggccagaaca taaatttcag gctgcagggc ttggccgagt agaaggtgca
    16981 gggagcatac tactggatac ccatccgtag catacaacac gcgaatctct tcgtacgaaa
    17041 catcctcact agggggagcg ccgcagggtt cacaatatcc agcttgggaa gtctctgtct
    17101 catttagcat ttcgacgagc atccagtcat ctgcctcata ctcccatttg gcgtctggga
    17161 cacagtcgaa gttcatgata gcaaggaaat gtggcagcta ctgaagagcg tgttctgcgg
    17221 ccggtctaac tcagagagta aatacgaagc ccttccaact gggcggtgcc tgcccgtaga
    17281 tgatcgaaaa gtacagtcgg ctgtgaagct tattaaaatc tttatcccta actgcttgga
    17341 cgtcgaagat gtcatcggct cgagggatga acttaacaaa ctcgctcaag ccaggcaaat
    17401 tagccgcatt ctggcaaaat cggccgcggc tatgcagatt gctaagaata tgagatgccc
    17461 gcgaggagca gaggcggttt tgcggcaaac gattgtggac aatgggacgg tatttcgttc
    17521 tctgtactct gtactagcct acctatatct ctcccctggg gcagacacgg atggactact
    17581 tgcacaagta accgctcaaa ccgcagacag gacgatgatg ctaggtgaca tgaccgtgct
    17641 tacacatgca atgcacgtag acggaatgga tcgtgaccat agctctttgg aactactgcg
    17701 catgggtctg gtaccaaatt cagacctgaa agatccaatc gagctcgtgc cggtaattga
    17761 taaactgcct gacaaggtac tgttccctga tcccgtaccg acactgccag ttgaaaaccc
    17821 acccatggag cgtactagac ctgcaaagac acgtaaagaa ctggttgctg cgagttaagt
    17881 gacttctcag cgctttaata aagtatgttt aaattttcca atgtcagtac attatttgcc
    17941 ggtagatcca aaccccccgt caccccgaac cgacaacgta ttgcgttcgt ctactactga
    18001 gtttactatt ttccagcgaa gggcatctgg ctctccgaga aaggtgcttc tcttctcagt
    18061 aactattagc tgtgccactc ggtcacctgc gtgaatactg gccgcttcat ctcgaatgtt
    18121 agttagcgaa aatgatatcc aatcattatc ctgcacatgt atcgggtcga ctaacagtcc
    18181 tttcagattc atggaggatc tccctagtat gaatgcgcgc cagaaaggtc cgcatgctag
    18241 tttttgggga agggtaatac gggtagacga ctttggaaga attgttacat ctttagtagc
    18301 tctaatatca tagcctccat ctcctggacg tttgggggca aagatttcgt taaacggaaa
    18361 cagtgcggca gggcaatctg gatctgatcg cagctcgact gtctgatctt taacgagcga
    18421 tcgtgtagct ccgacgatga tatggtgtcg cacctgggct acaaacttga tgttcgatgc
    18481 gccacaaaaa cgattgatat tttctggcgt cgctccattc agtataacga tgcgttcatt
    18541 gcaggctgca tcttgctcct gcaattcttc gaatgttctt ctgtaaaacg ttgtacatcc
    18601 catacaacca atgttgcccg gaatagttat tttcgccctt aatatatctg gaggtatact
    18661 taaaagggaa cttatacatt tctcgaaacc ttcacccaaa taatcatctt cgccttggaa
    18721 agaatctgcg gtttctaaga gtaggcgcgc gtatcccgtc ccacacttgc taagcatgga
    18781 atcgttagcc aactttataa catttagccg agcccttaca gtgcctggtg gaaatataac
    18841 atttccgtct cttgtctctg tgccagtcaa aacattcccg ccatcgttta caagtactac
    18901 cagtattccc aataatcctg tatagtctgc atctaccaat cctggaataa tttgataaca
    18961 tgcagcatgg ccttccacat cactgataac gattccatac ccgactggca aagaagtcct
    19021 aatcgcagaa tcaattctta ggacgggaga gtcggtgcgt gttttcgcta ttgttgcttc
    19081 aacgtttgta atgacacatt gcaaggaatc gaggccaaaa atgtcccacc cagatccaat
    19141 ctctattaat gcattttttt ccgttgtcat ttccatctcc atgcaagttg cttagacgcc
    19201 aaaataacac cgaccctttc aggaaatccg cgtagttaaa atcggcagta gaccggtagg
    19261 atacaaatag taccgcactg cgcgacttag aggacccgtg aaagagactg cagggcgagc
    19321 tctcgcaaaa gagcaatgag gctgccgtgg gaaaggagtt ttatgctgtt gggagcagtg
    19381 gtgtatttgc tgcatttggc actagtattc gcgcaaccgg gtgtgacacc aggacacgga
    19441 atggagcatg ggtattatgg tcttggcgct ggaaatatgc ttggagcgga aaattcgatg
    19501 tatagcgcga acatggaaca cttttaccac agtgcctgct cgtcgcgcgg attttcctta
    19561 gtaaacggaa cagctgcttc cgttttcttt ttcattagcc tggcagtggc gttgattggc
    19621 ctgctggccg tgctatataa cggttgtttc aacagcttta aaagcagtgt cattagttct
    19681 cgatggtagc gcagtatctg ctgtaaagac gaaaacatcg gtggtgggac catattagct
    19741 cgaacactat gtcttactac aaagatctct cggaggaggc gaagaagtat cacgacgata
    19801 ctcgacggag gcgagatacc accacccgcc gccccaaacc accccaattc gaacacccct
    19861 ggtctgggcg aagaacatct ccatatctag atttggatag aggaagcgat tctgattctt
    19921 cagaagggga ttacggccat ccatcgcgcg ctcactattc gagagatcat acggcaccgc
    19981 ctcaaggccg ccgaagcccc ccgatggaaa gttttcgcaa agaaaccact ccaaaggagg
    20041 agccccctca aagtaaaagg ggctggaatc ctgataatca ttgcgctggc ctgatgcgac
    20101 gtttaactat ctctaaggga tttggtccta gtgctacacc ctcaggggat gaagacccat
    20161 ggcatacttc tactattcca gcaaatcgtt cggccttcgt gcaagccgtc tctgtgacgg
    20221 caatggccca ggcagaattg gcagcgagag aggtgtggga cgtaacaaaa ccacgcacga
    20281 atagggagtt gagggatatg gtgagagagc tagaaatcac tataattatc aatccgggtg
    20341 aatctttatg gtctgttgcc acttcggtgg caagagcaat caaagaagga accccaataa
    20401 cccacgagct attgcagaaa agaccatcaa agcctccaac ccgccgcaaa actgaagatg
    20461 gagccagaaa gagttcttca aggccttctc aacccaagcc tgagcatttc ccccctccaa
    20521 gaagaaagac atccgaacga aagtactagt ttcgagagtc tttgcattac tgtgttcctc
    20581 gccatatttg taacaataaa gtatacttat gattggtaac atgcgtgtat tgtcatgtgt
    20641 tcatagacta taaaagcgcc gtgatttaca tttctgcgca cactgcgcag aaccatggaa
    20701 gaagaatctt ccactggagc ctttgcactg tatgaagtcg aagacttcat cgaggaagta
    20761 gaatctgggg ctggggggag gtgcagcgat tttgaggatg atgcgactga cctaattgaa
    20821 ttagaagatc tctattttga ttggttacgg aatccaggtc cccccgcgct ggtcaatgcg
    20881 ccaaagtacg ttaggccttc aaaatgttca gcatcgtttc tcgcaaaaaa cgcgctaacg
    20941 gagctgcaat ttgccgactg ggacaaaata cagcacgtgt tgaagacgat aaacattgat
    21001 attttctcgt gtgtaccagt gggagaaaat ggtctatgca atatggattg gttttccctc
    21061 gatacagaaa aaatatggac gttaatggat tcaggaacac ctaatgttag cccaaatttg
    21121 ctgataacac ctggcccgcc acccgaatgc attaaaactc cagaagaagc tccagcttat
    21181 tttgaagcaa tctcgaatta ctttgaatcc gtgttagccg ccagagaagc cgaatatgca
    21241 aaattactgg cggagtacgc gaagtcgctc gctaaataca tcagacataa atcacaaaaa
    21301 gtagggcgcg gtctgcgagc cctcgaactg gacacagagg aggccaaaaa acgatttacc
    21361 gttctaatga aatccgaata ctacaaaggg atcgaaaaac ttctaattat atttctggtt
    21421 catttagtgc ttaacgcgtg tagggatgtt gctcggataa tatgggtcca acagagggac
    21481 tcctcgtctg tattgcagaa ggtaacgtat aggtgggaaa gccaacagct acactgtatt
    21541 tttcaaccat tacttgtttc tccgggtcca gtttttttgg acaacgaccc cttgccttta
    21601 cagactttgc agcatgtaaa ctacgtacga tatcttttag gagttccggt gctaagattc
    21661 tccatgatag aagaatcccc cagtgcacaa tatatccctt atgacaaaac tgcaccttct
    21721 gcatatgatg ttttagcgac tattgcacgt acttgcctaa cttccagcgg ctgttcgcgt
    21781 gcttctcacg accataccta cgcacgcgat aacgaaaaac caaactactc ctcctctcga
    21841 atcgtcttat tagctgattc cgcccttgat acacctatgc cctaaacatg accgcccagg
    21901 ctataaaaca gatggactgg ccagacaaca tcattgcagc gatggctgaa ggcgatgggt
    21961 ttgaagagcg tctccgcgct aaagcgcggt gccatcagat gaagaggact ccgattggac
    22021 tcctccaagt aatccttgac ggggcaagga aaattgatcc gaaacggatt ttagataatt
    22081 cttccccgag cgacttagct gtgttagctg agcgagagct accatcctcc ctgctaggac
    22141 cggcgcgcga agaatactta aaatttgggg ataaaaaact gccagacaac tttatctcac
    22201 gcactgtctc caatgacacc acggatgagt atagaagaaa tcttgacgaa gcgtttaaac
    22261 tctttattgc acgcagaggg gtcactgaaa aatgcgttgc ccgaatgctc agacatctct
    22321 atgccaagcg gttgtccgtg gttttggatc tcgatgtccc atttggtgaa aaaataaaca
    22381 aagcgctttc cgccgatgat caagattttg tactgaaact gtactactgg gttttcccgg
    22441 acaaggtctc tgcgcctaga cttaaggaac cagaaatgca agcttacctg gcttcagtaa
    22501 cctatttgtc gtgcaccttt aagttcattg aaggatacgc ttattatatg cgcccccctg
    22561 ggccagaact ccattcaaca gaaacgaccg ctcgtctagc agccctcctt gtatatgtga
    22621 gaagcatgta ctgcaaactg gcgtccttat ttgacgcaat cgatgccgct gtgctgcgct
    22681 ctaaatttaa taggggagct tcggctcaag ctctgactgg aatttatgga tacacgcgaa
    22741 acgggaaggg aactataatg tcgcggtatt cttcggaggc catgagtgat gaaatcatgt
    22801 ctgtgtgtcg cactggttcg gacactttga tagaatcttt acgcaaagct ctggggagat
    22861 tgacctacct tattgctagg tgggagctca tttcggtaga gaagaaaagg gacgcaaaag
    22921 aggccgtgac ggcagcgtta gcattaagtg gactagttag cggacatttg ggatacttgc
    22981 taaacctaat ctcaatggca tacgtttttt ggctccctgg gcattattta aatatgcggt
    23041 taatattggc gctgagttcc agggaactcc taagccatct tttggctaca aatccttctt
    23101 cattgaggga agtagccagc tgcccgaaaa tacttttcta ccaatctgta gaagaatgga
    23161 gaggacagga aagaggaaca cagatttggt tggattatgt tactgtaagg gcatggttgg
    23221 attatatcga cactgggatc cctactattc gctccgagga aacaaatgct tccataaatg
    23281 aaatttccga gtatctggaa cagcgacgct cggccagtcc tactgaatcc tttttatctt
    23341 cagatggacc accaaactca agcgcagcat ccctgccccc tacacaaggc tcaatgcaaa
    23401 cacaaaacag gagacgcgaa cgacgcagta acagtgtcgt tatccgaaag ccctcccgct
    23461 ctgcgcattc aaagagtaat accattcccg tgtttcagga aacgaccatt tcttattcgg
    23521 caccgaattc cccggcggat cattacgtag taatgaatta agcctgtata actgtacagt
    23581 aaatgcatcg ccaattttta tatttacgct ctgaataaat aatgacatta cattgacgta
    23641 agatgtacat aattcgtatt tatttacttt cctcgtagac tccgaaagac agggcaactc
    23701 tcaatgcctt aatataccgc aaggcaggcg aaatagcagg ggacatgtag catattactc
    23761 cggcggttcc agaacattgt agattctcga ctagggccac ggacattttt tgcgtgctta
    23821 gagatgcggt ggagtcatca tgtatagaat ttatgaagta aacgttggcg catttgccgc
    23881 catcatccgc ccaccatagt ccttgaggtg aagtgctccc ggaccaataa aataaccggt
    23941 ctaaaatagt gaggaagccg attgcttttg aagatgaggc aattttcccc ccgagggcac
    24001 ggcaagaaag tttagcattt tcatacgtgt cttgaggcgg accacccccg gcccgataac
    24061 atgaatccag atgttgaatc cagtcaggcg gacacaatcc gccttcccag gtgctgttcg
    24121 gcagtgcaaa tgccatgaca gtgcttatta caaacataaa aatcagtaat cctaggaaaa
    24181 tgccaagcag gattagaaga atcactttac acgccttcca atattgtccg cctgtatttt
    24241 cggggcgcat tgaatgaagc tctccggaag gatgggggga ataggtactt gtcgtagagg
    24301 atgaagtaga ggaacaaacg cttggctcat cttccaaaat agccctgact tcgaagggaa
    24361 gttctgccat cattttttcc aaatggcttc gttgatcttc agatggggtt tgtgaaatta
    24421 taggggggtt caggtagctt cgctgatctt cagatgaggg ctgcaaaatt actggaaggg
    24481 actggcctgc tgctatttca ggcatatcta gaaaatccac ttgggccgct agacgaagcg
    24541 agtaacgagg gcgctgcacg ctcgaatttt aaaaagaaca aatgtcattt ctgcgtatag
    24601 tttcggcccc gttatggcgt taacgtcaat atttcacgta ttatgttatt gaaagtggtg
    24661 tcaaggtcat cacatggtga cgctattgct taattgcgcg aaaaatgtgc gggcgcgaga
    24721 aactggttca tagcactcgg tgcgaacgtt acgtatgcag ttaccgccca tatcatgtaa
    24781 atcaggtcac gggactggat tcgtaaccta tgattggtgc ggggaggtct agaacaaaca
    24841 ttcgcacctc agtattaaaa atataatata gatatactat atttttaata ctgaggtgcg
    24901 aatgtttgtt ctagacctcc ccgcaccaat cataggttac gaatccagtc ccgtgacctg
    24961 atttacatga tatgggcggt aactgcatac gtaacgttcg caccgcgatt tcgagtaacc
    25021 gggagcataa ataccgcgtg cgtttggcac tccgtgcgca atatgcgccc gccactgccg
    25081 acgtcagatg ctgttctgat cgaaaggtta caggcgccgg aattctgtac aacctaacgt
    25141 agggcagggt tccggcgcca tacgggtcgc aagaaacagg tacaatcccc tttcccctaa
    25201 ttcattatgt caatattttt taggttgtgg ggcggcacat ccggcaggat gtcaatcgag
    25261 atttttgaat acaggtgatg gagggagtaa ccgacacggt gctggttttg acggagcgcg
    25321 acaggctcgc cctattcgga cccattctgt ttcgaggagg gggacttacg gcagcccggt
    25381 gggctgtttc agtagatgct gttctaccgt ggaccgaaaa aaccatcccc ccgttaaagg
    25441 ggtccaagct catcattgct ggggaacctt acttggggtt aacatcatct gatgttctct
    25501 ccaagtgtga agggaaaaca ttttttgtgc tcatcgctgt tccagcagcc ctcggacgct
    25561 ggatttgcgc gcccccgcca ccgcttctag agtccgttgc agaaaatgtg cgttgtaaaa
    25621 tttcagcaac cctatccaaa gagcatggag cgcccttttg cactgccgta tacattttgg
    25681 ggtcaactac acaggttccc cctggctcta gcttaggttg gtcttgtgtc gggcaacctg
    25741 tccttcgggc ccctttaaaa gaagctacca agcccgacga atcgttacaa tctgcagagt
    25801 gtgtatttaa gtgtccgctt tttgcggatg agttttcggg gaataacccg tttgcaattg
    25861 ggtttttgtg cgcactggac aagggagttt tgaagcacga attgtttgca gcaatttatg
    25921 cagcaaaaaa ggcaatttcg aatgcatcct tagacgggac attttgtgct tcgtttggag
    25981 ataaagagat gaaattagaa agtgtaagca cccacttagg gcctgccgtt gtggtaacgc
    26041 gtggggcaat tacagacttc cctccaaaga acgaatttat ggatcggctt acatgcaagc
    26101 gaaccttttt gcgtaaagat ggggactttc tcctgggatc tgcgttctta atgtgtaagc
    26161 gacaaaatag aacgtcgccg gttttacgca ggtggaaaag ggcctggctt cgagataggc
    26221 gaaggaaaca tttaatgcgc agggcaaggg tttcggtaac agctgagctg ggttgtcgga
    26281 ttttatcgca tccaagcaga atagcatcct tcgggctaga agttacagaa agagatctga
    26341 atttacagcg gaggctttcg gcacatagac cgagggcccg gggggtggta tatgaagatt
    26401 ttgattagtt acctgaagag acacgcccca aaatcccacc cacgctgatg catgccttgg
    26461 gcataaaata ctctgcgatc ttcgcagtgg tcaggcatac tttatacgct ccaacttcag
    26521 ttgtcatgga acagcggcga gacgaaaaag aagcggagga acagaaagta tctgcaatag
    26581 ccagtgcctt tctcaatgtg ggacaatttt tttctcgtgg gcaaacgaac aagtctcgac
    26641 cgtgggtcac atcatctgaa acaataaaag tttctatata tgcatggact cggtgcagag
    26701 actctctact attttcagat tacttgtttc gccgcggcac catggatagt gcccggcagc
    26761 agttgcaggt tggagtgcct aagaagggcg gggtgtacag acagctatca cgtgatgatg
    26821 gaacggtgtt cgaggtcagt ttggatcctg cagtgtgctt cgagttctca gtgacgttaa
    26881 ttttaccggg acatgatctt ttctggccgg tagtgccgcc gctgcaattt ctcgagctga
    26941 taagtcagcg cgcggttatt ctggcagacc agtttatttc gtcctctatc atgaagcgag
    27001 tgagcttatc tccaatcatg ctatttccga agaatacatt catgcccggg tactggtccc
    27061 cggatcccca gcctggtcgg taccgaccaa aatttcagcc tactcgatca gaacaacatt
    27121 tcatgaccgt cggcaagctg gtgccaccgt ttcaaattga cttgcatggg aaaaagaata
    27181 atttcatggc tggaattgcc gtgggttttc acggcccgcc gaccttgacg ggcactattc
    27241 gcgccctgac tgaacaagca attcacaacg ctgtggccga ggtggttcga acgcttgaac
    27301 cgatgactgt ggttccgatc actctgaaaa atggaactgg agctctgatg ggattgactt
    27361 cagacaacaa gggtcttcgg atattgataa aaccggcact aggagaattg gccaggtctc
    27421 cacgaagacg gcgttccgaa tcgcgcggaa gagagtctgt tttattataa attgaataaa
    27481 cgcagacttt ttattactgt caataattta tttattggtc tttattacac ggctccttcg
    27541 ggtaacatta tacacgactc gattgcctct ctggcaacca ctaccgcgtt ctgcatagta
    27601 gggatacaca gttcttgttg ttgcggcaaa acgaccaaaa tgcctggcaa aaaactgcaa
    27661 aacctgtacg gggaatctat tacttgcgcc ccggccgttg taaaatctgg cgttggtcca
    27721 ctttctgaca acatggcggc ggcgtaaaaa ctcacgtttc caagaatcga ataggacctg
    27781 tcccatctca agtttgcgta ggttgctgcg gagagcgcat cggggagaga cagggattcc
    27841 gcacgcgtga aggttttagg ccataatctc agatatggga cgaagtattg ctctccgaga
    27901 aactcttctg ggaaggcgat tggggcgtca aatattccaa tgcgtactct tcgcgttaga
    27961 catgttccgg aaaaatatat cggaatgtca agagatattg gggaagatgc tcccttgcag
    28021 cgcttttcgt ataaaaagcg cgggcccaat atttccacta atattgcctg tagtgctggt
    28081 gcaaataaag ggtcgcctgt gtgatcaaaa gccgattgaa tcccctgtat ctcatcactg
    28141 gtcttgccaa agagttccgg tagatgctca ggcagtatgc tgatgtgatg ataagatctg
    28201 ttagaaaata tccaacaagg gccctgagca ctaggagtag gcctttgctg tcgtatagag
    28261 tttccgtgtc gttccttgtc taccatactg tcgagaagct ggttcgttat ttcagcattt
    28321 tcttgtggtt catcatcttt tttacgccgg agtgtttggc gtatccagcc actccgaccg
    28381 gagtgggagt tcttaactga aggtaatgat ggcgcgggtt tcagcggagg ggaaatcggc
    28441 ccagatattt ccagtcggtg tagctgaggt tccgatcgag agaagcgctt gcggcgtcca
    28501 aacggcatga atttgctcag ccagcccatg gtgtctcgcc tagagagttc tgagtttcag
    28561 agcaggctct cgcctagaga gttctgagat tcagagcaga ccctcgaacg cgttcgaggg
    28621 cttttaggtg cttgttgcat ggggcgtgta ctgggcgtgg atataagaca tgtgcctcga
    28681 cgcccgccac gcacgatttc cgcagacatg agttccatgg cctgctctcg ttttcagaaa
    28741 ccaaaagcga agaatgatag ttcgcccgaa aaatgtgaac gcactgccaa gcaaattgtc
    28801 gcagcaagtg attattgcaa tgattcggaa aaattagagg aagagatggt cttcgtcgga
    28861 gctggaaaga tttcatattc ttcgtggatg tacgaggcaa ttttttcctg tgattgtatt
    28921 cccgacggat cagcgtttgc agttgctaag catgcagtga tcctaaatcg cgtaaacgga
    28981 ggcttgccat cttgtcttgg gagtgcacat gggttgacca tttaccctgc caggacaagc
    29041 cagcgtggaa ggttcagccg tttagcatac agaaatgata tgtccccagc tccacaatca
    29101 gaaaatactg tcgatgtgga tggagagctt ggagcgtgcg ccatcggcgt gttggagatg
    29161 ggcgaagaag tgtgggcaca tgaagaaatg ttttttttac cggtggttcc taagttagat
    29221 cgcatgtggc cgtgtgttcc caatcctgct ctgttttggg gcctggcgcg cgcgcttaac
    29281 aatcttcccc ccaagatact cgtttcagga aaacttgcca aagggttcat ttgccctcta
    29341 tactatctta gcgtaccaac ttttggagaa gagagcaaag aaactttcct tcgcacgaga
    29401 cagaagcagc gaagtctata tgaccctttg tttgaccctg cttcattact tgttcagcca
    29461 caattttttg gatgtgatgg tattaaggat tctaataact ttcaagctgg gcttggcata
    29521 gttttccagc ctcaggatgg atggacggca aaaacaaagc tgctcgagtt ggacagagtt
    29581 cggtcggaac ttgtcacact atttgcacgc caggagcagt caaggcctat taccgtgata
    29641 attactaggg gggcagtcag acgccggctt gtgttttcta ctgttggagg gtttaggttt
    29701 tcatcctcgt tcgaaccctc tgggacaccc cttaaaaccc actcggtgac tttacatatt
    29761 taatggaaca cacatacgaa ataaaagttt gtcagaaatg tatttgcgtt tattgatgtt
    29821 tatgtttcgg gtaattatcc aaacagatca ggccgcgtcg caattcccat gttcttccat
    29881 gcttcggaca ctgctgtgca agcagccgtc ttaaaatcgc ctatctcatc gggggtccaa
    29941 tgagagtgca ataaaatgcc gagtctaggt ggatcgtacg cgtggcaaat tgctgcgcac
    30001 agaaacttgc cgcacatggg agtttcttct aaaagagcgc gccagaaggt aaagcctcgc
    30061 ccagtaagcc agctagtagc tcttgatgcc catgtatcta ccgctagata tgagcgttcg
    30121 tccgatgcca atacccccga aactgggaaa aacgcgcaaa gaatgtgagt tcctttcgga
    30181 atcgaggctg tctgctgtgc gcgcggtgga tgtatttggc tgtcgccaat cgcaacacaa
    30241 aacgggatac ggaaagccca ttcttcgcgg caagtaatta tcggcgaagc tatctgtgat
    30301 cgatacgcgc gtaacccagt aaatatcgcc gcttgtagta gtccgacggg cgagtgatgc
    30361 gggctgtctc cgtgctttaa atcaaggatt tctccgctta gagtaagtga tggaggactt
    30421 tgaaagaaca aggccccgct gaatgcgcgt acagcagcaa caaccggaga aagttccaaa
    30481 tccgagataa gtcctaacat tagaaatccg actccatctt tccacttgtc tgcagacaac
    30541 agtttaaaag gcaaatactt ggctccaaaa gtcatcgggt tttttgaatg cacgctatca
    30601 gctacggctt gccatctttg gaaatttttt aaggaagctc ttttcatggc aagaaggagc
    30661 tgctcgacgc caatctctaa attagaatta gttgtgtagg gagttctagt catgataatt
    30721 gcagtagaag gaattccagt gtcgttggaa agggattctt gcggatcctc aaataatggt
    30781 gctgctacga atcggatttg agagttatcg ggctgttttg agtcatggtc ttgaaacaca
    30841 tgaatagtca aatccttgtt gcaatccaga aaaaacgatg ctgtgccgtg cagtacagct
    30901 aggccatatt ctaccttttc tgtccatagt tttccacgat gtgttcctaa ttccatgtga
    30961 gacgagtcta caaagtttgc gaggcagtga gttactgcaa aacgacattc gcgattgctg
    31021 gtagacagtg ctttggaagc ctgagactgc ttctttgacg gagccatagc cagttattcg
    31081 tgctgccgca agtgcagttg aaaagggttt gtaaggaaca aggattaaag ttcgctctcc
    31141 tcgtcagacg gtagccgtac acgtctaaat tgcgttgccg agctgaggca gaatttatat
    31201 atagccctga tggcactcca tagagcaacc aatccaacaa gtgcccctac cacaataccg
    31261 ataatgtatg ccttgtcaaa aactattatg cttctgtcaa gtcctaaaat tcggacagca
    31321 gttccgtgtg gtcctagaag cgcgtagtta tagaactcgg ggttcataga cttaaaaaat
    31381 gcaatagatg agttggcacc ggctaacagt tctgattgaa catatgcact gtctataaag
    31441 aaagcatcct ggaacccccg tagaccgtat tgaactatca ggtggttgca atatatgcaa
    31501 gttttcgctc gtccattcaa atgaccatcc tccatttttg ctgttcgcgc gatttgcggt
    31561 agggagttgc aacttgaatt cacaaacgtt acaaacaaag gggcagctgt tgaggtatcc
    31621 ggaagtctgt aggtcattcc agtgctcggc gggctacttg tcatcaccca actagaatgc
    31681 gcggtaacag ggaggaaaaa tacgatgtgg tgttccaggt cccagtttaa acatttcttt
    31741 acctctggaa aaaacgcagt tgccaggatc tgaggggtca acagagcttg tggcggtatc
    31801 ggtgcactat atgatggcaa ttcaccttca gatgataaat atattttggt gtaaaaaaat
    31861 cgaaatggag cagatgctgt cagaattatt ttccatggtg cacttctgga aatatcaaac
    31921 cttgtcgcaa ttgcacaagg agaaaaccac tcttcaattt tcgatgcctg tcctttcttg
    31981 aagctcccgt ctggttggga gtgaatctcg ttgatatcgg ctagccggtc gacagagcat
    32041 aaaattgtca tgcgcctgag gaagttcctt ccatgttgta tagaaagttg aggagcccgc
    32101 aaaataatgt acgtagaaac tgccaataac tttctgtacg cgggggtcat taccttttgt
    32161 gtaatgattt ctctgtaact gttatctatt atttcaagag ccagttggct gggggtcact
    32221 ccatcgatgc tcgccaggaa tgcattttgg ggatcttgtt ctgcagtgat aagcaccgca
    32281 ttcatgatag taagaagcag gttatgattt tttatcatgg gttcccatgg cctgtcgtgc
    32341 ataattttaa gaatactgga tgggatagaa gtaagagcac caccgacatt ctgaataaag
    32401 cgaatattcg ttgtatagtt tactgaattc gcccccccaa aacacactgc gacttggtct
    32461 gcccatgttt gcgtttctgc aataaactcg acgatctccg aatcagttac gtatgcatcg
    32521 atcgtaaact ttagaaatcg aaaccacgcg gccataaacc gtgctgcgaa tcttacaaaa
    32581 aaagactcgt ctatggtatt cgggcaacct gcgattgcga ccttctgcaa agttaaaaag
    32641 tgtcccgcgg atatttgttc gtcgaagctg gccagctcta agaaatcttg agcagcggtc
    32701 gttactgctg taaacaaatt tggccgataa tttggtccag ctgcgacgtt gatgcgcaca
    32761 gttaacccct gatcttcagc cttcagcata tagggccatg acttcaggga cgtttcttta
    32821 accttcgcgc tggttggtgt aattatcatc tctatttgag gagaatgctg ggtcgcgatt
    32881 ataagggtcg ccacattcag tccgatgtta atcttaagat ctatgtcact agtaactgcg
    32941 aggctaatat atcgtgtaaa cacaaatgga aaaacagttt gtaaaggatc actgtaaatt
    33001 acacgaatcg gagcgatgat gctctcgccc ctatgaactg agttatttgg tggaaagttg
    33061 acgagtttcg cagatgtaag tgcattcccc ttgtatccta ccaaaagtcg atgctcaagc
    33121 tttggatcgt tgctgaattt tcgtggttgg atggtagcct cgctagcaga accccatctc
    33181 gagtaagtat aggctacgta cagttgtcca agcaaatcta gagcgatcga taaattcctg
    33241 ttagcgcttc caggaggccc aaagattaag tttcgatcga caaggcatag ttgtgtgatg
    33301 tggccgtttt cgactgctgt cgctatcgca atgaattctt tcggaggggc caaattttca
    33361 ctggtggggg gcacgaagac aatttttgcc tttgccttgt catccccttt agctctaagt
    33421 aatatcgcca gaatgaggaa aaatatttct ctcgcgtgtc ccatcggcgc gggttgctgg
    33481 tgaagccacg ctctctcgag taagaatgag tacaaagcaa ggaaatgagt aaaggacata
    33541 ctcttattgt gaaggattat ggaagcggaa cattacgaac ccatatcagc attgtagcgc
    33601 tctactgcgt caattaagct cgcgatcgcc gctcgtttgg ttgtaagaga acttgccgtc
    33661 tcggcaaact ctaaacattt cagtgcacat gcctccgggg tgaggccatg tgctggtaag
    33721 taaaaaatgc acaagttttt caataccgtc gcgagttttt gaaccacaaa tgaaagtaca
    33781 gtttttaatc tttccccgtg aacattttgc tgatcaaaag ctaatattgc aaatagcgtc
    33841 tggtcgattg aaggattgat ttctggaaca gtagcagttt ctaagcactc tctcttgaat
    33901 tttaagagcg tggcacttgt taaggcttct tgctccttca acaatgctgg ataagatgta
    33961 cgttggaggt aggtggtagt attcatgagg cagatgtacg agttacgtaa tgcacacaaa
    34021 tacgtccagt cgaccgtttc ccctgggcgc cccctttgta ttatacgccg tgcctgttcg
    34081 caaatatcca aatccattaa aacaatgttg gagtgtgttg gaatgtcagg aattcctgac
    34141 aataaagtta ttaaatctcc aaattcgagc gctccgctta gatattgtgc aacagggaaa
    34201 cacaaacatg ccgcgagtgg gtgcctatct acgaggaata agacatcatc tggtccggat
    34261 gcagctgcgc tgtagcagcg ttcagatccc aaataattat aaatgacgtg gttcattatt
    34321 cttagtgggg cagcaatagt catctgaact tccgctacgg caaccggaga cgcctcccga
    34381 cattcaagtt ttccggaagc ctttagggtt tgtatttcat taatttcttt gatcatatcc
    34441 gctccgccaa accattggcg ccatgcttgc ataggttccg ctaagtatag acggcaacct
    34501 ctccaatttg gcatttgcat caacgtcttt gcagtgactg ttttaccgac tccgaatggc
    34561 ccgtcgacgt aaagaagtac aacgcggcga aagtcggagt catcgttctc gaactcggag
    34621 caaaactgca caccaccgga agttttcacg gcgccagcta cggccatctc tgcgggctag
    34681 actaaatgcc ggaatccgtt gccataatcg cttttaccga gctctcgtca gatcactgga
    34741 ggaagtcttt gaagggggtg gagacggaag gctggcctat acgataattc cccaatgcaa
    34801 acctgccggg ggcaaaattg tagtcatgtt tgaagtgaac ctagggttgc ggaaacctga
    34861 ttgcatttgt ttgctggaga cacaacatga aatgaaatgt attgtgattg aactgaaaac
    34921 atgtcgtttt tccaaatctt tgatgactga aagtaaatta agacaaggat atactggcac
    34981 tctccaactt cgcgattctg cacgattgtt ggagaatctg gctgttcctg gcactgagaa
    35041 agtaaagatt ctttctctac tggtatttgt tgctcaacgg gggatgaaca tcttggcggt
    35101 aaaaacggtt ggggaaacgg ttataaatgt atcgtctgag cttttctttg tcactctagc
    35161 taccagaagc cagtatttaa agactttctg cgcgaaatta gagccacgcg tgtcgcatgc
    35221 gcgcagtaag tatcaacaag aaagtgcaaa gaatgcggat ctagcgtctc ccgccccttc
    35281 agccttacaa accgtagctg cattgttttc gtcgcgcgtg ggaaaagagt ccgcaaccaa
    35341 acccgcgagc tattccactt ctacggagga gtccaaaaac ttgtccgaac catgtttcga
    35401 cccagattcg aacctatgaa tttaccaaag gacagcaaca agccgtctac cttgatggtt
    35461 ttagccgatc gtttaaactt tatctcctgc gcggaaggct cgagtaaata tgcatctaag
    35521 cttttcgaag gaactctaat agacgcagaa atcatgacca atcgtgcaag gattgaagat
    35581 ctggaaaggc ggaacagggc tgccaaggca gctttagagc aactggaaaa tatgagcgct
    35641 actgttcccg tacatgtctc atcggcattg caaactattg aatatcccct agagactgta
    35701 attgatgtct tggatgattt agcccagcgg gccgtgcagg agaaggacat tgttgggtct
    35761 tataaaacac tagacatccg tgcgcctggc gaggatgtcc ctgcgaacgt aatttggata
    35821 gttaagaatg gagaaccatt aacttttaat acagattttc aagtagattt tctgacaact
    35881 tcgtttgcta ttgctggcaa tggccggctg ggattcgggt cttggtttcg cgcgctacag
    35941 actcagctcc tagataacaa taaagctatc gctagggttt tgaatgtaat gggagacacg
    36001 cgcatctcgg ggcggtttat gaaaacggct attcgagcgc tgcgatcggc gatggaaatt
    36061 tatgctggga ctcgacaata tagcggattc gaggctactg ttttatgctt actgcactac
    36121 tcgcggtcta gacaatctgc ttcaaacatt agacatggtc ttgatgtttc tatatttgaa
    36181 gatgcattaa gacatgttcc aacgtattta aattatatgc tggaagatat tcgggccgag
    36241 tggggctcag ttacattttc atttgaccgg tcaaaactcc ccgtaaactt tttttcccca
    36301 attgacggca gaaaatattc gaatggagtg ttcgatcctc acatagtgta tcaattgcta
    36361 aagcgtactg ggaccctttc caccacagta cgagatataa cgaaagaaac tctgcttcca
    36421 atagatccag attttgttcg ttttgatgac cccattgctg ctctctccat ttcatttttc
    36481 ccttcgagac gaacgccgtt aattcttcat gaagatgatc cgcttgtgcg aacggttata
    36541 gactcgatat ctctgctcct agtcttgcaa aagctaatgt ttaatagtaa tgtctatacg
    36601 agcacacatc tcaatcgatt tcagccatct gcgttctttg aattgccact tggaacccaa
    36661 tcggaacagg aggcagctaa atggcccgtc gcccctgggt caagacctca agccaccgca
    36721 agcacatttg atgacaatgg acaagatatg gccagtcgcg acaacaactt gttcttttta
    36781 ttcgagaaat atgttgtacc tatgtataga tatgacaaca gatgtgaagt tactggtttc
    36841 tttcctggtt tagctgcact ctgcataacg gggcgcgtta aaggaatacc gacagcggta
    36901 cggttggggg agtactattc ctccctctgt aatctaattg agcttgatct cagaaaaacg
    36961 tcacatgtgg gtagcggggc agctgctgtt ttggcggtac acgattcatt gacaggtgac
    37021 gttgaagagg gagtgtccag gttacttgag gtatttgatg caaaaaaagc atttgaaagg
    37081 aatattgagg acattcaacg tggagtctga ttctgacctg atctatttta tgtgtcttgg
    37141 atgcttgcca catcacgtga catatggata atgcttagta ttttcgcgat cgcgtctctg
    37201 tttagacaat aaaagggtta tatctttctg atcagtccgt ctgttttgtc agtgtgttga
    37261 tactttgcgg gtcgagtcgg tctcgctatg tcggagaacg tcgacatcaa atatatcttc
    37321 gttgccggct atttggtagt atatgaccac caagaaagtg ccgggcgaga atatgagctt
    37381 actcgcgagc aaagcaaatc ggctttacca gttttgcctg gaacaattcc gataaacatt
    37441 gaccacgagt catcctgcgt ggtaggtaca gtgctgacga tcttagacct gccgagagga
    37501 ctgttttgtt tgggtgtcgt gtcaactgct cttgcaccta tttttttaag ctacgtgcaa
    37561 gatgatgctc tttttgcgaa tgccgaagag gggatggttt tgacggagac agagaaattt
    37621 ctctatcttc tcagcaacat tctaccttct ctatcgctct cttcaaggcg gcttgaaaag
    37681 aacgaagtgc ccggaaaaga tttttttgca cacgtggcgc tctgtgagtt gggtagacgt
    37741 gaaggcacgg tagcaattta cggggccacc gcttcggaag ctattggagc atttgatgat
    37801 ttgagcgcac caattaaaga acagctgtat gaaatagcta cacgtgagaa atgtgcagaa
    37861 gtccctagag agttgtcgcg accagaaatt acgcgagtcc tgatgaagaa atttattcac
    37921 ggggcgtttt tgatggatag gggtacctgt ttgaaaacgc gacgcgagat ggcagctgtt
    37981 tacaacccga aatatttaca agcgaatgag gtaataacca tagggattaa ggaacactcc
    38041 gaagagactc ctgagaatgc tattaaagac cgttcagttt ctacgcaaac ggccccaagc
    38101 ttcgatataa gcgagagtca gcaaccgtcc gggcaaacac acgttccagc catggagtcg
    38161 gcgacatgct ccggccagtt cttgcaaaca aaaaacggag cttcaccgtc cgcatctcgt
    38221 gaagatatgg tctatgtccc attcgagaag tatgcgagtc ttcttgcggc atcagcccgc
    38281 agagataacg accggagacc cgtgtcgcca tcacgagagt tttcccgtag gtcgcgggac
    38341 tctactcacg aatgttcacc aggacgtgat atttggccgc gtggattcga acgacaccct
    38401 cgcctagaat cttttatggg tccggggatg aaccacactt acagaccggc tctttacgaa
    38461 gacccaaatt tctgcgggcg tttcccatat attccttatc aaagccccgc atctacttac
    38521 cccgtgcatc caaattatta tagttcgaac ttcggccagt ttcctggggc tggaacgtat
    38581 cctatacagt atccatcatt acatgagcag actgttgttt cacgcttaga tgccttgatt
    38641 tcggctcttg agaaaaataa taaacgggat agcgaatact cggagaataa ccctcggaag
    38701 agatccgcta ggaccatttc tgagaatgac ccgtacttcc ctggggaaat ggttccagca
    38761 aaaaagataa ctacggagca gcagctatgt gaaaaaaagg aacccgttgg tagcggaatt
    38821 aatgatattt tacaaggaat tctgaccctt caaaaagagg ttgccggtct taaatcagct
    38881 tccaatgccg attcgtcttc agagagaaaa gaggaactag aaaatagtaa tcaagagtct
    38941 gctcgggaga cagtcgatgc ttctatgcca aaacgactga aagatgctca gacaaaattg
    39001 aaaagaaaga aagaagcagc cgcatttgcg caaatgatgg cagactgagt catgtgaata
    39061 gtaatgtcat tttattaaat aaactgcatt taaacttatt cgtcttcgct ttcttctgcc
    39121 cacgaagggt attcgagcag ggggtagtca tcttccttgg ttcggggttt tctgcgaaat
    39181 aggtttctca tatttttagc aaaagcagaa aaccgcgctt tctgtcttcg agctttctgt
    39241 tcatccttgt gtagaagctc aaggcctttc agaactctgg tggcaagtat cctgtcgtcc
    39301 tcatcactat cctcctcaac ctcctcctca tccttgtagt aacgtctaga gggtcgtgga
    39361 ggagttccgg ccgggggaac tgcgcctggg aacagaacct gaactgggtt tgatttcagg
    39421 ttcattacat atttgaacgc cagcagtcct aaaataatgc tcaccaccac cgctatccca
    39481 attccgagtg cggcgaacgg gttagaaaga aatgaggcga tgccagatac tgtagaaatt
    39541 actgctgccg cggctgtcat cactacagtt cccaatgcct ttcctacttc tccaagagtg
    39601 ttgccaaaaa aatctgctat tgctctaaag attgcatctc ccctatctcc acgtattaca
    39661 gtgtcaatgt ctctgaacct tttgttataa atattttgat atctgaccac atcatcatag
    39721 tttaaagtcc cagtatctct gagttcctcg cgagtgtata cttcgacggg cacaaagtcc
    39781 aaatcttcta gtatagtggc gttcaagttg atgaatatgc tcacttcttc gatctcggaa
    39841 gcatttactt gtctaacaaa tgtatagtct tcgtaaagaa ggtagttttc tcccaacaga
    39901 aagtaccgtc tgtgattgat catgcatggt tctatcaaat tccgcccttg taaaatttca
    39961 ttatgttctc cgagttggcc taatatgtca agattgtggt tttctgttga gttcgcagaa
    40021 aactgtgact caggggagga cgaatacctg aaaataagta ctggtctggt atagcacatg
    40081 gttgggtccc ctggcatgcg catggaatcc tgcatcctaa tattttcgat tggaatttct
    40141 atacattttg ataccgctac gatgtctccc aatagcctgg cgcttacagg ttgtccgaac
    40201 aaagatgtca tcagtgagtt cgggtttagt ttcttcatct catgccatac aatcagttgg
    40261 cggttctgaa gctcacacca cgcttccaac aaatttccga taagctcgtt aacatgggct
    40321 tggattttgt cgtatgcaaa ttgtaacatg gcaaatgttg cagaactgtg ggtagtaatt
    40381 ctatcaccct gaggtccaga ctgcagcgac gccgtgcggc gacctgcggc ttggcgacgc
    40441 tctctccctc tcgggagatg attttgtctt tgtgcctctt ctaggtacat ttcagccaag
    40501 ccatggctca tgagtttctg aaatgcgatc agaaatccgc cactaccgag atagtattcg
    40561 atgtccccag aacggacatg agtcgaacta tactttctgg caaagatgcc atctatggcc
    40621 tccgtggcta tggtaggaac gcattcagcc aaatgaagcc tgctgatgtt aaaaggttgt
    40681 tttccggacg agaacgtcat agtcatatct ttaagtgaaa agtggtaact gtttttgtac
    40741 gaaacacgaa ctgcttccgg gacttcaatc catttactga gagtacatac agattccttt
    40801 tcttccattg catcccagcc tatagtgaat tgttcatctg ttagaaagtt tcttttttta
    40861 gggggtctta tttgtccggt ttccaaatcc ctgacttgat aatttgcgat ttcgagaaat
    40921 ctatagtctc tgtagacact gtgacgcctt ggtccggtcg tgtttttggt ataaaaagga
    40981 gaaatttcta ctgtatcacc tgtcgccatt ccaaagtaat catacgggta tacagatcta
    41041 gcctgtagat attccacaac acagtcgacc gatgtagacg ttcggtatcc cagggtttga
    41101 tgtcgcttag taaagttagt tgtatgaaac gccttggaga cagttgatct taacagtgat
    41161 ggaaccaggg gcaatttttt ttctgcttca tcattgtcgt aagcttcaaa aaacatgaaa
    41221 tttttatgat acgttgcttt ggatgagcat tctcccgatc gatcaatcct gacaatttca
    41281 tgatagtcta ttggaaccct ggtcacgtac tcatttgtta tttggggtct tgagaataat
    41341 gcccacgtag taactgtggt tatatgttta tagtatagag tcacattaaa gacgtacggg
    41401 gcaatgtttt gcttgaagac tacggcaatt ccttcagtca tgttagtcga atcggcatgt
    41461 cggtgacaat gtcgtggctg ggcaagcctc gcaacactgg cgccagttgg agatgagcac
    41521 gcaaaaattc tgtttctaat ctggggttct ttcggtgccc ccgacccaat ggcttcggag
    41581 aaagagattt ttccaacatc catgctggct gtatcacgag ggtctattat tccagcaatt
    41641 ccgtgtgaat cttgagatag ggtagatggg atcaggattg ccacgcacac gcagatcagc
    41701 attttcaagc tagccatgtc aatgttcacg gcgatgtagg attgcataca ggaccgcgta
    41761 taaatctttc tctactatga tagtagacgc tggacccagt ttcccgcggt catcgacgcc
    41821 ccacactgca actaatggat gttcctcttc aaatgttaaa tatagcccgt tttccaaaat
    41881 cgggccgtcg aggtcgaatt cgacacaatc tgctcgcagt aacttagtgt taccgctgtg
    41941 gaaaattttc tcgaaagccg ttgtagcaaa gagtgcctct ctgatatatc cgcacgcggc
    42001 tctctgaata gcagttgaat tagaaatgcc cgcgaagtta tagaatcggc gaaactcact
    42061 tgtcatccaa tcacatgatc tgtgacgttt tgtaaagttg gccaactctt ctttcaaatg
    42121 aggaagaagt cctacgttct ctacagaaaa gtatatagac gtgtttgggg gttggggaaa
    42181 tctctccttg tgatgtttga aaagggggcc gcttaaaatt tcaaaaaacc gattggtgag
    42241 gcgcggtaac atggtttggt cgatttggta tctggtgatg gaagagcgta tgtattgatg
    42301 ccaatcataa gcacgcccat cattttgatc gatgcgtaga attttcgaat gtagagactc
    42361 ttcagcgcaa acaatatcca gaaatgcgcg tcttgctaga aacgcattct ttagcgttac
    42421 gtacattacc ggaagagttt ctccgtaaat attcacacgc attaattttt ctagctcggc
    42481 tcgctgaatt ttaatgcatc gatccaagtt tgaaaatgat cgtgcagaaa gcttttcgac
    42541 gtagttcttt tgtctgacat caagatctcg ctctgccttt tttagaagaa cttctatcga
    42601 atcctcgtcc ctttcaatag ttcctctgag gttagcagtc aggtcgcttg tactagttcc
    42661 ttctgtgaca ggttgtgtct ccttgtctga gccacgcagt ttttccacta attcctccag
    42721 tgcatctgta tctactttct ctgggtttct taatctgcga aacaatggga gggatagatg
    42781 gtggtcatag caggctttga tcaaggcagc tatttcggta tccggtgaag tggccagtac
    42841 tcctgtgatc agcgtatcca ctaaagaatg ttgtggggat attaactcag cttgcgcgac
    42901 cctgtgaaaa tgtgcatgca ccttttcaaa cagtgttctt tctagacgga tgcattcctg
    42961 ttcaaagtct tcagctcttt tgaacagttc gctcagatct ttgtctaact gctttaacac
    43021 agattgtgaa gtagtagttt gtgactctac tccgctgggg gtccttttac ccgacgctag
    43081 ccagtattgt aattcactta gttgatagac gggccccggt ggttccgtaa acacatcata
    43141 tttgtttaag attttggaag cttctgactc tccaggggaa cttgataagg tgcgtcctgc
    43201 ttcgacgtgg ttttcagctt cgatgcgagt ctcgtttgaa agcacatttt ttaatttttc
    43261 gggatccaca tcccttaaaa atggaagatg gcgtttaagg tcatccgtag atacattgac
    43321 cggaaactgt cttgtcaagt gatcacaaat tttgtatcca aggcgtcgat aaattgtttc
    43381 tccctgatta gcggttacac taagctcttc taaacacaca taacacggct gaccatgatc
    43441 gtaagtatcc ggtgctgcta cgagacttcc ccccgagctg agaaccaaaa actcatctat
    43501 tgtatttaga gcttcaattg cgtttttaca agatactacg cagtgacagt agtttagttg
    43561 cttcataaag ttttctacat cgttgatcag aacgagttcc tttgaaataa ttgaactcat
    43621 tccatataat tgtagctgga cctccgcatg caaaggacag atgaatcctt tcccgtaccc
    43681 aagcgtagct tcaaaaaaac attttctatc ctttaggaca gaatacttgt ctatctcatt
    43741 acacaaagct gctatttcgg agcacgctct tcgaagccag agccacacgc aatatgtctg
    43801 aagggttaac ctataattta cttgcataga gagctcatta gaaaggagcg aatgaatgta
    43861 caatgccatt agcgcgttgt gtttgattct cgaccgcagt cgcttctgca acaatatctc
    43921 tggatcgcag cgcttcaaaa tatctatttg aaataacagc gtctgtagct gacctgccag
    43981 agccataagg cgtaactgtg tttcttcagc catattcccc agtaagaatg aaacaaaata
    44041 cgtacaagga ctttcttata tttatttgtt tattctgagc acgcgcagtt actgttaaca
    44101 gaacagaata tcagccgata gcgaaggttt ttttgcactt ggcgcgccaa gttcaatatc
    44161 ttcgctgatg tcgccagtgt tagtatattc atcctcgtct gcccagacca acatctctcc
    44221 tgcattttcc gggcatgtat ctttcccctc tagctcactg agcatacttt gtgcggtagc
    44281 cacggaccac ccattctgac ttccagaaat gtcctcacgg agctctacta atatatttac
    44341 cagatacttg tcgtcagtaa ttgccatcca tgtttcggca gtaatgtctt tcattccttc
    44401 tcccagaact ctcagaacgg ctgtgtagat ggaagtggga ctacctcctg catcaattag
    44461 gcttctcact tgagaggcaa tggtgttttc ttgaaaccct gatgccactt gcccagatga
    44521 cagaatagtt cctacccttt tacaagcaag tgcaaacttt ctgacgggat cattcgtcag
    44581 cgcggaatta accgattggg accctgaatt gcctataagg ctaccccaat tgccggactg
    44641 aaagacggtg gtcgagtttt gttgtcctac atatttgctg atcataatcc ctaacattac
    44701 tataggttta gaactcaata ccacgcggca cgagtttgac gtactggatc cgttgaacac
    44761 gacgcggttc ttcaccttaa actctttcag tttcaggact tgtcccctag aaagagaata
    44821 ctcatattgt gcgattgcct gttctgtgtt tgggcgcatt gtatccggag cgttaacaca
    44881 cggaactgat attgaaaatg gctcatattt tccagaaagg aatcctttgt ccagcatccc
    44941 gttaaaggct gatcttaggg ccggcatggc agaagaacgg aacatttttg actctggttg
    45001 ccgcgtatca aatgttccat ggatttgact gagaatcaaa tcttggaaaa gtattgagcg
    45061 agtctgggcg cacaataagc taagtactgg acagtacgca gaagaatacg gttcaggtga
    45121 tccaaatgta tgtacgattg aggataagtg ctctttgtaa tgatatgctc tcactcctga
    45181 gagggcagaa atgaacttag agcattctga tccaacgaag ttctgaattt tttcaaatac
    45241 agtttttaat tctgctaggc ttgaaatatt atgcgtgtct tcgcccgtgt ctttgtttat
    45301 caacccttct gatactagat attgaaagac tcgccagcct atgcccctgt atgtgtcatt
    45361 cataactgct ttggctggtt caccgtcacc tgccctcttt aactgggaat acggggcaaa
    45421 attccccaaa atgtcgcagt ccgtgtagtc tccatcaact gctcctatca ctgcgatagg
    45481 gcttcttctc atggttcgtg gaataggaaa acgggttctc agtcgctgca tagtgtaacg
    45541 gatgcaatga ttcctagact cgtcattgca ccaccggcat tctggtacgg ctccagtaca
    45601 aggcgctttt ccactgttag aaatcgaaat cagattcatg tttggccgag tgctgagttg
    45661 cttggaacat ttttccaaat aaaatatgat acgggacagg agttcggggc taaaaccaca
    45721 ggcatatgcg aggtgctcag gatcatattc gaatgtgttc tgaggtgtga gcggagatgg
    45781 acatgtgcct tcccaaactc tcttccctga gtagtccacc tgggggcatc ccaataaatg
    45841 caatccacat gtcagataaa aacgggttag tccgctcgag gcgcgctcgc cgggctccgg
    45901 cgcaccccca tcgactacct cacttgcata aaggggggag ttatttgaaa aaattgctgc
    45961 tcctacaatg ccggccaatt ctgctgagaa ccgatcgaga gcttgaacgc gctccatttg
    46021 agttttgcaa tcgcagaaca acggccactc ttcatacggc agaccgcagc cattatcaaa
    46081 gggatatgga gcgcaggaga cagagagtct agttgccagc gcaagttcag cagccaagct
    46141 acaggcggcg cgccgttcta cttctacatt ttgtttaggg ggtcctgttt gttgtatgtt
    46201 ctgagccagc tcggtaaagg tcttgtccga ggttaataca cagccttcga agcttccatc
    46261 gaacgcgagc attgccgctc cgcgcgccac ggcttctagg tctctggttc tcagactttg
    46321 tccctgtgtt ccgagtgttg ccccatgaat gagtctgttc aaagctttgt tgaataatgg
    46381 ggtagggtaa atgcagcctt caccgatgtt acggctgttt gaatcaaatg ggttacggca
    46441 aatccgcagc gcgatgtctg gcatgtacat ttgcacaggg tagattggta tgcgcgtaac
    46501 atgcttagaa ttgatgtaaa gcgtctcgac tgatccatag tgaatgtatg tgttgcatac
    46561 atacaccgcc tcacaaaacg gttcggcaac tacgagatag agcatcgttt tgtcagggtc
    46621 catattcagg gatttgcaga tctcttctcc tgtagtttcg atggcatttg gaaccggtcc
    46681 atttgggggt agtgaactga acccgaacct ttcccttgcg tcctcgcata tttttgtgag
    46741 gtttggagtg aatgatgtag gcgggatgca ctctcctcca tgaaagatat ataccgttgt
    46801 tgaaaaatgg cagggagata aaatagccgt acaattacct ccaacgactc ccgatgactt
    46861 agttccgatg actgctgcga cgtttggctt gaaatcagac tctacagtaa gcccccgtat
    46921 gagaggagcg atggcgcagg agggctggtc ttgacttttg gcgcacagta tcttccattc
    46981 ctttccatca atctcttcgc ggggtcttgc atatacgtag ccaattggcc caatacacca
    47041 tggtccgcca tccgactttc cgcccttagt tgtgccagat gaactctttt ccatttgcgc
    47101 gagttatctc agacagtatg atctcagatc agagttccgc gtagtagagt agtctccgtc
    47161 actgagcacg gacttaagta ccgcggaaag gacacaccta tgtatacttt agagagttca
    47221 taaatatcga tgattgcagt agctgggcac cgagtttgtc actctgcact atggacactt
    47281 tttcctccgc cggtactgga gctgctcgtg tagccccgat aattggcctc gggccgcact
    47341 ctggcgcgtc ttattatact tctgtgagag aattcccgta tgtatgtcca acgtgcatta
    47401 atgggggcgg aaggatagga acgcagattg gaagggctac aagcaaacca accttttacc
    47461 acaacgagcg acaattagac atcttgacaa gcacacatgg agcgtggccc gtcaggatga
    47521 aatattggaa tgctggtcct ggaatgactc accacaacaa gggagatgta aagttttatg
    47581 aatttcacgt ttatgacctt tttgaaaaca ctgagatcgc tcagtcatgt gtacgatgga
    47641 tgcattccag atttcttgat acactgaaac cgaccggtac tgtaataacc ttagttggaa
    47701 attctgcatg cggaaagcgc gtcgccgttc atgtgtatgg atctttgcca tacttttttg
    47761 ttaaaaagcg agaaattgac caagccgcga aagtcacgaa ctcggaagag ttggcgcatg
    47821 ctctagcatt agcgacgcgt aagacatctt taaaaaattc accttttcta gctgtttcag
    47881 cggaaagttt ttgcattgat gttgttcggc gcagagacat ttattattct gaatctgagg
    47941 aggaggactt ctaccgtgta aaagtgtgta atggcaaagt gatgaaattt atatgtgata
    48001 attttttccc gagcgtacct aaatatgaaa gcaatgttga cgctattacc aggttcatcc
    48061 tcgacaataa tctgacttct tttgggtggt atcgctttag agctcaaggt ggcgcactcc
    48121 aaattcgaga cccaggacaa catgctacat cagctgatgt cgaaattaac tgcacagcaa
    48181 gtaatttgga actcggaaac aatgtctcgt ggccagacta caaattactg tgctttgata
    48241 tagaatgtaa agccggaggg gcaaatgagt ttgcatttcc ttctgctgag aaggtagaag
    48301 atcttgttat ccaaatttcg gcagttacat attctttgtt aactaaggaa aaagagcagg
    48361 aaatcatttt ttccctaggg acctgtgaac tttccgaaga ttgtagtgat gggataactg
    48421 tatgcaaatg tggctctgag ttcgagcttc ttctgtgctt tatgactttt ttcaagcaat
    48481 attcacccga atttgtgagc ggatacaata ttctagggtt cgattgggcc tatctttcta
    48541 acaagctgag caaggtgtat ggcatgcgtc tcgatggata tgggaaagca aactcgtggg
    48601 ggacattcaa acttcaagat ccgtctgcgc gcggacttgg aagattcaaa aaagtcaaaa
    48661 tcaatggcgt cgtcaacatt gatatgttta ccattagtta tgaaaagcta aagttaccat
    48721 cttataagtt aaatgcagta gcagagtgcg ttcttggaga acaaaaaatt gatctggctt
    48781 acaaagatat cccagtcatg tttgctgcag gccctaaaga aagggggaaa ataggggagt
    48841 attgtttgca ggattctaga ctgtcaggga gtttgttttt caaattctcc cctcatttag
    48901 aaatgtccgc tgtcgctaaa ttggcctgta tacccttgac aagagcaata ggcgatggac
    48961 agcagctgcg cgtttataca tgcttgctcc aacgctctac ggcgtccggg tttgtgttgc
    49021 cggacaaaaa gagtgcgttt tccttcggtt ctactcttgc ttcagacgcg tctgatgcac
    49081 ctgctacaag aaatgtaggc taccagggag ccaaggtact agatccagaa ataggattcc
    49141 atgtaactcc tgtggttgta ttcgattttg ccagtttgta tccgagtatt attcagagta
    49201 acaatctatg ttacagtacg ttaacgcacg accccgccgc actggcaggt ctacagccag
    49261 aaaaagattt cttccagatt gatgttcagg gtcggaaatt ttattttgtc agggagcata
    49321 ttcgcaaaag tttgctgtca gacttgctag gtgattggtt atctatgagg aaagccgtgc
    49381 gcgcaaaaat caagacagcc gagactgaag aagagcgaat cttattagac aaacagcaag
    49441 ctgccttaag ttgtctggaa ctctgctatg ggtttactgg ggtgatgcat ggaatgcttc
    49501 cttgtttaga agttgcttca acagttacag ctataggaag ggacatgctt ttgcgtacaa
    49561 aggcgcacat cgagaaggag tggagaagtg gaaatcaatt tgccgaaaaa tttttgcccg
    49621 ggtccgaacg tattcagcta aaccaatact ctgtccgggt cattaatgga gaaactgatt
    49681 ctgcatattg tgaagtttac cggagtttac atttaaactt taactcaagt tggtggctgc
    49741 atggccgaat agatttaaac aagcgctttt tagaggtccg ggtaaaactt gagtggaaaa
    49801 gattttcgtg cgccctgtta ctcattggta aggaaaaata cattggggtg atgcatggag
    49861 gtaaaatgtt gatgaagggc gtagatttag tcaggaaaac aaactgtaaa tttgtcaata
    49921 ccacagcctc ccgattagtg aatctacttt tcgaagacga cgaaatagcg atggctgcag
    49981 atacagcaag agccggattt gaggattttg actgtcttcc gagcggactt actaagcttg
    50041 gccggttgat tgcagaggca aggctagcta ttaccggcaa cggactaaac attagggact
    50101 tcataatgac cgcggaatta agtcgtgcgg tggataacta tgccagtttg aaattgcctc
    50161 atctcacggt ttatcaaaag aaagctgctc cgcgcgaaga attacctcca attaaagaaa
    50221 gaatcgaata tgtcatcata gaaccgggac aatctgtccc gaatgatcca gcaactgagt
    50281 cttttcctaa ctaaaagaaa cttcttaaat ttcttagcct ggcagaagat ccagaatggg
    50341 tcgtatcaaa tggtctaaaa ttgaatgtag aatactactt tgattcgctt attagaacat
    50401 taagtgtaac attcaacgca attttcggtg atgcaaaaac agcagaggat gttttaagaa
    50461 gctttattcc agagaaaata cagttttctg agaaagttgc agaggctctt gcacgaaaca
    50521 ccgcgacatt tgtatccatc cagaagtaat cggagggctg taagttgcaa atgttgaata
    50581 aagtttagtg tattcgtgaa ttttttcgtc tgttactagg atatcgcagt atcgtcgata
    50641 cactgaatcc ggggtcagct taacgcggtg atgctcagag gaacctgggc catcttcttt
    50701 ggaaacgatc aataagaacg taccagcgaa tacgtccacg tgccaagtgt atcctgggca
    50761 attaaatatt aattgtttca gaagctttgc ccctagatga agtggcgtgc tctgtttaaa
    50821 tacaaaatac ataaggtatc ccgatggaaa cttcttagat cttggatcgt tcaccaagag
    50881 aacggtaaaa tcttgagaga gtccgccctt tactgtatag tatgcataaa acaaagtcgc
    50941 ctgggccagt agatttttga tagtgtcaag taggaattcg ttttcatatg ctccagatcc
    51001 aactaccgat tcacctgaaa atacccgcag ggacgccact aactctttga attcgaccac
    51061 agagctcagg tgatggagaa aggccaattc caacgcaggc aagtctaacg gtggggcatt
    51121 tgaccatcca tatgagcaaa gtgagcagca tccaccaggt ccaacggtgt agcccatctc
    51181 ggaaagagag atacagtcgc caggggcaaa acttgcattc acattgtaag gaagggagat
    51241 attttcttgg cgtatgacag gaatcgtcat tgttctgaga agggagatag tatcttccgg
    51301 agatgaagcc gttagcttga aaaaagcatc gaagaaagtt ctccgtgtgt ctagattagc
    51361 ccttgaccta gacgatcgcc tcttcgatct gaggtatgag atgtagcgat ggcgttcgat
    51421 ggcccccgta ataccttctc gtcggatgcg cagagcagcg gcgcgagaac ggaagtcaga
    51481 catatcgagt cagtgcgtgt tctaaagcaa tgcagctgat tccgtgcctc tttaaatagg
    51541 tctcagcgcc gcgaatgaaa gaatttaaag cggtagggcg aggaggagaa agctggtaag
    51601 ctttaaatgt gaaggctaga atccacagcc cgcggcaaac ccgttcttga aatatgttag
    51661 ccgtggcgat ttcggcttta taaagctgca gcagttctgg gtccttgggt tggccttccc
    51721 acaaaacttt tggatttacg cgaagcgtat taactgcaca caatggatcg caaaaaaagt
    51781 gtttgtaaat tgcgtttgcc ccggccatcc tcaataaggt taacattcgc cccccatcgt
    51841 ttaacgcagt atagtcttcg aacgtttcta atgctggttc aatcccatcg aacaagctgc
    51901 tatttacgtt actgcaaccg actactttac ttttcagctt tcgaagagca tgccagtgtt
    51961 cccgagtaag catgagattg cacaacacgc attcccctcc agtatctcct cggctagtcg
    52021 ggtgaggcaa aatagacgcc aaaattgggc caatggcaag tgatggtttg gtattgtcgc
    52081 aaatgtactg cttcgctgtc ttggggagcc tagtattttt gacctgttgg attagcgttg
    52141 cgtgaaagtt ctccactacg gtatttcttg tccgaattat aggggcaacg aaattttctc
    52201 cattatcatt tgtatcatca tactcaggct cgtcgctgca gctggcatcg agttcccgat
    52261 ttggcatacc ggctgttcca gcaattaata atgccgtcag gtcggtaaat ccccatttac
    52321 ttggggttgt cagggtttcg cttggtcccc cttccacata ttttgactcc gtgctaatat
    52381 cttctaaagc agctttttgc gcacaggttc gaaaagcgaa ggaggcagtc tctgtatttt
    52441 tcctctttaa catacactgc gcggagcaaa aacactcgag tggtctggca tactcacgcc
    52501 attttaacaa agccacggcc attccgctac tttttgggaa gttgaaatct gcagacgcgc
    52561 cagagaccgg ggcaattttt gccctaagtg cttcttgata tctagtagat agtaacgcat
    52621 agcgtgctac cgactgcact aggaacgaat aattatttag atctatttta gagtccagtc
    52681 ccccttccac cgctttgaaa cagccgttaa aaaagaagtg cttctgaata tccccgaggg
    52741 aaaattcccg acggcttata gcgccaacta aagaggtgct gtgggaatgc aagtagtgtt
    52801 tgtccatgat gaagatgaac tcaaaagcag ttatgaaggt agatgtagca cacaggggga
    52861 tgctttgaga tttgaagcac aataaagagt agtccaccat ccattcggga gtcacgggga
    52921 attttttttg atatttggta ataatcttgc agacggcgca tgatttatct agggtgtata
    52981 agtcagccat ggtttctacg aaagaatcaa tgtccggaat tctgttttgt tcttcagctt
    53041 gttctgtact ttcttcatga tatatttcaa ttaggtgagc tccatacaat agttcgtccg
    53101 acaacttgtc attaaacgtc agaatcgccg ggtcgtagcc agtatatagt tttgagagca
    53161 ctccagcttt ccatcccttg gaaagttcag tgcgagtttc tgcagttgat cgtttggatg
    53221 tcatggcatc cacagttccg aggcgtctta gtgaattggt agatgaagag gagttagcgg
    53281 aaaggccact ctcagaactg ttcagaaagt atattggatc tgcaggtagt ccggtatatg
    53341 aaatatggtt ttatgaccta tcgcctccgg aaattgaagt agctctgcct actaccgatg
    53401 ctaaactaaa ctaccttgcg cacacagcca atgtcgcggc cgaacttcgg taccgcaatt
    53461 tagatgggaa aaggatgtgc gcacacgcag aacttattgc tcgccgtcgt gaacggttcg
    53521 cgcaaattct aagtaagttt ttggatcttc accaaatttt aggggcgcta gaaccttgtt
    53581 agtctggtag tattataaat aagagggcga gtgtgtatgg tattaagacg gatccagaag
    53641 atcataaaga aagcaatgaa accccaaggc gccagaaatc aaggagacaa atactgtcaa
    53701 ttggtgcgct tcgtgaatgc tggattaagc cttgccggaa cgacagcgag tctggtgtat
    53761 accagagata atgcacgtct cgcacccact ggagatattt ttacgcttct tgctaaactt
    53821 gacggtcccc caattccagc ggaatatatc ctagaggcaa tgaatagctt ccttaatatt
    53881 ggagagtcgt ggctgcgtat tcaaaatacg ggccaggctg tcattgttgc cggatgtttt
    53941 accaagaccg ctaattgcaa agaccaaata tggcctgctt ctagtcctac catatcttta
    54001 gcggctgcaa aatctctgtg ggtaagttcc tcatcggtga aggaaatgaa aagacttcaa
    54061 aagttaaaaa acgccccgct cgcaacaatg atgtacatta gtttttacag ggggtcgaga
    54121 actgatatta ccatcagatt cgcattttac cgctcagact cggaacccaa tttgattaaa
    54181 attactcgca gagtgcaaga ggctatagac tccgcggagc aagaagattc atataaaacg
    54241 gcggcccttc ttaaaaaaac gttgatggaa actacaagcg agatgcccac aagtcactcg
    54301 gttgctgagt cgaagccatc acgttctatt ttcgagcgcg tcaccacata ttttcgaata
    54361 catgtaaaat gtttaaaccc gaggtccttc tctttacagc cactgatgtg ggtgcttatg
    54421 ggtgtggcat ggcctgcttt tttgacacta ctgatcttct atttaatccg agtacaggcg
    54481 acgagctgaa atcataccac acctggaggc agatatgagc aggcaatcta actctcattc
    54541 cacgccccaa ccacaggaca gagtcaatgc ggccgcagaa atgttgaaag cttttttatt
    54601 gacccctccg agagatcgag ctccggacta catgcaaacc ttaaacggaa ttaccttgga
    54661 tcaactcacg gaagtagctc gagccttgaa aaatgaaatc ccgagagaag atacagttcg
    54721 gcaaaatatt cttagaaata atatcacact cgcgctaatg gctttaaacc gagctccaat
    54781 gcttcgagat cggttaaata taaggcccgt atttgctcgc ctttcaggcc ctcaaggatt
    54841 gtggacgttt ggagtgagac aacgcaccag gccaagaccg agacgctaag caaaacgcaa
    54901 taaatatacc aatttaaccc agtattattt ttattttgtg tgtttcatcc gctatgcggg
    54961 cctgctgatc taaagcgtaa tctctcgcgt gttttattcc tttaagcacc atgcggcagg
    55021 tgactgacag cgatgcataa atatcactgc gcgcggtggg tggcaaggga ctaagaattt
    55081 ctctttcacc cgctttagac tcttccgcat cgcttgcaag gtcttctgat ggggctttgt
    55141 catttattga ggttccggaa gatatctcat ttacagcatc atcctcttcc gaactagaat
    55201 caggtggagt ctgaatggat ttcagatagg gtgtgatcgt tccatcccgc aatgcgttgt
    55261 ccaattttct caaataagta tctaaagctt gagtatccct tactaacctt tctccctctt
    55321 caatgcgccc tttcttatgt tcatcggctc tgcgagaaga ttcctcgtga agtttgtgcg
    55381 accctttgac atatgccggt gtaaaatcct cgtcagaact ttctccttcc gggggatcga
    55441 cttccttgtc ccacgtgtaa ctgtatgttg ggaagtgagc tatatcctca ttatctgagc
    55501 aatgtgtctg tttggcttcc gcggtgtcat gtttatctct gtggcttgtt atgctttctg
    55561 gcgggccctc gtgttcgcta gttttacgtg ttgttgccag gtggcttcga tcttttggtt
    55621 ccgggtctgt gggatgctca aggttagtct cgtctgtaat aactgcgaaa ttatcagacg
    55681 ggtcagaagt tattgacgga ctctgaattt tccaatcaca agtttctgag agtacttgtt
    55741 cgaattccga taattctgat tctgttccgc tctgcactgg actagcaaca gagtatagac
    55801 tggtatcata atttggatcc ccgagattag acgagaacgt ccccgtgtct gaaaatttta
    55861 ctgggaggtc ctcatatttg gggtctccat ggagccttaa aacgaatggc gatggagctg
    55921 tttcgagaga aactaatatc tgagttattt tgtttcccct gtcgatggca aaaagtaacg
    55981 acggagcatg cttgaggggt ttgctggaca gtacggttga taactctgct atctgggagg
    56041 ccagacaggc gttctctatg gggttggcat caccggcaat aatgtctccc aattgaattg
    56101 ccgtcttggc agtagtagag gacagcgcac tttctaatgg atttgttttc cgtccatcga
    56161 aaatagtaga aaacaaaacc aaaccgttat ttgagcttag ttcccctgct tcatatgcga
    56221 tgacgacagg tgctccaaaa agaagtgaaa taattgcgat atcaaaagcg gttaagtccc
    56281 atatggattt atggggctcc tcccgaaggg aatatatccc agcacgatct acggtcccga
    56341 acaatttgtc atcaggggcc tcgaagactc ggctgagatc actgtttggg gaaaagtcat
    56401 aatcgcagct tggcgatgag cgggaaacca tataatgaat catggtatcg atgggctctc
    56461 catcaatatc gtcatggggt cccatggaaa cccatagtgc ctccaggata ttcctcggga
    56521 tgcatttgag ggcaagaatc attagaaagg cacttgtctc atattcttct ccggaacaaa
    56581 atttttcaag catgcatatc cctgacctga cagagggaaa tcttttccag gggtctaaaa
    56641 atctcaaaat agaggagggc ggaggttggg aaagccagtc tttagggtct atcacaaaac
    56701 atgccccagc tgaaggatcg aaatgctgcc taccttttga tagagggaaa gagagtgctt
    56761 ttttattctg agtttttctt tggtaaggat caagagatgt tattcctacc ttctcgcgca
    56821 ctgccctaga taaaacaaca tctagggtat ttactatgta ttcagtttgc tttaaataat
    56881 taagcctgcc aaagtaaact aggtgtgcag gttcgcatgc agttaaaagg attaaaatat
    56941 caatagcggt tattgagtaa atgcgaactg ctttgtcgaa ttgatttttc tgattgatct
    57001 tatccaggtc tgtgtggggt ataaagttgc ccatctcatc tattattaca tcccgcgctg
    57061 accctaaagt ttttgacaga gtcagataag tcagggcact gtaaattgta catgcggcga
    57121 ccatcggagt atctgtttgt ttgttcgagc ttggccaggt tcgggtggaa cagaaaatgg
    57181 tgtaagaatg gaagcccgct tctatatcgc tagtcctggc tctcatccat agagttgccg
    57241 cgaccaatga gagggctgca ttttgtctga cggataattt ttttactaac tcgttgtctt
    57301 ttggattctc aagttccaag gagagaggct cactttggtc cgaagatgtg cataacgcag
    57361 ctgaccacaa ggcggcagct tttgcagtgg ccgttcgata acaaagagtg tattccaggg
    57421 gcattccgtt atctgtgacc atgaccgagc ctattgttcc gaggtggtga aacgtaaccg
    57481 tcataaccgc ttttttattc tgtctcatat agctggaagc cctggcgagt tcccggactc
    57541 tggaagaaaa gggagtctcc gcagaagata gtctcgggat gatgtcgtct gaaaaagcta
    57601 tacccaaggc cttgtaagca aggtaaagtt caagtcttag cagtattaac tttttaatat
    57661 cttcatactt tgctcggtac cactttggaa cagactcaaa aattgcagtt aattctaaat
    57721 ggagagattt caaagctttg aaatgcatct ctgtctttgc tttaaagatt acttcgtcga
    57781 atgttcgcat ggcattagtc agtgtgatga tgttttcttc tgccttttgt aatatgggag
    57841 tatattctga aatgtctttt tgatacttct ttatttccgg agttgatgta acttgagcct
    57901 ctaccatttg caaccggctg gctaagcgtt ctcgtgattc ctttagattg tgaactgcat
    57961 tgacgtatgc accccatgac tcttcgctgg tgtctttttc ttttccggag gtttccttaa
    58021 aggaagtggc agctgataaa aaatacttat agtaagcttc gagatctttc agacccgcgt
    58081 cagcctcttc atacagtcgt ttaagttcat ccaatcgctt tttaaaatct tctaatggtc
    58141 cgcgttcatc gatagagttt actagttcac atgtatcgag aatgtgagcc gaagaaaaca
    58201 tccattccaa tgatttgggg tccacggaag ttataccggt ggaattgctt ttctcttcca
    58261 cttcgcgaaa gagattaagg aaaaggataa ttatatcttc aagtgattct gccctttcga
    58321 tgcccggggc aacttccttg ggcacgcgac ccaatagtaa ccctttcagc ttttttaagc
    58381 ccttctgcat acgcaagact tcctcttctc ttacactcca taattgctcc agcatgtttt
    58441 taattttgcc gtctgtgttc tttttttgtt gttccgcctt gttaatttct gcggataaaa
    58501 ataatttaac atctcgcaac gccctgtgag aagcatcttg ataggcggta tggtcaaaca
    58561 cagtgacatc atcggagtgt agactgtctg gcagctcctt gagtgcgatg agggccgtgg
    58621 gtatcacttc gccgtggtct aaccgctttt tggcattttc tggacttctc tctatctgtg
    58681 cactctcttc agctaattga agctccttct ttaactcatc ttgcaacagg attgcttttt
    58741 ctttaatagt ttgaatcttt gatgaaaatt cgatgaattg ttcatgcgct tgcaagtaaa
    58801 agtcaacaaa ttctgataat tcaggaatgc gcatcaattg ctcggacagt cggaaaacta
    58861 cgcccctggt atcaatttga gacccttcta cggtaacctc tgccgtttcc aaaatatcct
    58921 ttgcaattgc acaaacggtc gtcaggcctt ctacctttgc tccaaataaa gtttcatagt
    58981 atttactgac caacgggaat gaatgtaccc acgtagaagc ggctatagga gctacggcta
    59041 ttttgtttcc ctgccctgct tctgcattac cagaatatgg gttgaaggag aaaaacgatc
    59101 gaagaagttt tgtgccggtt gcgagccagt catttacaac gttttgagct agatgtttta
    59161 gttctgtgtg ggctttatgt gcactattaa catgtggccg gagatcatat atcgtttccc
    59221 aatcgtctgc cgaaaactta gcactgccac gatcttggag gagtgcagcc ttcgttgctt
    59281 ccagccactc gatttcctct atggcaagta tggcattatg cgcagcctcg gaaaggttgc
    59341 tacatgcttt ttctagagat agtaattccg gggaaaatct ttcctcattg gtaagatcta
    59401 gctgtgccac ctctttctta accctttcca ccagcactgt agccgagtct gctatttgtc
    59461 gatcacgtaa ttctgggaca ttcagttttt ccgtggcgtt caaaatgtct ttagtcagtc
    59521 tttcaataac atccgatagc tgttttttcc ttgcccgttg ataagcttca gactccagct
    59581 cgtagagatt atcacggatg ctaaatagaa actgaggtat ttgcgaagcc cctctgttat
    59641 tttgcacatc atgaataact gcctccacct cttgtctggc gcgagagaac ccatccgcat
    59701 ctccatttgc tttcgccgtc tctatgacga acagaagccg ttctgcatga tcgagaaaga
    59761 cttcaaacgc tctgttcagt gcatgtttgt tttttcctcc ggaaagaagc gttgctgtaa
    59821 aacggatagc gtcgacaaga tcatgcaaat ctgtggtatt tagggatcca aatgcacgtc
    59881 catactcttc cagcaagttt tcgaaatcgt cccgtacatg ctttccaata aaatcatcat
    59941 ttctagcaag gtttataact tcctcttggg gaatgtttct tgtctggagc gcgcttttta
    60001 tatttcttag tccttcgaat ttttttaacg ggcgcaatat ctgcgtcacg gtacgtttcg
    60061 tttcttcgtg cgcagtttct tcctttctaa tctctttgga gaattgatct atcaaacgtg
    60121 aagcgcggtc ttctagcgcg tcaaggcgac ggctttgttc cacggtagtt ctcgcggctt
    60181 tggctacttt gattgattcc tgtgtgtgaa ggacatattg caggcgtact tgggggggcg
    60241 ctgtaatagc ttccactccc tcgagctcgt tttctaattc agccagcata ttttcagtta
    60301 gcccaaaact ctgagcaata gcgttgatgt catgaatagc ggagatccat tttgtaggtg
    60361 atgggacaag tccctctgca tgagcttcga atagatgtag ggaccatctc ttgagttttt
    60421 catcggtggt aaggtctttc ccatcgatta ccagatctct gaaaattctc aatggctttc
    60481 ttgtgaacag tacttgtaag ttcttcgatg gggttcctgc aagttgccta atcaactgaa
    60541 accgcctttc aatctcctct atgtttttta gccaattgac agcattctct acaaatagag
    60601 tagggatgct aaaccttccc aatactccac cgaccccaga tgataatgcc gatatgctat
    60661 agtcaatggc acccgcatat ttctttagga atttgaccgc agcatcctca attctgataa
    60721 ttgcgtcgtc gagctttcga ttaatatcct gaacgtcgag tcctgtaaat ttcctcaaac
    60781 cctgtataat tgcttgtggt atgtccggag tttgggttgc ttggatattg atcacatcta
    60841 ctcctatgtt acaaatttca tcaatgactg tccacgtatt ggcgagaagt gatagtactg
    60901 caattttggc atcagcgaag cgtgcttcac tttctatcac agatttcgca gcacgctcta
    60961 ctacatcagt aattttgtgt ccgtgtgaat taacatcttc tattagaata ctcgttttat
    61021 ttgaacattc cagcagttct tcggataact gttcgtacgc agttggaagt tgatcacgct
    61081 cggcactgtc tgcgatttga ttcaatttag caattaatat ttctgtctgc gttaacaggg
    61141 ataaactgac ctgctgcgtt tttcttaaaa gaacactgcc cccttcactg ttagagtggc
    61201 atagctccag gagcaagtgt ttcttttcga taagatcctg ataacgcagt cttgtagtgg
    61261 tcaatatatt gctgatattt ttctctccga tgcgagccaa tagcgttgcc aatgggtcta
    61321 ttagaaggtc caccgtgctt tccaagtttt ttgtggagac cccgttctct ataataaaaa
    61381 ataatatgcg attgcaggta attctcacct tttcccgtaa aatcccagat cgcaaaaatc
    61441 tcgtcagtgc cggttcgaat gtctcctgtg gggccggtaa ccacttaaga ggatcttcca
    61501 aggcattttt tattggtgtt atggatccta attcaattgt tgctgatggg tttgtgtctt
    61561 ctgccgtaag taaattccaa gatagcttcc tcctggcgct atgcggctta gtattgcttt
    61621 gagcttctgg gtctgaacgt acggagtgtt ttctttgttt tcgtggtgtg aggtttgtca
    61681 gtttttctga gcttccgatt tgatcaggat tctttggccg tggcttctgt ctcttttttg
    61741 atcttggtct taccggaacg ctccatggag caatagcctt tctacggtcc gcgagttcaa
    61801 aaaggttctt ctgagaaaac tctgggttta gtccgagagc atagacatgc gccggaaatg
    61861 gatgaattat ttgtgtgctt aacgtaacac tgcttaattc agcatctgat gcgccatatg
    61921 atgccattac tgatgccgca atgatttcct ggagcgtttt ctccgatacc ttttcttcgt
    61981 cccacccatc cgcattgaac cagtagagaa aattcatatc tattgcaact ccagacatat
    62041 tctttacata tgcccgaaca aattctggga ggtcatcaat tctccttagc tggcatacat
    62101 aagcacttga catttcccat ccatgtgaat caaaaatgta cacaggatcg tcctttcccc
    62161 cagaacacac ggctgcaact cccctgtcac cgatgatcat tatgaatccc aatcctttcc
    62221 taattttctt ggcaatgatt ttggtaatgc cgcgtatatt catggaagat gggaaacctt
    62281 cgattgtgac ttccatgtca taacccacat tcccgtatgg tatagaaggt atcatgagca
    62341 tgtcaggttc atcccatgat gatctccaga gtctgggaag ttcgtgacaa tcaatcattc
    62401 gaaacgaaca tttttttgac ttgtcctcca ccttggcctt ccctgttctc gtaatctccg
    62461 ccccctggtc taaaatcgca tccaaactgt ccgcagagag catcgaatct gatcccgtag
    62521 cattcgcacc cccgcaggaa ggcggcggac gtctccatac acatatagta tctaacaggt
    62581 tcatattttc gagcaaattg gctggtcgac gcggctacaa taaattctcc gaatgccggt
    62641 ggtaatcttg tcggaggatg gaaatcctga gccatgttcg tgacctgcca aaactgtaca
    62701 tcagtctgct tctggggcct tttatttgtt tgggaagagt ttcgtaaatg tctagccaac
    62761 cgcacacaac aacgcgataa atacacacca ctcaattact cattagtctt tctttattca
    62821 aacattttta catttacact ttccaaaact cgatcggaaa ctgtcagaag agtctctgat
    62881 gagattagtt tgtctggaag tgtgtctaca cacccattgt ctatcccttc ttttgtcgag
    62941 tgtcgaacat agagcggggc tttgttggtt ttatcccacg aagtaatgtc tgacgcctcg
    63001 gtaataaatt gatttgatga tgtatcttga tatcccctgg catcaggcgg ccctaaaaga
    63061 gtaagagctg acgctgtatc ttctttagaa ggggcagaaa tttcaatttc ttccaatttt
    63121 ccttcaaggg tcgtggtccc tccctcctct atatctagca gagctgatgc cgcgccaata
    63181 actttaacta catcttcagg gttttggatt aagatgtctc gagagcagct tcattatctg
    63241 aaaaagtttt ccaggctttt accacatcgc gggccctttt taccccgacg cctgcgagtg
    63301 aacgacataa tgtccacgaa cgctggacga cagtattcct cgcgtccgct atgccagata
    63361 attcttcagc tactttccta caaatgtgag agcgtgtttg agcataaccc gcaagctgcc
    63421 agtatgtggt ctcaagtgca tgcgttttaa cctttgtgga atctaatgcc cgaatagctt
    63481 tttctgtgtg tcggattgca gtttctgcaa aattgacggc tttccatatg gcctgcatta
    63541 cagtatcgtc cttccagtgt cctagttctt ttttgtcacg gcaacttgag aaagaaacat
    63601 tgcccaaaaa atccgcattt gctgactgtg aaagcagtgg tcttatgtta gcagtcttag
    63661 aaagtagtat ttgcactgca gtagatatct gcatagatgc gttatttaga gtcttggaaa
    63721 cctcctcaag gtctctcgtt gcagcttgct cgaatgcctg ggaaatgaac tttgatctca
    63781 tggtatcgac ggcagggaca ggctggactg ttttcttaaa tgtttctgga agagtgtcga
    63841 ggctcctgtc gcatgcgtca gaaattttaa gcaatgcctt ttctatcgcg cttgcacttt
    63901 cgatggatat cttttctgtc ggattggtct ttgtaataaa tggggagacc gctaactgaa
    63961 attccaaaat tgctcgcctg tacttctgag tatcagacgg ttttctgaga gccctaatct
    64021 ctatccccga taaaagcttt accgcgtgtt gtaccgcgtc aacggtgaat ggataagttg
    64081 atactgcgta aacaatgtct ctcaatacgg tcgctacgga aagattggaa aagagttgca
    64141 tatcgatttt cgggtccgtt ccattacgcg aacatatctc ttcaggctcc gcgcccccaa
    64201 cttcaatggc ctggactaat tttacggttt ggtcaaatcc ataagtgtag gattgtttgt
    64261 cggcacttgc atacccctta tctttggcct tttccctgcg ttcgagccaa tccaaatttt
    64321 cctgggtctt tcctcctaag tcagatatga ggtgttgaac aaaattgaac acccccaaat
    64381 ttccaagcgc ctcgggtcct ccatcgctcc catctataaa tgaggccaga gtgtccctaa
    64441 tgatgtttag agcatttttt gatggggctg gggcaaatga tcgtagtggt agtagtagtt
    64501 cgctttcaga cacccctacc cgccggagaa gatgcgaata tgggtctccc caatcagata
    64561 taagcccagc gtaatgccct gaatactgta gcgtccgcgg attatatgta tacattgagt
    64621 gcgcagcgag tcctataagt gatgtatata caacggctcc taggaaatct ccaatgattg
    64681 ttccgtcagt atcttcaccc caaagcgcct cagccttttg gatatacagt tcgcagttgc
    64741 tcttggtaaa ccccctaagc actaaagtac gaattacttc ctctgggcca ccggtagcgg
    64801 ccaagtccgg cgaacgcccc atcatatcgg cggtacttgt tgtataagca gttagggtct
    64861 ccttttgttc ctctgtcaag ttattaggcg cgtcctcgaa aagctgtacg atggttggga
    64921 catctagggc gaggcgttta atgggaatag ttaatagact atctaagtcg tgccgccagc
    64981 aaactacatg tccaggaaca tgcgtcttcg gaggatctcc taacacgagt agtgggtctc
    65041 gactgtatgc agcattggcg tacagttgcg agatagaaaa gtatcttgag tctaaatctt
    65101 tagcgatcca tgacttggcc gaatctgtgt ccagatcaaa ggcagctagc gccgtctgtg
    65161 gaaacttccg ataagggggt tttactgtag gttcaaaata ctctctgacc atagagaggg
    65221 tcatcagcgc tttagttttg ggtagcccgg ttgaagccgt gatataattt aacattgcat
    65281 ggtatcccac taagccttgt agctttgttc caagatactg tatcccgtct tgaaccattt
    65341 ggtggtcgta taaaagtgga taattttcaa ttaaaggaga taggagtttg gttggctcga
    65401 gtcggtctcc ggatgtctcg aacaattgtc gctcgtcaac taccaatctt gccaaactcc
    65461 caaattccgt taaccagcca ctaattagac tccaatattc tacatttgga tcatttaacc
    65521 caggaaattc tttacgtaca gctgtttcta ggtcatgttg cagtccagta aatgcttctc
    65581 tcaaatattg aattattctg aaatcttctc cagagttcca tggaacagat atgcggctaa
    65641 taagagagcg tgcaaataat ttcaatgtaa cgtccgctac tgccggaggc gccattgtgc
    65701 atgcgagcat tatagtttca accatgtttt tcctagcttc tactttctcc aaatcttcaa
    65761 gtggaattct gtttctggag attagaattc cggtgagggc tgaagtaaca cccggaactt
    65821 tactgcagtc ggtgtgtaca gcttcaaggc aagccttgag gctatccgtg atggcctgca
    65881 tggtttcaat agtcgcgtca actcacggaa ccagctggta gctttataga cacgcttctg
    65941 aatgctttca cagcacagtt cttttcagaa gtgtgattag aggtagtgtt tccaggctaa
    66001 taataagcgt cagaacttcc tttccgcgct gttacatcgt aagcatgtcc ggattacttg
    66061 ctcgcaatgg atcgaacgat aaaattcgag cgccagaaag agggctgagt ggattcgcaa
    66121 acactcgcac tcatccttat ttacaaagtg tacttcctcg aagaactcac cagcataatc
    66181 tgttatcagc cgcgctgggg cgcctaacaa ctggccggaa tttttctcat ggtcttggaa
    66241 cgaggccagg gaaattcttt attggctcgg ggccacgtaa ccccgaagaa acaaataatg
    66301 caacgcttgg aaaggaagat acaagggcca tcgcatctaa acctcttctc gatgttgaat
    66361 ctacgaggac aaatgatgta atttctttaa cccaaataac tgtcatagac ctctgccagc
    66421 caggggtcga agagtctggg tctctaatgc tctttttgaa aggggttaaa gacttactca
    66481 agattttggg atcacgaccc gcccgcgagc aaattgtgag agatttagag actgcattta
    66541 tcaatttgaa ccgcgcctgc ggcttatcgg ttactgggga gagtgctgtc aaatccttcg
    66601 agctttcagc ggtgtctttg agttttgtag ctgcggccgg cgcggctcac taccgaaata
    66661 attgcggagt agaggcacta cgcgcgttcg taatcgcgaa ttataaggat tccgccatta
    66721 ccgaaaagct tgccaatttt gatgcattgc ttctggcaac aactgaggca cgagcgtacc
    66781 cccatttttt tctatcttta ggtgggggct tgataaaagc taccgaaagt gaaccagtaa
    66841 cgtgcatgcg actcttggtc agagggactc acgaagcagc agctgccgga gatcttctga
    66901 gaaaaaatgt gccgtactcc actttccatg catgtctgtt acttgacctc gatgaaggtt
    66961 tttgcccacc aaggacaaag atcaatgcag aagacggtgt ttactttcta catttattat
    67021 tcctgtactc taccgatatg ggacacccga ggtacgaact atatgtggca aaaacatctc
    67081 tccccgaaag ttgcatgaga gacattttaa atgaaagatt tacacgacgc agaataaata
    67141 atactatagc ttccttaaca cacatgcaag ctcaagaacg ccaagccttt ccccctttta
    67201 atattgcaga agctgcggtt gccgcgcgaa tggatctgag acgagaaaga tcaagacatc
    67261 cactggatcc gttaaggtcg tgatcaacgt cttagggata tgcagataac gtccactgga
    67321 ataccagacc attcggctct agtattcgcc gcatactgca tgctagggac ggcgggcagt
    67381 attggcggag agccttcttt ttctactatc cagaaaaacg ggactagtct aaagtatgtt
    67441 cacattcgcg attttaactt taggggcggc ccatggaatg tttgtatgta acacacccac
    67501 ttctaaataa atacaagtct gttcacccca tgtgtctatt cagttctcat tcgaggcaag
    67561 ggagcaagga tccctctcag ggcaattata ggattatctc ctgagcagcc cggagccatg
    67621 ctttcgtttt tcgatgaact cgaaagcatt gcccatctag aagagtgtct gcgggacatc
    67681 gaaacgcgta tgcgaacgtc tgggtttgat cctaaatcca tcattagaga cgattttgac
    67741 ataagggatg ggcgcgaggg cctcgccaac cggatctcga tgcttgtgga cgggtttaaa
    67801 gtttccgtgc tatttaacgt agaactatac cgactcctcg cggaactcgt tcatttaaga
    67861 attcgcacaa aagcagtctc attttcggag tggctagata ctagggggct atctgcggac
    67921 tgtaaacaat ttattttgga aaatgcagaa catatttctg cggtcgtcaa agacttctac
    67981 aacggaacat accatcagct tgcaagagtc ggtcttcagt cagctcaaaa atatgaatcg
    68041 ctgtatttgg gaaaacttgg caatggaaag ctggagagta tgggtcaatt ttttactaga
    68101 ctctctgctg aggctgccag aggagctttt aatattcccc aatttgcaca ggcattggaa
    68161 gttgatggcc aggttacacc ggcagacgtc tttactaggt tttttacgtg tttgagtagc
    68221 caactgatcg tacctcctac cccagtaatg cttttcgggg gtacgtctct ggctgcttat
    68281 gccagttgtt ttttgataga ttcatctggc agaaatacag agaggcgttc aatgtcgttg
    68341 cccgaagaag taattccgat catgaataat cgcggaggaa ttggaatatc actgccgtgc
    68401 cttggcgctc cccaaaatga gtcggggtgc ctgggatttc ttaaggctct cgattcgcta
    68461 gtagccgcga gcaacggcgc cgcaaagcgg ccaacagggc tttgtgttta tttcgagcca
    68521 tggcattgcg acacattaaa gattctgaaa attcgtggca gctcggccgg gaatgaagag
    68581 ttcagatgcg ataacatttt tactgccatt tggatgcctg atctttttat gaaaagactg
    68641 cagcagccag gaagtaaatg gacactgttc gaccataggg gggagcatct gtctaacttg
    68701 tttggagagg agtttgagaa ggagtatgaa cgtcttgaaa ggaaaatgtt ggagtggcca
    68761 ctatccctat caccgagatt atgttcagat aatcaaaagt gcagttccac cggcactcca
    68821 tttgtcgtct ttaaagacgc cttcaaccgt cactattttt acaatatgca acaccgagca
    68881 ctgaagtgtt ctaacctctg tacagaaatt gcccacatgg cagactccga tactgttgga
    68941 gtatgcaact tgattagcat caatttggcg gcaatggtca aaaatgctcg cgcaggactt
    69001 gctgggaaac ccggcagctt cttcgactat gaactcttaa gggaaacggc aagaactgca
    69061 acaattttcg ccaatgtcat gatatcactt ggaaacatgc caagccaacg ggcacagagc
    69121 gggaaccaca ggttacgatc cctcggtgtt ggagtccagg gactgcacac agcctgctta
    69181 atgcaaggtt ttgggatgac tagcgttgag ggctttgaat ttaatgacac tgtgtttgag
    69241 ctacttgcct tggaaacaac tggaatcagc tgtagattgt gtgagctggg gttgcctccg
    69301 tttgataaat atagagaaag ctattatgcc ttaggatggc tgcatattga tgggtggccc
    69361 aatacgaagc tgagatacaa aaatgagtgg gatagtctaa gacatagaat agatccatct
    69421 ggtttgtaca actgccaaac agttgctttg atgccaaccg ccagttcttc ccaaattaca
    69481 gaagtcagcg aggggttcca gcccgtattc gggaacatgt ttagtaagat ctctactaca
    69541 ggagaggaag tgcgacccca tttggcgcta atggatgcca tcgacgagct gtattctgac
    69601 cagggagaaa aacaagcatt tctagcaaac ctaaaaaaac atcagtggtc tgtgcgcgct
    69661 gctctgggaa gtgcttggtc agagtctcac gtcctcgcga aatttcaaac cgcatttgaa
    69721 ctcgatcagg aaaagttact atacttaagc gcacgccgcg ctccattcat tgatcactct
    69781 caatcaaaca ccctctacat caccgaagac gtggacggta ctttaagtgc gtcacgtgta
    69841 tcccgcctac tgcaagttgc ctttaaatac gggctcaaga ctgccatgta ctactgcaag
    69901 gtgcgcaaga tcacaaacaa cggagtgttt gtcgggtctt gcggagacag cctcatttgc
    69961 tctgcgtgtc aataatcttg ctaacatggc agaatatcag tccacagact attattactt
    70021 gccccagtgt gatgacattc gcgagctccg agacctgagc atagcaaata actggaacga
    70081 atttgaacta tgctacagtc gcgatgagaa agatgttgat ctactaactc cggaagaact
    70141 agatttttac aaattggtgt ttgcatttct ggcagccgca gacgatttga taaatttgga
    70201 tatcgggaat ctcatgactt tgttccttca caaggacatt caacactatt atgctgagca
    70261 aataagaata gagacggtcc actctagaac ctacagcttg gtgcaaatga tccttttcaa
    70321 gggagacctt catgcgcgag acagatatgt gacagaagct attaaagatc ccgccataaa
    70381 gaagaagata gactggctca accgtgtcca agtagaaacg gatctgacac ttcctgaaaa
    70441 atacattcta atgattctcc ttgaggggat ttttttcgtg gcgtcctttg ccgcgattgc
    70501 gtttcttagg aggcggaata tttttgtggt gatgtgccag tcgaacgacc tcatcagtcg
    70561 cgatgaagcg gtgcatacaa cagcatcatg ccgcatttac aacaactggc tcggggatca
    70621 caagaaacca tcggctaaac gaattcacca acttttcaaa gaggccattg aaattgagtg
    70681 taacttttta gcatctagag cgcctcaagc ttcgagactc atagatctag aagccataca
    70741 gagtttcgtg agatatagcg gagatcgact tttgaccgcc atcggggttc ccactatttt
    70801 tgatgaaccg ccccctgatc cgtcgtttcc ccttaccctg atgtcgatcg acaaaaatgt
    70861 caattttttt gagcaccgga gcaccgcgta taatggcaac gttatcaatg acttgtaaaa
    70921 gaaagttcaa acagtcaagc attatataaa taaaaactac tcagacagat attaacattt
    70981 tatacttgtt cttgttcatt ttttccacaa ataacttctt gtaatgacgg cagaggcttt
    71041 agatgcccct tcttaataag ctcagaaaaa tatttcgggg catcattaga aaagtattta
    71101 cacaatactt catatacagc gatcatgtcg agctgttcct gaaccacggg cacgcgctta
    71161 agtagtttgt gtctgccatt tatttctcgt gggccgatga cactcaaaac gtaggacaga
    71221 aactcgtcat ttttttcatt tctggcgcca ttatttaccg aaggatcctg agggcggtaa
    71281 tcaatgtccg agttaccatc gtcgggaggt tcttgaggaa actgagtcag tacatataca
    71341 tagcgtccag gcaaaggttc acgcacatct gtttttattc caaaaacatc actatccgca
    71401 ggcaagaccc cgcgctgctc aacacacttt ttggtatcgt tttcattttt ttcgtggtca
    71461 cgccattccg ccaacctggc agaaaatgag tatattgaat cggtagaatg gatgttagta
    71521 tgacagtcca cacatgcatt ggcaaactct tccccggaca tgcccaaata ttcaataata
    71581 cttttataaa agatagcgac tggaaatgct ggggtcagat ccgtaatcac atcacaaccc
    71641 atgaatacta agtcactatc gctagacagg acgtacgcca ccgtgcgggt atggaataga
    71701 ttggcacatg catagtcggc ttccattcct tgcacataga ccgtatcaaa tcctgcggta
    71761 gttattaagt cccaacataa cttgtagtgc ggaggacgta tttttcgacg tgtcttgtaa
    71821 atacaatcct tgggctcctt aatatcgctg catcttcgcg cggcaggtgc agtcggaaca
    71881 gattcttcct ggctaaggtg tttaggttcc ttgtattcgc gccgacgccc accatcaaca
    71941 acaaatacag gatagcacga tttccgactg agtaatgaaa ataagaacac caaactttta
    72001 aaagttctct ccatgcatcc catatttccg tccgggtcaa ttcttcgcaa aattagaaaa
    72061 agaacattcc atgtgtcgac tgccagtgga agataaaatc ccttctcaat ttttaacgat
    72121 aaatgaacac tgagtccatg gtttcgaata aagcgacgca ttcccaagat tcccatatcg
    72181 gtatatttcg aggagagcaa atgaaaagac agaagcccgc aagtctcgta tcagcaaact
    72241 aatatttagg gcgctttgaa aggcggtatt tgtatgtaca ggggttgggc aatccacacc
    72301 ctcgtaatcg cattacacat aaggtgtgac atggtggtag ccccaaaatt ttatgcacag
    72361 gctacagttg tatataaacc gcgcggatgt ttaggagatg ttcagagaca ccgggaaggg
    72421 aacggacgta cacacgaatt acgttcgttg gaagatggat ttggatactg cgacaagaag
    72481 taaatgtttg ctccgactaa ctttaggaaa gcatgggatt tcggtggttt cccccattgc
    72541 caaaaacatg cgtgggattc tgcaacactc tgtgctggct tttatgaatg actgcatagt
    72601 aatttcctgt tccgctccgt ttgggatggc tttcttaaaa atcaagtggc aattgttcga
    72661 ctcatttgaa tatttatcag acgatgagag tatactacct atcatgttca ataatactat
    72721 acaccagcgc cctggagacc tcttggattt tctgtgggac tctaagaaaa aaactgtcgg
    72781 aataccaact ttagccacat ttactatatc agaaagtttc aaatccgatg aaactagggc
    72841 tgtacttaga ctgaaagtct gtcgcgagat agaagagagc gcgtcgtgcc cccaaaatac
    72901 ggaaataagc acgaaattca agtactcttc atcggatgga cctcctatat acctgcctcg
    72961 ttccgataag gcatgtcggg cctcgctgga acagtattcg ttcaatgaaa ttacaaagtg
    73021 gctttcgaag atccctaaag atactcaatt acagtcccac tcccaagaga gtatgtcacg
    73081 ttctcgtccc gcagaagacg agcaacgcct aacctttaac gcgaaatggt tcggcgacca
    73141 gacaagtatt gtatcgtctg cgtcaatttt gtctcagcta tgtggccatg aacctgcgcc
    73201 taaaaaaaga gagctctcaa gccgagccat cggtaagaaa ctaaaagaag cccgcattat
    73261 cgctgttcat ggggacaaag atgcctgccc cattgtagta tcactctcca gacccggatc
    73321 tctgaaacag tcactagggt ggctgaaaag cggtccttgg ggaccaccgt gtcttacatt
    73381 ttacaaagac tctgtgaata gtcttggagt agaactctct gaaagaggag gagaagaatt
    73441 agctgctggg atttttttcc tttccgcgtt ttctgcagat ggagcaatct ttgagcaatg
    73501 ccatgatgac tcagacacag ccatgcacga atttttggcg gaggaggagc gcctcataca
    73561 acagaccacg ctatcccatt ccaactcaag taagaagagg tcgctcgaaa attacgagga
    73621 caccgatatt agcccatccc accacccaca aaagcggggg aaattaaaga acggctcact
    73681 tgcacggaag aactaaaatc gtctcctcgc gtctaccggg gagctcagtt tactgccagc
    73741 gtttgtgacc caagtgtgcc ccgtgatttc aactctaccg caactatgac gggggctacc
    73801 ataattgatc cattcgcacc gcccaagggt aaatggtgcc cgttcaattt gaacgggata
    73861 gttttttcct tgatgatgtt tattatattt ttagcctgga tactgtgcat tgactatgga
    73921 ctcgcgttag cttacattac ctgggcaaag ctttctacga aagaggcaag attcggatgg
    73981 atgatcggac tattggtggc tacgattact gccagttttc tggatattca atactcggct
    74041 cacaaaacag tccgaattta ttttctggtg atgctttcta tggcgagcgc agtaataatt
    74101 atatctctca tccattccaa cagccccaat gccgcgatag ttatggggct attctccgtt
    74161 ctttcggaag tttgcttgat actgattttg ggatttcaac tccgaccggc cattttctgc
    74221 agcataaaca tgacctggct ctttcttgaa gccatgctcc taaatttgac cgtactttct
    74281 tggaacttga tgcaccttcg agtaaaccct agatacttgg aaccgttggc cctttttact
    74341 attaacattg ttggcataca atccctctcg ttttatctgc tcaagagtga tttttttaag
    74401 accagcatga taactctgac gggcagtata gaaccatttt ccgaagataa cacgatttat
    74461 acacccccaa gacaacataa agatactcgc ccttcactga atgacggacc aactcggtgg
    74521 tgcggttact gtattctcgt atctacaaca ttggttactg ccgctttcgc ctgcacatta
    74581 tcattaccgt tcctgggcaa agatttaggt actgtacgca tcggcatgca aacgaatttt
    74641 aaaatcctca tggtagcgtg cggttcggtt ttggcatttg gatctacttg cattggaaaa
    74701 ctatgcaaaa tccatatcgt tgtatggttc gtgataagca tactattaac cttcgtgtct
    74761 ctgctatcac tgattaagtt gattgaggac ccagctggca ttccatttgg tgtcattctt
    74821 gcatcggttt cttgtctgtt tcaagttgga gccctctttt tccgagaatt aaaaacggcc
    74881 acccatacac aaggatggat ttcatgcgcc cttcttttct gctccctttt cattccaatt
    74941 gccgcgccgc ttgtgtgtga gtacaagctc tgaattcttg tctaagggag acgtgccaat
    75001 tctgacaacg ccctaagcca acacaaatgc cttcctcaat ttacgcgcta gcttgaacat
    75061 tccaacaaga tgaatgcatc gctaacatgg cttgctttaa cttttaaagt taccttgagt
    75121 ttcagcctgc tctgaatgtt ttcctccaaa cctaagatgt tcttagttgt acgatttttg
    75181 tattgcgaat accacatcat ccagtaccaa agtactaatg gtcggcaatc gaatagaaat
    75241 caaacatggc acgcaggaga ctgtcgcctc gaaactgcct tcgccgagct gcagaaattc
    75301 ggaacgagga cattagaaac agatctacat tccaccgagc aaccgtttac tggagaaaat
    75361 gctagagaat aacctaacag gcggccttca actttcacta cttaacaact ggaactatat
    75421 tgtcgaggat tgtcatagtc acgaacatga tgcagtattg cttcggatgc aatctatatt
    75481 ttgacattgt taataaagca catgtactat gcaaagtttg cattcgtgta attcgtcgag
    75541 agagaaagtt acaagttcga ttctctcgcg ctaggagtgt ttccacgtgc gaaaacgcaa
    75601 aaattttcat attattcggg cggactgtgt ccatagtagc taaattaccg cgatctggag
    75661 actagggcat tcacgactca acatgcagca tcagagtact gcgctagttt cgagtatact
    75721 tttgctcttg agcctgcaaa gccttgcgtt tgaatttttc tgtgatccgc cacacgtttt
    75781 tcgagggcag ctcggtgacc ccattctatt gcaatgcttc agcgacagac ctctaaccca
    75841 cgaagaatct gtaaaagtag aagtaattcg acacccagcc agcttagttg aaactgcgct
    75901 aagcgcctac gggatccccc cttcgctaga tccatggaga gctactccaa gaactctcta
    75961 cacatatgat gccgctactg attcaatcaa ggacctagga tacattggtg aagatggaat
    76021 taacccacca tatttggacg actgtcgttc aggttttttc aatgtctcta tcaagtctag
    76081 catgagatct cacatggcgc gttatcagtg gaccgcaagt cgagggtcta caaaactaaa
    76141 tagctctttt atcgacgtct ttttggcaag accacctaca actgtccgca tcaaatcaga
    76201 agaactgtac gaagactcag ataaggcttc gcacttaagt gttgaagcgc ttggcgctta
    76261 tcctccatct gctgcgctgg gtacatggat gatacataat gcatctcttg ctgaaaaata
    76321 cagtttagaa agaagagttc tttatgcatc aggagagaat ggatcggtgg atcagacatg
    76381 ggaactggaa atacgtggag aagccagcca gcccctccct tccaaaattc aatttgtata
    76441 tcgatggacc cctcctgagg actttgaaat gctacgacct gaaactcgct tgttaaggtt
    76501 gactcccagc tggattagca agccccgcat cacggtacaa ttcgtccctc ctgcctatgc
    76561 cctgtgtaga gcagctaata ttatagacgg ccgaggattt attgaatgga tcgtagataa
    76621 tagaatttcg acgagcccac accagacctt tgttttggat gagcccgagg ggaaaaatat
    76681 cgttacacta atggacgtca taaaactacc accggaggat acatttcaat ctgcctctaa
    76741 ttacgtgtgc gtcataagag gctatgaaca tgcatacaga tatctcaacg cctccttaat
    76801 gatagataat ctgccaatgc ggcaaggatt ccccgcagtc gctgcgattt ttattataat
    76861 tagtatcgct tttgtgggtg ggttactagt tgcttgcttg ggcgcatggt gctggaagac
    76921 aacataaacg ctcatttaat aaatgacatt acaaacgtgc actactgtct gtccaattta
    76981 tttcatcgga aaccttgcac tggcaggtag tctcaagcaa gcctaaacga tattatagat
    77041 ttcaatattt ctaccagatc cgtccgatat tcccaaatga ttggagaaat ttcttcctta
    77101 gtcatcttcc acagatcttc gattttgcgc ccaagctcaa aatttccagt aatttcagaa
    77161 acctcactgg ccgcgtatgc ctcctcgtac aagtaaatgc agacgagagc cgcggcggtt
    77221 cgctttgcag tgttgaccaa aatttcttgt ggaattttag ttcgaaggca cgctgcggta
    77281 cttacatctt tcattaaacg ggtttttgcc gcatcgagga gtaccgctgt ttctgggatt
    77341 aacgggatac tctctggtgg atacgaacat ctcggtttgg gttgcacttt gggattcaaa
    77401 caacagctga ctagtgcatc ttgcaaaaca tagtgcgtgg ccagcaaagt tttcaatata
    77461 ttgagaacaa cttccgacaa ttcttgtaat tgtagagttt cggggctctg gatttttttg
    77521 agcccgcttt tttcaatata tctttcacag acaactgtaa tttcgtcaaa gtgacaagga
    77581 tagtgcccga gcataagtaa ataattaaac agagtataag gaatcactga gcttcgcccg
    77641 aatgatgctt tgctgaggca tcgttggcca gggtatggca gcgtgaccag aatgtcagcc
    77701 tcgtcgcgca atgtactttt cagttttgct ccatcagtct cccatgaaag tccgatagtt
    77761 gcgagaagtc catgtcgtga aatcgtggcc gcatccacga tcattaacat cttccagagt
    77821 cgctttaata ctttccaaca ttcccagaaa ttttctacat cttcgtcgaa catttggtcg
    77881 gggtaaatgt gtttcacctg cacatgatct gagaggatag tttttttctt acacccacgc
    77941 agggcttttt tctcatttcc tactgcgacc gtactaatga ttttacctcc cgtaataata
    78001 ataggagtaa aaatctgtga ttgttcatga atcggttctc ttgttaggga gttcaagaat
    78061 aaatcttcta aatcttcttc tatgaacttc ggcagagtag taatatgtgc ctgcgttagc
    78121 accagcgcac tactatctac ttgataccta aatcctgtcg tcgtattgat tagatccggg
    78181 gttctaaata acctcagtac tttattcctc agagagactt ccccaactcg tatttctagc
    78241 gtttcggaaa cctgcaggcc gacaaatatt ttgcacaaga tcggtcgtct gatctccacg
    78301 gtaaaattat caatcaattc atcatgtgga gattctgaaa tttcaccaag atgagaagta
    78361 aaaatgtatt cttcctcctg gcggtcaaaa ggcatcccat tcaaacgatt cagttcagtg
    78421 ttaataatcg cacacatggt agggtgtttg atcctaaaac cgaatttggt aatatttttt
    78481 atcggcccgc gagtagagat cgagtagatg catcctccat agataatgta gagtcgtccg
    78541 ctgtggtgat ctatgtagcg tgcaggagac tttgatccgc gcttggagac ttcttgaaaa
    78601 gccacttcca tttcagtcct tctccaaaga gcttgcgcgt caagtgacgg taccgctatt
    78661 ggtgctttaa aagtatccgc cctttatact gctccaattc tatcgtagca taaagttttg
    78721 acgatcatac agcgcctgcg tcttggcacc acctacaacc aaacctgagc tctccttcaa
    78781 catgacaact ggaaacgaag ccaattcaat ccgcctctct tcagtacaag taccgggaaa
    78841 ttgtgagatt gacaagctgt tggctggatt tgactacgaa aaagaacgtg atggtgacta
    78901 ttcgacactg aacgaaggat ccatatttct aaacgatcgc cttatagctt cgggaagtga
    78961 agatacatct gatctacaat atacgcgaat gaggaaacaa actttttatc ctagtttagc
    79021 ccttctttta aaaatactct gttgtctgcc tttcttttgg tacgggaatt gcacgcgaga
    79081 gaaatattta tttgtaaacg ctcttattat cactgccctc tcctgtctag aaggactatt
    79141 gatttccttt tttgtgtacc gaaacgtgaa ggctgatcgt cttcctttaa aaggtcctga
    79201 aaaactcatt caaatggtgt tatgtatgat aacggctata tatggggcga ttatcttttc
    79261 aaggcacctt tttgcggacg atgaccttgc tatttcaata tttgcgaaaa actggacaga
    79321 cacacaggaa gccttgagaa ttggtcattg ttatctctct ccgtattttt cgatgtgggc
    79381 tgcctgtctg tactttataa ttcttctata cgacgttatt gacgtgacac ttcctctttt
    79441 gtgggcctgg acaatattaa ggacagcaat aagcttctaa atcgttttac tgctacacga
    79501 aatcgcaaag ttaggtggaa ggatcgcgtt actggcctca taaaccccgc cttgaagcct
    79561 cacccccggt aaagacacga taaaggcaga gactgcagta ttataacggg ctgacttcgt
    79621 aggataaagg caacctacaa ctctgtgtgc tcaatattta gccatgaatc ctgacaacgg
    79681 gatcccgcat aacagtcatc atgatcgcgc agcattccca agatctgctg cccctttcgt
    79741 agcatctggg gaactgttag gaattcttcg agaaaattgc catgcgcatc tatatgaatg
    79801 gataagccgc gaaggggatt gttgctacag acacagcttt gatattctgc tgggatctta
    79861 tttcaataca ctaacgctca ccaactttct agaaaccgga ctttcagttg catgtatttg
    79921 cgtgaaattt ccagagttac gctatgcaga ccgaggaata atccagtttg tagtggctaa
    79981 tcccatgatt gcaagaagtg attgtgaagt accttctcgg ccatcattta cctacatcag
    80041 taagagatgg tctaggacga cattatcctc atcccttgtg atttgtgcac cagctctggg
    80101 cttgctaagt ggcgagtcac ttgacgggac cgaaatatct gagttttcta gattacaggc
    80161 gttaaaccaa cttgcacgaa acctcaaact aactctagac tcatttgaaa gaggaacaat
    80221 aaatcatgtg ctgagaattc taatccgaaa agctccacca cttcctcttc tacgacccat
    80281 gatggcggcg ttggaatgtg aacgagaaat gtctacggtt gccagagcaa atattatctc
    80341 cagtatgaag gcagccctat gtgaagattt gtttttcata gataaggaga ggggacacga
    80401 gactccggat ttcgcccgaa agctattagc cttaattaat tgcacgcttc ctagtgtaac
    80461 cgatgctcgt gttacacaca taggtccgga tggtcgactt atagaagggg tgattgttac
    80521 aaccgaagcc gtaaaaggcc tcatcgcggc ccgccttggc atcgaaactg cccgtgccaa
    80581 cgtcccggca atgtacagtg agatggtatt atctggaaat agccttgtaa cggccttact
    80641 gctggggaaa accattcgta actttgatga agccgccgca aatttgttaa gctttttgga
    80701 cggtgaaaaa aatctcgccg attttccaga aataccgtct aataacgcag accaagttcc
    80761 aacaatgtcc gtcaaaatgt ccctgctcaa cgtgggggac catcttgtca gcatagaagc
    80821 actagagcgt gtttacacgc gcactggagt tccctaccca ctctgtgaaa atgtggatct
    80881 gacattcttt ttcccacttg ggttgttcaa acctgcaata gatcgttatt ccacatctga
    80941 gattgctcct gcggtcggag ccccggatta tcgccagttt ccccctacag aaatgtactt
    81001 tttcaataag gacggcatga tggttaaact cacgtttgaa gactcattgc caaccgtcgc
    81061 acatcccata gcacatggaa tgctggaagc tttggcagaa ctttgtcaag aaccatgggt
    81121 ttcaaatcgc agacctgctc cgatggggtt cacaattcaa cgtatcggac taaacccacc
    81181 tcgcctgtta atgatcgaat tcttggaagc ggtagcacgt actgcccctg caccataccc
    81241 agacgcaact ttaatcaatc ggaaaaatcc agatcaattc tctagccata ccaacccgtt
    81301 ccttccatta gaggttcacc cgttctatga tgtgtacaga gttgcgcagg atctaactat
    81361 tccctgtgat gaaccattgt ttttcccagc cgaaccaata acactggccg cctctaggcg
    81421 actctgcaac ggggatattc cgttgccgct gtcttcagtc gattttagac ttgccagggg
    81481 gtactgtatc gctgcaggaa gacacagact gcacccttca acggacgcag ccatagaaac
    81541 aacactatct gatgtgaatt acccactggc tttctatgta attgaagctt gcatccatgg
    81601 cgatgaattg attttcatgg aatcgcagag gctagtagcg cagtgcatca atagctattg
    81661 gcatacatca aggggactag cttttataaa cagttatcca atggtaacgt acatttatca
    81721 caacatgact ggaatgatcg atcgagattg ccactccaga tatgcggatg taatgggcct
    81781 gcttcacgca ctgagggaaa caatcagaaa ttatactctc cctgcggaac caattctcct
    81841 gcgttctcat gaggaattaa acaatctcat gacggacccg gcactttttc cgcccatgat
    81901 ttatgactgt gattccatcc taagggcacg cactgcatgc gcgactagag gggttacgat
    81961 ctccaccttc ggagagagag cacctaccgt ttctgtcagg gaatatccag cccaagtgga
    82021 tttcaccgtt cttagtaaca ctctaaatca cggcccagca tatactgctg gcggaagaca
    82081 tgaaggagga acccatcatg actccgaatg gacagtactc agcaaattgt tttactatgt
    82141 ttttctacct gctgtctcta gagggaggtg ttgcagtgca ggagtcgagt ttgaaatgat
    82201 ctacgatctc attaacacta ccagacttcc agatacagtt gatgaaatgg acaatcaggc
    82261 aggtgccgtc gacagaggtc ctttggcgga tgaaaatctt gcccccgaat cctttaacac
    82321 tttgttggca aatggatcca taaatctggt ggataatgaa gctctggtag catttatcgc
    82381 tgccgcacgg cgccgtcagg cagtacacac gatacctctg agagttaact atttacctga
    82441 cccgggcttc gaaactatag acagcccgag gaattttttg gtagacggag tcttatacaa
    82501 tggaataatc atgatgaact atgctcaata tgacgcgaca gctattccat ctcgctattt
    82561 ctatgcattg cctgtgaatg gattctttat gaaccgtact atcatagaag catctcacag
    82621 ggctaacgtc aaccttacta atgtacctga ggacttgcca ctagttccta catttttggg
    82681 gagcgaagtg tatcgctcca taagagcacc gtcgtaccta tttgcttcga gagcttcaaa
    82741 ctatgcctca aactcggtcg cggcatacag cttgctggca ggatacttca agacgtctcc
    82801 cgtcgcactt gtccatcagt tgaaattaaa tcttcatcca gggtttgctc tcactgtcgc
    82861 ccgccaagac agatttgcgg cggatcaaat tttatttgcc cgaagagcat cggaatctta
    82921 ctatctagga tctccagttg taaccaaccg cccagagaat gattctctcg taattgagat
    82981 aagtcagcca agggggcaca tagatatggg tctgggattt acagcgagtc gtgttcctgc
    83041 aaaaattaat acagtggtta cagacatggg caatcattgc caaaatctct tcaatgcccg
    83101 ctaccctggt cagtttcgcc atgcggaagt tgcggatttt attgcctctg aaataacaga
    83161 caatgactct acagccttgc ctagagcgca gcctcccatt ctgctgtctt acgaaaaggc
    83221 acccatcccc ccttgcatag agcggggaca gcttgctaca tgtgagtttc ttttaactcc
    83281 agtgactgcc gatcttgcat atttttatac atcagcaaat ccccgagggc gcagcagctg
    83341 tatcgcgtgc accaactgcg aggatccatg cgcgagtgaa actgaaaagg ctatgtatga
    83401 ccattctacc ccagatgcag cacacccgtc tagggctacg aataatgctt gggcatcgca
    83461 aaagtattca gtgggagaca aaatgtataa tgcgcggcgg ggttttatta cggccagtga
    83521 tttttacagt cctctgagca agtttatgac gccatctaga gctgaagata agagtcggtg
    83581 cctggctcgt ttgatgagag attcctctgc ggcaattagt tcagttacgg gtgacactga
    83641 gtatcaattt gtcgccccgc ccggtgccaa cgaattagta actgatccgt gcgcaatgtt
    83701 tcaagaagcg ttcccacccc tttgtagcag tgacaaggtc ctcttcgcaa cctacgaagg
    83761 ccctaataga gcatctggat ctggtgcaag agaaaaccac tttgcgcagt atttgattca
    83821 cgataagtct ccaatcgcca atgcgttaaa aaccccatgc aacacgcgtc gctaagacgg
    83881 aattcgcaaa cgatttctac ccgtgaaatc acgtcaccgc ctggtctgtt tgggcggagc
    83941 cctttcaaaa cttcttcata agtgtttcct gtgcagatga tttgcccacg gagggatata
    84001 tagcgcatac ctaactaaat ttcagaggac agaagtacag atcgtatcag ccagaacgat
    84061 gacaagcgga cagtacgaga tccgcgttgt tctgccaaat ggactgacac gagatgaaga
    84121 agatcgtctc agaagcttgc gtgggactat tttaatggcg ccaattttgc gaaggtgtgt
    84181 ttttctgcac gaaatcgatc aaaaatcatt tttcgcccat ggaaaagaac cagactatgc
    84241 aactctgctc acagcctaca ggagacgctt tcccatatta atagtttgtg tcgaaaaccg
    84301 agaattgagc gccatcgcgc tatccatagg atacccgcgc ggaatcagcg tgcgcaacac
    84361 tggtccattt agtttgaaca acggtgatct cgtgtcttta ctgccaccca ttacgaatac
    84421 gcgttttcgc gtcgacttgc catcctgcgg ctctgtaatc gagccagcca tgacaattcc
    84481 tttcgagatc ggaacagaac tgatgggaaa gatttttgca gggatggcct atgacttctg
    84541 cgttagaaat caaatagcga caacccgtcc tcgtgatatt tatgttgtaa catataagaa
    84601 caagacactc gatctatcta cattgccccc gtctgatgcg gctgcacttc aagatacaat
    84661 gaaaagccta ttttcatcgg ttctattttc gatacacgag ggggtcatgt ccgttttgtc
    84721 actaatgcct gctttattgg caggaggggc gaacgatcca tttctcaatg ccattctaca
    84781 aatgcaaagc atgaccagac tttccgtgca gctttttaat ccacccgcgc tagaattacc
    84841 ggaacctgct ggcagctctg ggcgatatca tgtatttgat gcttttgccg cgtggctttc
    84901 aatgtctcac cgacttggtg atttattcaa tttgaaaccg gtcctcaaag tagtaatgtt
    84961 ttactcggat gattctaccg cagacgaggg agacctcctc aacgccattg taccttaacc
    85021 cgtctgtgca tctctatgaa atgacgagac atcatatctc tttgatttgt gaataaagta
    85081 tttattatcg aaattgaatt tatgctggtc tctgtcttct accgatcggt gcgatggggt
    85141 gatatccggc agtcggggaa ccttctagtg ctaagtatgt agacattaca gcggccacta
    85201 acatgtcatc gggtacgcgg ccctgcttac cgctaaaagt tcgaaaggaa tcgggccctt
    85261 ggccatgagt aacagtaatg ttccttattt ggtctacgag atactcgcat ggatctttac
    85321 tgagtacaag ggtgttcgag acaagttcct gggaagccat aaagcgccca gagttaaata
    85381 ggctgacaaa caagtcaaat gctctgctct tttgtttgtt tagaagataa aaagggtgag
    85441 ccattgcagt tccaggctgc cgactgtggg caaaagtcag agaaaagcct aacctcctac
    85501 gcaaagaatc caaaagctct gtcaagttgc cggctatggc agcagcagaa tcctgactcg
    85561 aattcccctc caccgctata cgaatttctc gaaatgcgcc agcgtgaata agacaacagt
    85621 atgctataca caaatacacg cactgggcaa tttccagcgc cgcctctccg gtcagtgcat
    85681 ccaagtaaaa atgttcagct cccatgagaa ccatagagtc tcgcagcgca gtcactaatg
    85741 ctatgccagt accagatgcg cttctgtttg tggtaaatgc aggatctaca tacacagtga
    85801 gaattttccc gagcccagag atgttgggtt tacttgaggt agatggtctg taaatcaaaa
    85861 actgatccaa agctcgcaca ggaacaagtg tacgatcgga gtcatatttt ccagcacgtc
    85921 caccggcaat ctcatgcata aacgaatctt ttacgaacaa atctgcggta tttcgaacct
    85981 cgctgtccat actaacaaag actggtttgt gcaaaacata acaagaacag gtagtcacgt
    86041 ctgttctttt ctggatttca ggcatgtgtt cgtcgcatat ataggtaaca acattaagca
    86101 gagagtttgt ctttccctta agattgtaca gtagactcgt gttactatgg caagtgttgg
    86161 tagaagatac gaagaaaagt ttgcagttag tctgattcaa aaaccccatc accgtgtgga
    86221 gagcagccgg ttttataaaa tttgcttcat cgacgaacag gaaattgaag tcctgccccc
    86281 tgagaccctg caaaaacaga ccagcaataa aagatcacac tcaacggaca tgattcattc
    86341 accagcgcgt cgcaatggaa gtacatgtct tagcagcgac atcgaagcta ttatcttgcg
    86401 gtgaacagga gggaggtcct gcgccgatac taagtcacct agtcctgtcc acgcagtgct
    86461 tagaaggatt tgaagttccg gttcaccttc ttagtgacaa taagttttat acagaaattc
    86521 aaattcgaca ccacggatgt tttgactgca cagagtggaa acaagttttc tcaacttttg
    86581 tcggacaccg ggcactcgac aaaattctat tacctgagtt ggggaattgt caagagcgcc
    86641 cctttcgaat tacgtatgat ggtgggaatg actggggagg actgttcatc actatcccgg
    86701 tatattgcga cgcagaaaag atgacatatg atgattttac tgcggtggct atacgaatag
    86761 ctataggagc tgcgttggaa gaatattatg aacttctatt cacgtatgga gagctggtaa
    86821 actcttctac tcgctacaat gtagacagtg ccagattaga ggcgctttcg tgccagctat
    86881 tagagtactc tccatcacat ttaaatgaag ctcaaaccaa gtattttcgc gatattaaaa
    86941 aacggctctc cgaattactc ggcaaaaacc ggcaatatgt aataagcgca gctgaatatc
    87001 tctcaaacaa tctacaacga tttgatgcgc caccggacac gtcagccaaa caggctacta
    87061 taaaagaaag gatagacgag tctacacatc tcttgaaaca ggtggcaggc gcttccatgc
    87121 tgcccatgaa gaagtacacc cccgttcccc aaggaagtga aaatttgagg gcggtggccc
    87181 aagggttgag cgctctcgta aaaacgctag ggacccgagg cactgaaaag atagcagatg
    87241 ctcggttttc atcaaatact gcaacatctg aattagagcc accaggttgc agcagaggtt
    87301 tcgaaaaggc ggcaccacca atgcctgata taagaaatgt tatcatgaca gacaggcaaa
    87361 aaaccacaat gtctattaca tcaagatcgg taacttatta tactatgtat gattgtctgg
    87421 cagcagcctg tgaaatcatg gaggcagaaa ataattctac cagaagatca tggtcactcg
    87481 gaaaaatctc aattgtgttg atgtcgtgct ataactctgg agctccaatc atggttgtaa
    87541 attattccca agactcgtta aagttatgct atccaaaggt tagatctgga gcttcaatac
    87601 tagctacaat aatgagaccg ctgggagaaa cctcagtaca aaatttaacc gaagcagctc
    87661 agcaagaaat agtgaagaat gccccatgtt ttcaatgtcc tttgaaagct ttgaaagatc
    87721 cagattctct aactaaattg tttgcagtgg actgtgaaca gttgctcctt tatagtttcc
    87781 aagcgcgcgt ggctgcagca ttcaccgcag cggtgtccga ggccattgta cgagcaactc
    87841 acacagagag caatactact cggctcggac agctaataaa ctacgacatc cctttatacc
    87901 agccatttga cagcttggaa gcaaactggc caacacaaat agcacgtatg gcttcagacc
    87961 taatggcagt tctctgtata actcttcaaa gtgaacgctt gtccgtcttt atgaaaagtg
    88021 gaatatggcg cgccatcttg gcaatgttaa ttcgaaagga aaatcaccga agaccatacc
    88081 tggcccctgt tcatgtggag gatgacgtgt acctattcga ttatttcaga ttcggatcga
    88141 gtaatattgt aagaattacc acagagcctg ttgtgttaaa ggctcgcaaa cccaaaatag
    88201 acggcctcta cgaacttgat ttcatcgcta gtcccccctc tggcctccac ccgtggacta
    88261 aacaaaaatt ccgcccagga gaatttcact cctatatatg cgttggtttc aattcggccc
    88321 tgaatgctct tctcatcttt cctggagggt ttggattaga atttgatttt ggcgaagcac
    88381 taaaagaagt ctgggaggat cacctggatc acttagtatt gaaacgcttt agtaggcgtg
    88441 caccatacta ccctgaatct tatctcccga gctgcgaatt catgcaaaag ataaacacag
    88501 ctgggtagct agaaattgcg ccattggcac gtctgcaggc attcttgctt aaatgtaata
    88561 gcgtaggaca tagaaagcag ttaataccga gtaattaaca attagtggtc aaatggatta
    88621 ctgttaggac taggtaaatg tacagaatac ttacattcgt attttgactg gaggcgaaga
    88681 caatcgcact tttgtttcca ttgcgaaatg taaatgtgat cgtttccccc ttgacctgtt
    88741 ctacctgttt tgcgccaaac catttgtaca ggcgagtaaa aatttcaata aaaacgggct
    88801 ctgttgcttt tcttaagtgg gcagtgtatc caatgcgtat tccttcaaaa gatgaaacca
    88861 gtagggaaat gagcggaact aaaaaccacg ttttcccgtg cctccttgga actaaaaata
    88921 cagtagttct ttgtctaaaa tgttgaatga tattctctga aaataatgag gtattaaaaa
    88981 cggtagacaa gtatctatta cttcgttccg tggatccttc ccccaagcaa atacttgacg
    89041 caaagtatgt agcatgcatt aagatcattt tttgaaataa ttccagtgtt ccgtctctct
    89101 gttcgctagt tgttttttcc aactttgccc gtttgtagtc atttgaagct tgaccagaaa
    89161 atgacttttt taacagtgtg tgaaatctgt aaataaagtt gttcagttgg gaaaattcat
    89221 cagacttgac aaacccccgg tagccattca ttattccgtc gaatgctttg tcatgtatta
    89281 gggagtcgct tggagcaaac ctggcaaaat ttaagtttgc gagtttctgt cttagtgccg
    89341 gaaggatact gtcctcggct gcacctgtga aaagttgccg tttaggggat acctgtaaat
    89401 cgtttagtgc ggcatcggta tctgtgtact tggtagaata ggaggccaga ttttcgtaaa
    89461 tgatttctga cgccatatat gaaaacgcac gcgaaatagc acagcaatta tgaaaagatc
    89521 ctataggggc aatgcacgct tgatggcgct gtggaacatc aatcgcaaat tgaaatctgc
    89581 tcgccggtga attcatggta tccctcgctg aatcattcct atcacatata cttgcagtag
    89641 ttataaaatt ggagtcactc atttcttgcc catccacgtc gtctggtcct cgttccattg
    89701 ttcgcttacg caaagcatcg cggtatcttt tgacaatttc gaccgattcc tttccaagca
    89761 tgtcttctgc gagagactac cgaaacaggg ctcgggccga agttatgaac tacattaaag
    89821 ggcaagccta taaagctgcg gtcatcgaga tgatgtctct caaagttcct cgaatgcacc
    89881 cagctctgcg ctattttctt gcatcagcta gggagcagga agctgtttca gagataaacg
    89941 tgcgctcaaa taagcgcctc agctctgtca ggtgtcatgt tgctcggata aaagcagcta
    90001 cagagagtca gagagcatta agactggagt tggatggcta cagaagatat ctaaggaacg
    90061 actttttaga aacattcgct caagagtcag aagccattgc agatgcggag ctagacttgc
    90121 agcgggcaga agaagaaatt gctctgtata tttcaggtga ccctgatcgc agagacagct
    90181 tagattgtga ggaagacgac cttttattaa aatggcaact agaaaacgta aatcctccga
    90241 cgctactgcc atcaccacat gcaccaagtc ccgtcagtcg cgggaactcg ccaagaactc
    90301 caccgactcc cagtccaact tttcaagaag acgaatgccc agtagaagaa tactaagcaa
    90361 cgatgatgga atcgaccttg agcatatagc cccggtctca gaagatttga caaaagaatc
    90421 gagacagctt gcgatctaca taatgccgaa acctaacaaa atatgtctca aggtcaatcc
    90481 aaaaatgagc taccgatggt ttaacctaga agggtcaacg gtaattggaa atggtggata
    90541 tggatcagtg cagtatgccc caaagtacca catggcagta aaaatatttg aatcggatgg
    90601 tcattttcga tgggaactag caatgtcctt gattctttcc aatgcggcaa gaagaccaga
    90661 actttccgac atcgccaaac atttcttaca gatctatgcc ttttcaaaaa tcgagagagc
    90721 ttttgtaatg gaaccgttga gccatgacct aaaaacgtac gccaaaagat acaaagacaa
    90781 ttttacaatg gaaacattga ataccctgac atctgagttc aaaggacttg cgaaggcctt
    90841 ggcatttctg aacattgatt gcggattggt acacatggac gtcaagagta acaacatact
    90901 ggtcaaatgt gatgcgaatg gaaaacttag tcgacttgta ttggcagact ttagtttgac
    90961 aggccctaat actaattcta ttctcaacca gagcatgatg gtgtgtcctt caagaggagt
    91021 agtggaaggg ctaaaaatta tagattcaac gactgtaaag aatcacattc catctgactc
    91081 ttttatcata tataacggcc actgccgagc tccagaagtg ataataaatt attgtaatgg
    91141 gaaaaggtat cgcgaccagc caatggacgc cctggaaaca cttggattgg atctattttc
    91201 ccttgggcaa gtagtgcagg aaatcttatt tgagggaatt ctgtgcagat cgcgcgagtt
    91261 ttcgtttaaa ccaaaaccaa acactattca tgaaaaatta agtcacgatt acatgatgag
    91321 ggttttggca tatcgaattg tgctttccga caatctaatc tctagaggct gtgatctaag
    91381 tttcaccggt ccactaagtg gaacagtaga atcagtgaac gcatccctat ttcgagaatt
    91441 agacagaatc cttttccaga gtcacgtcga aatgtatgag cgcatcgatc tacgagaaaa
    91501 actgctgaac gtcatcattc ctccggaaac cagaggactt tgtaccctgg cgggactgct
    91561 atgtcactgg gatgcggatt tgcgccgctc tgcagtgacc ttcttttaga gattgtgatc
    91621 gttacttata ccaataaact ttttcagagc tttgtattac gtcgtttttt tgtgaccggg
    91681 gactctatca aggggcgtgg ttgcgcgata atggggtata ttttggccta atgggtaaca
    91741 ggcagcaagg tgttccgttc actagtcttc atctcgcaga ggagaaacat gacaagtgtt
    91801 caagaccagt ctcctctgaa cgaaaacatg caatgccaga agactttaga attgtcggtt
    91861 ggaatgcaga ttccgaaaga actaccagga gtggcaatgt ttacattcta cgattactta
    91921 gccgacctgg cacgcggagg acacgcgcaa agtgacattc ttcaacagga accactacat
    91981 caccgcctgg cttacatcag ccacctgttt tcgtggctcg aaaaagaagg tttcgcgtat
    92041 ggcattttga acaaattttt tggttctgag cgcgctctga gcgcatcaga aattagtagt
    92101 aatttatcgc aacaacagat caatgaaatc ttatttttca tagaatctga aacgaaacaa
    92161 caagcgtcgt gtgacctgtg gaaagtttta agacaatttt tattgacggc ttcaactttg
    92221 aagtggatga aaaataaacc gtgctcaaag ccggaatggt ttaaggtaca ggaattcaaa
    92281 ggcggacacc ttggctatgc cacacagtcc atgcctttga tttttggcaa tactaacgaa
    92341 agctgcgccc gatcccttct tttgggatat gtaactggag aggcatggaa aacttcagaa
    92401 gatcgagaag agttttacaa atttgacgac ggccatccac cagaagaagc atttacatgt
    92461 ggacttcttt tagataaacg gagtggaatg ttgggagcat caatggatat ggcgatagta
    92521 aagcgcagga aacagtgcgc tagaaaagtg gagatatacg aaattaagtg cagagcaaag
    92581 tatgtgttct cggtcgagaa ccagacgcat ccactttctc aactgtacga taaaatgttg
    92641 caacacccat gtgaaaattc tattcgcgat ttcttgctgg gaatttcctc accgggggta
    92701 gaatttgttg aagagagcgg aatccctaca gcatcagaag ctctactaac ctgcgacaaa
    92761 acttggaaaa ctgacaggtg gaagaaaaat ttacgagaac gtgcttgcct aatggaaaag
    92821 cgtcacttgt ccctgaatag aaccaacaac tcatctgtgt ttttgtttga aagcccctgt
    92881 ctggaaacaa acacgatcag acctgtccag tggccggacg gtgaaaacaa tatcgagtta
    92941 ccaatcttca ttaacccaaa acatcagaat ttcaaacaga tttttgtaca gacatacgtc
    93001 ttggccgaat attttgaaac aattcctata tctccatttt tagttacatt tataggtcgc
    93061 aacagaaaga cggtagagcg gggacgtgta tttaagctcg aacacacatt agacggtata
    93121 gaagaaccgg tggaattgaa ctgcaagcac gcgataccgg tactactaat aataaccccc
    93181 acaaccatcg acagaaatca tttcagtgat ttggactcgc ttggcagaga agcgttcgag
    93241 ttttctgtga aggaaacatg ggccaaggtc tctgtggaca cctcggagaa tgttgctgcc
    93301 cctgctgttc aaagtcctgc gggggtgaca caagatcccg aaaatctgga gagcgcttgt
    93361 ccctattaga cgacagcttt gacgaattca ccataaccga agacatgcct atgattcaag
    93421 gaggaaaaaa gaaagagaag cgtagcaaaa aagaagccga accaattgta gttgagccag
    93481 tggctgctag aaggcattga aacatgttat ttcaaataaa cagaactaca accaaataca
    93541 tgcgtcaacc tttatttgcg ttatgcgtaa tctaaattac agttcgtcgt catagggtac
    93601 agtttcataa acgtgcttgt ctcttcggct tttgtatttt tcgcggcgcg ttttgcgttt
    93661 cacggtttta tctaaagctt ctgtggcaac ggtcgttacc ttgcggatga aatccgtctg
    93721 tctgtactgg tgatatctgt atgcccgtac gactcgcaga atagccaaaa ctaaaacaag
    93781 gagggcaaat actcctagaa ttcctgccgc agccggcttc cagttgggat gagttccgct
    93841 atccaacgta ttagcatagt gcagggatgc cgtcccaagc attccaagag caatgatgag
    93901 tccgaaatgc ggaccaataa gtacatgcac atacttcgct aaaaccagct cggtcacaat
    93961 caagtatatg atacctatga taagaaatgc aatcattgcc ccaagtgtag aagcagggac
    94021 actgactcca aaattcacgg tcatgacgag tgctccggac aaggccatta taagccccca
    94081 aactcccatg atagaggcgt agacgtttaa taccactgcc ttaaacggtg atacaacaca
    94141 atgaacttca gggcatgcac ttttgagctg tgagttaaaa actgagtact ggtcaggtgt
    94201 ctttccggaa gacgcgaacg tacccaaaaa tacgatgccg gatacaaaaa taatgcaaaa
    94261 tgtgacagct gatagcgtaa gctgtctgta cgaaaggagt agtacaaaca actgccacgc
    94321 ccatactgtg ataataatag acattaaggc aggtgtgctg atcacggccg aagtcaattc
    94381 ggacgctccg tatgaacgat cgtgattaca agtcttggct ctaactgcgc caagagtaac
    94441 gtatatcgcc aagagtatcc acaccgccat agtagcgtaa acggtaaata tcattcctgg
    94501 cgacgaaata aaaaaaagtc catcttcgtt cgcccttagc agtccaggtt gattgatcaa
    94561 aggcgttgct ggcttaaggt gtccaccggc gacgttgccg aaaaaacagg gaaaccctgc
    94621 ttgcggacta agggcggaga aagctgaggc cagtgatatc aacaccagaa ccacaaaaga
    94681 gattacttca atcagccaca tgcgccatgc aatcctctct aaacgcgatt cctgtccact
    94741 atagtagtag ccgctcattt tctgcgctat gtgaattagc gcctacgtcg ctcagcggga
    94801 ggaacgatat gtcgccaaat aattttgctc ctggagaaca actgtggttg tcgcccagcg
    94861 tcggactcgc acgaagactg tacggatgcg atctcagcga tcgcctatta tccaatccga
    94921 caatgagtag gctgagccta gatcagcagc atggccatcc ggttacgttc ccacccccct
    94981 cacgctcgcg accggtgttg attgcgcgcg ctccgatggg atccgggaaa actacggcac
    95041 tgattgaatg gttggctgga tttctagacc accaggatag aagcgctata gtcgtgtcat
    95101 gcagaaaaag ctttactaac agtctttgtc gacgattcca acgggatggt ttggtgggtt
    95161 ttgctacgta tctagactgc gaaaaataca taatagatga gatttcacac cgacggctat
    95221 tggtacaact ggaaagtctg ccacgcgtct ctagtgtact attggatcac tatgatgttc
    95281 tagtagttga tgaagtaatg tctttgatga atcaattctt ttcgcctaca gttagaaaac
    95341 tacgtgaaac ggaagctttg ttttcattat tgttatctaa atgtcagtat atcgtagcga
    95401 tggacgcaac gataaatgca actcttgttg aaatgctcgc agatttgaga ggggcagaaa
    95461 atatacacgt gatagtgaat gatttcgtat cgagcgggtt tgccaatcgt caatgcacaa
    95521 tgcttaacgc gcttggcgcg gcaatacctg ccagtttgtt aaagccctca gaaggaaatg
    95581 aggacaaagg actcgaggat aacaaaagta ctgcacaggt ggatccatct ctacttgaag
    95641 ggtccttttt tcatgaaatg caggcgcgct tattgcgtgg agaaaatatt tgtgtctttt
    95701 cctctacgct atcattttca aacgtcgttg cgttcttttg ttcagaaatt ctaagtcctg
    95761 ggacagttct cttactgaac tccaactctc cccacgtaga tacgactaac tgggggcgat
    95821 ttcgagcagt catctatact acagtggtga cagttggatt gagttttgac tcttgccact
    95881 tccactcaat gtttgcgttc gtaaagccca caatccatgg acctgacatg atggctgtct
    95941 atcaagcgat gggtcgggta agacgtctac tacatgataa gctttttata tatttagatg
    96001 tttctggggc atggggcgca ccaattttca ctcccatgat tttaaactcg gagtttagca
    96061 ctaccccatg gccagtagac attacagttc cagcagacgc catgtgtgta aaatttaaaa
    96121 accgttgcag acagatcaac aatcatcgag acggggtatt tacccggttc aaaaataagc
    96181 attatgtaga aagatgtaca ctaaccagtg ctaatgacag ttttagtctc ctacatactc
    96241 ttctagtcaa taacaaaata aatgtggaga taatgagcgt tgactcctcc gatccgaaac
    96301 tggaaaattt gggtcaattc atatctggtc tgcgtgcaga tagttatcgg aatagggctc
    96361 cacttaagca tctgtactcc gcgttggaaa agtatgaaaa gagtcaagat atattttgcc
    96421 ttccatcaaa cccaactcct gaggaaacag ctttgatgct catggagagt gaaaatgtaa
    96481 accagttcat tgctcgtttt tttgaacttg accgatcgct agaaaatttc ggggaagact
    96541 tgcaagcctt tctgcaacag cttggtgaca aaagcaaaac tatagatgca ctaattaatg
    96601 cggctgttgt ggaaacagga tgcacctgcg atgaagatga atggtttcag atcaatacag
    96661 aggcattgtc caaagatcga gacagtaaac tcgactcttg gatatcatat tatctcgatg
    96721 gtccatttgt gtgtctaagc aacggacgtc cggccgtgat tgaggtttgt aatgaaaccg
    96781 aagttaagaa tcgtcgaaac ctattaagac tatgcataaa cattgccagg acgataggct
    96841 ggaaaccttc agccgatcca aacgagactg aaattgaact tgatgttatc gtgaaggcag
    96901 taaatgacgc attgaacgca gggatgggga attgtatgct agaatatctt cggttaaaca
    96961 taacagaacc ctcatggtta actggaccta taaggaacct ccagtgttat cttggagaaa
    97021 aaaaaatgtc tcgccgcgaa cggaagactt ctgacccact agagatggca gctgtaaaga
    97081 tcttgcgcac tctatgggcg gagttatttg atgtacgggt atttaaaagc caaaagacat
    97141 ttcctggtac ggcaagggtc aagaacttgc gaaaggagga gctctgtgct ttgctagacc
    97201 gcattcacgt tccctacgat cgcaaggaaa cgcacaagca actatatgct aaacttatgt
    97261 gtcatagaga acagttcaag ggttctcgac taagtttccg gactgctgcg tggacccgtt
    97321 ttttaaaagg acggtgcctg gaggacttcc atttgatgac tccaatctct tcccatcatg
    97381 tatgatgaaa gcatacttta tggctactta tggggcatct cgatatatac gattgagact
    97441 aaacaaaatg cgtcaggaaa tattacagac atgtgggtat tgtatgaatt agctgtccat
    97501 gattctacta agggtgccca tgaagtactt tatgcatcct tacagtttga agaaagcgac
    97561 ctcagtgtgg cctcgtggcc tcatccagct ctgaatgcca gattactgac ggacttcgtt
    97621 ggggctgtaa agaatttcca tcagagggtg tacaagctga atgcaaaaac aattaacttc
    97681 ggatggattc tctcatgttc tacttctagc cagattgctc tccgcctggt gacaggaaga
    97741 ctacttcatg aaatcaggcg cgccttgact ctgccagaat tttattctcc ttctattttt
    97801 tatgtttgca aagacagtgg attgatcact aaggtctgcg aggataaatc caagccacgt
    97861 atggcaactg catcttacgc agcattgaat gcttcgtcta acttccaagc aaattacatt
    97921 gaacgcaatc tgcaagccgg acattgttgt gaactgagaa attttggatg ggctcgcata
    97981 caggcaatct catctggaaa aattaatcca agaagcatga ccgcggaatg ggtgtgggct
    98041 ggtggaaagt ggattgatgg aagaggaaat gaagcatttt ctgaaacagg gactgatccc
    98101 acttccgacg atggccttgc tgtccccttt gccttaacac ccgcgaaaac aatttatgga
    98161 ccgacgtggt ttgttcccag acgcatgctt gtagcgtcat tggtgcccaa ggagttcgaa
    98221 tatgccatct atctcaagga tggaagtacg ataatctctt tagtgtgcgc aataataaat
    98281 ctgtattgca gattttacca aggaaacatt gttgcacaat ctacatttct caaacctatt
    98341 atcctttttc tatttccgac aagttcttcc cgaatggacg gctcagagaa ggtttcatct
    98401 ataaaagact cctacatgta tacacctgga ttcccgagta taaattttgt tcccattacg
    98461 acgcagaaca tgtcaaagat gggagccttg aatgcatgca gaatagtctc tcttgtggag
    98521 gggttatggc cagcctataa tatcagagca ttactcatgc tggatcgcgg agatcgagcg
    98581 aaacatgggt ctcagatcac aacactaccc agagacctcg agagcacttt agaagtgtac
    98641 ccagccggta aaatatccac catagccgat ctcccgactg ttatcagtgg caggatttta
    98701 aaaatggact tttctgcttt ctttccatgt ttgtacatgg catgtggcgg aggcagccaa
    98761 gcgctatgcc gcattatcga ggcaagatta aacagggagc cgcagtcaga gaagcttaaa
    98821 gctgccttgg tagctctggt gggtgggcta aaatatacag atccatcgaa atataaatta
    98881 gtaatagcgc tctgcaacag cattgcattg gctgtcgaaa atgctgccaa tagcctccag
    98941 tttggaatag ctatttatat gaaggatgga ttcataggag cttttgataa acattcctct
    99001 acaagcgcag aggaactgag aagcaaatgc gaatgggccg ccattgaaga attgcagaag
    99061 attcttctag aatgcggcca agcaattaca ggaatgccga ctctgaaact aaggctagag
    99121 ggagaattta cagagggcct gcttcttaat tgcaacaagt attggctcca caacaggaat
    99181 accggaaaga gtttcatatg tgggatacct gggcttcgag aagagaatgg gctgagtgtg
    99241 ttaacagaac gtacagcttg tgaactgctc gctggcattt acactgccaa caccgtaagc
    99301 accgctaccg aaacactcac gcgaattcta gatggatatg ccttctctgc cttcgaagct
    99361 agaggtgaca taaacttctg gcaagagacg ctaaaaagta gctttacccc atgcatttca
    99421 gattccgcag ccatcagatc tgccagtttc atgacacgcc cagatgagct ggaaggagag
    99481 actcactttg tttaccttac tccgacaaat ttgtcctccc atggctccgc caacgctggc
    99541 ggtaaagtta tctacccaag ttctctcgca gaagagaatt tctgcattaa aatatgttat
    99601 tcggctcacc taatccccaa aatgtcagca atggtggagc ttgtacagaa tatggtgtgg
    99661 ttaaaatttt atcataattc tgtggacaat gatgaggaga cacggggtaa gttattgaaa
    99721 acgtgtgact acgattacga gagaacatct tttttattct cataattaaa cagaacattt
    99781 ccaaagacca tgatacttgg tacttcgtca tttcaaaaat aggtatcata taacttatat
    99841 gcactgcgat gaagcttgcg gtcattccac cacaatctta atacgcgagt aaaaaagttt
    99901 ccgttgccat atacccgatt caaagttgaa ttccttgact ctaagatgat ggctcgttca
    99961 ttttcattgg aaggcaggtt catgatcata agtgcgtggg tagaataaag agaagatatt
   100021 agctcttctc caattggagc ggtaatttgc atgaggggct gcgccactcg ataatgaggc
   100081 aataccaacc cgggatcaaa gggaggaaga tcatgcatta atagcaatgt atttaagagc
   100141 cactcccctc cattcaccaa tagctcgcgc accttatcat tgattgaaat agttcgcgcg
   100201 acacgggcaa ttgcgcttcg taacttatag cagtgttctt gagtaacctt aatggggtca
   100261 atgttttcca aatacatgca aatcaaacag agcgcaaagt cttcaaattt ttggggcata
   100321 attctgtgaa tcctgtttaa aaaatcaggc catgtaacat gcacagtggc aacgcggtcc
   100381 tctgaggctg tgattactga aaatataaag ccagcatgat catctaggcg cacacacgcg
   100441 caaaagtact cttcaatatc cactactgct ccagaaatca gctctaggat aattttttcc
   100501 ccatccatct ggatgtccat atatgttatg gaatcagacg caaacaatgc tggcgcccct
   100561 ggcgtggatc gtacttcaaa aaaaaatctc gggatagcct gccgcgatat ttccttaatt
   100621 aactgtgatg tcgattctcc agaggaggcc agacgttcaa gttcctcaag ggtagggccg
   100681 tgttcgggtt cttctgcgat gtcttccaat cgtataggtc ctactttttt ctgatgccgg
   100741 catatcgcgt tgaatgcttc ttcggcccat gatactaact ttcgagtcgg ccgattctct
   100801 gtcgctgcct ctagaatagg ctctcctgtc tctttcagct cttccatccc atcgttcatc
   100861 ttgccgattg gcgcacgaac gtctgacatt tgctatgtaa cgtacgttca gatctttcaa
   100921 atacgaacct acccgcgagc tggcaaataa tgtttgacac aactcctcct ctgacttata
   100981 tgtagtctgg ctcgatacaa ggaatcctag acgtgacgcc ttcagaactt tgtgaaaaaa
   101041 tggaccgaca ataagcgtga ttgcgctagt actgtacgac aaagatactt cctcgccttg
   101101 attattcata tttctttgaa ttttaaacac gcgcagtaat tcttgttccc agagcgccga
   101161 caatcgagtc tcctcctcca gataaggagg aatgtaccgc gccagaaaac tattagcaat
   101221 atactgttgg tcattcatgt ccttacttac atcaacgagg ttatatgata aattctcagg
   101281 gagcttcgat agcgactcta gagtttcttt gcactcccaa gcctcttcga tacctccaag
   101341 ggtctcccat gctgggcaac ggtcatagtt tgcttgggtg cgctcagtcc gcctggcaga
   101401 ttccattcta gcctcaacca attctttttt cattttccca ttactataga ccaagttttt
   101461 attgctttcc ttgagatcag agacagtctt gaacaaagta tttactacct ttccaacact
   101521 tgtattaacg gcagctcgca cagcattccc catgcgatct tctgcattat caatgggccg
   101581 ctgcccctgc gctgccgctc ttccgccaca cccaacacgg gtagggtcaa gcacgagttg
   101641 tctctcgatg ttagaaacat tttcacgcaa gtaagagtcc actacgtctg ccacatcacc
   101701 aactttgcgc atattttgaa tatcaataat gaacttgatc agcctagctg ctgcagatgt
   101761 accggcctct tccacacctt ctcccagagc cttatccacc acttttgtta catgatctgg
   101821 atcctgtgca ttctcagttc gtagaccaag caaaaccttg atcggagcgg tatttactaa
   101881 ttgacacaat tttgcatgct cgcgcatagc ctgagctttg agaacaggac cgtgcaatcg
   101941 ttgcatagga gaatcaaata atactcccct gtcagttacc aatggttccc aaacaaccat
   102001 acattcccca agctccccag tatttccatc ataggcgcgg atttcactgg ttttaacgtt
   102061 cattattatt agtgttcgct catactctaa aatatgtact gcccctaata cagcacggag
   102121 atacttcagc atttcgaacc ctctggcaaa aagtgaaggc gcgacatgta ggtggtggtg
   102181 tatttcagtc gttgtacttt ccaggtcttc atttccgaga tcactgccag tggggcgctt
   102241 ttcttgaggt tttctttctc gtaccaaagg aaccataccc agacatgtta tccaatctat
   102301 ataacgtacg taggaaggag ccttcccagc ttcgcttaac ccgcgcaagc ttaactcaga
   102361 cacgccccgt acaaaatcaa gtaacactgt ctgcaataaa aaggaccaca actcgaacgc
   102421 ctgctctgca actcgaattc catcttccga attgtgacag taacgtgctg ccagttcatc
   102481 cggtgtcaac cctcttgttc tgatgtgagt gtcccaatcg cgctccacat cctcaaatcg
   102541 acagccatcc aatatattgc ggagaaccgc cacttgaatt tgtctaacaa cagattctgt
   102601 tgctcggacc gagttataca cgccttgtcc agaagtgtac gtcgatgcgc ccaggagaat
   102661 ttccctgaat cccatcgtgc gctttgttgg atggattatt atccagtcat caggctcgcc
   102721 tgttagaatc ggctccaaga ccgcgataag gttgtcgata tcaaaggcac aaggtacctg
   102781 acgcaattgg gaaaatggca tgtccatttt cggggaagag caggcgggaa atagaaatca
   102841 ccactcctgt ttacttaaat ttttcggcaa tgcagagcat tcaggcgatt ttatcggaca
   102901 ttacaatcct atcagaacaa gctgttcatg aagactccaa gccgcaactg tcttggtttg
   102961 agactgtggc acgtttagat gaaccgacca ctttgcctct ggcggaatta ccatttaatg
   103021 tttatctaat caccggtaac gccggctcag gaaaaagtac ttgcattcaa actcttaatg
   103081 aaacattgaa ttgcatcgtt actggctcaa cgcgcatagc tgctcttaat atcttcaata
   103141 agctatctgc ctcttacacc tcttgtccca ttcatactat ttttcaaaac tttggcttca
   103201 aaggaaacaa cgtacaggct gtgctaggac gattcaagtt tgaaaaacct cacgaacaac
   103261 gttcgttggc agaacatcaa atggccgaca tttattatta ttgggacgtg ataaaggaca
   103321 ttactgcacg cgccatagac acggcatctc cggtagcttt gtctgtcctt caaacactcc
   103381 agcagaaaac ttcacgcaaa tttgtaaacc ttgcaccttt cctaatttcc tctatgcctc
   103441 catttgtcaa aagcaacatt atccttgttg atgaggctgg agttttaggg aaacatatat
   103501 tgactgcaat agtatattcg tggtggctca tgaatgcatt gtggaaaacg cctatgtatc
   103561 aggacgggaa gaagccagtg atcgtgtgca ttggctcccc tacacagaca gacgcaatgg
   103621 aaagcagctt cgagcacaga aatcaacgac accttatatc cagcagcata aacattttaa
   103681 gtaatcttat ttgtactcct acactgtttt cagtcctgaa tatcaagaag cagtgggcca
   103741 tctttattaa taataaacga tgctcggagc ctgctttcgg agaagtatta aaggcatttg
   103801 aatttgggtt acctttgaca gaacgccatg ccagattctt agatcagttc attgtatcag
   103861 aatcattcat caaagatcca tcaaagcttc ctggatggac taggcttttc tcgtcccacg
   103921 aagaagttaa agaatacgtt tctaaattgc acgcaaagct tcgtgcacag aaatctgaaa
   103981 aatatagggt atttctcctg ccgatgtata caatagtaga tatggcggca tttgaaaagt
   104041 ataaatccct gacgggtcaa gagacactaa atattgatcg ctggctgcaa aacaattcct
   104101 ctcgccttgg aaactattca cagagcaggg atctagatgt gaccgcgccc agatttgaat
   104161 accatcgaga tgagagtaat gaatatacac tagtaacgac tgatgcctcg cacgtactca
   104221 atagccagat cacggtaaca aaaaaggtaa aaaaattgat cttcggtttt gagggaacat
   104281 ttgaaaaatt cgcacatgta ttatccgaag atagctttct caagacgtat ggagaagaca
   104341 aagtagaatt tgcctatcac tttctgtcga ccttgctata ctatgggatg attaaatttt
   104401 acgaatttct ccgaacagag ggcctccccg aagataaatt aacaatggcg tatgacaggt
   104461 tgtactccct agcaatgccg gagccagaaa ctcagaactt tgacatggga aatggtgaaa
   104521 aattttgttt taacgaagat gaatgtccga atgccgatgt gaatgacaaa gatgatttat
   104581 tcgatatttt tgataagtcg ttagatcaat tctatctaaa ttatgagatt tgcgggagcg
   104641 atgtccacgg tcaagaaata tttagttatt tcgagcagat gaaaagaatt tatactttac
   104701 gttacgcggt gctgtgtgag ctctttggga gtgtatttac tgccgccccc tttagctcat
   104761 tcgtcggaac ggcttctttc tcaagtcaag aaatttctat ctccagtttc aagggagcag
   104821 tatgtgcatt tgctgctcaa accgacacat ataccttacg cgggattacg cgagcaagat
   104881 ttccgggata tgctgaggac acctcaaaag cccacgaatg ggccgagcca attttacaaa
   104941 tgctagactt gccaagactt gtcgtaaggg atcaaatggg gttcgtttca gtcctgtgcc
   105001 ataacaaagc aacttttgtc gataatatag gtggacagga attaaggatg gccataacaa
   105061 ttgaccacgg aataagttcg agccttgcaa tgacgatcac acgatctcaa gggttaagtt
   105121 tagacagggt agcaatatgt ttttctcacg gaacaatgaa attaaatact gcatacgtag
   105181 caatgtctag agtaacgagt agcgaatatt tgcgcatgaa cttaaacccc ctgcgaacga
   105241 aatacgaaga tactcgacaa gtaagccaac acattcttcg cgcgctcaga tgcaaagaaa
   105301 cgcgactagt atactaatcc tcaaaagtag ccacacgcgt ggctttaaaa tcagtttccc
   105361 accgtcgttt ggagtgttgc ataccctcct cgtcccgaga acatgatttt cataagctac
   105421 gtaatggtag gagtccaagg cttggggcat ggctcggcca ccgaatacga acaagtagta
   105481 tactcatgcg atggaggaat gcggtttatt tgcatcggaa ataaaatgta tcgccaccaa
   105541 ttaccacccg ggaaagtaat agtaattcac aatcccgtcg caacaatgat cgctgtagac
   105601 tgtgaagaag aattttgcgc atactgtttg gagcgcaatg gttctcaccg aggaccctca
   105661 ggagaaacat tagcttttca gttctcggca tgttggtttc tagggcgcgg aggaacgcga
   105721 gaacggtgga gcagcggcaa catcaccatg atgaattttt tgggcgtcgc tcacttaact
   105781 gtaaccatat acgaaacccc ggaagatcta gcatctagcg cgcacaccac ccccacatgt
   105841 tcccaatcct ctccagaatc gctggagtgt ccagaggaaa gcgttcctcg agatcttgta
   105901 gagtttgcgg caaggcatgc cggactgtta gaggaataaa taaaagtaat aaacaccaaa
   105961 ttatgaaata cgagcattta attattgcgt cgcattgcgg aaatgagttg accttcatag
   106021 ttgctgtcac ttagctgcag ctggaggtag tagtgaggaa aatcgggtct cgaaatgtct
   106081 agagggtagc tcaggcaact tttccgactt cggtagaaag caatatccat taccctgtaa
   106141 cgcagccgtc cgtgccgaag agcacctgga gttcttccgt ggaggctggc gagacatgcg
   106201 ggcaaagtcc atatcagttg caatagcagc ctgaccgtac ttcatagtcc aggaagtgca
   106261 atattcgcgt tctgagtaac tttcgcaatg gggcaggtat aaatgttcta gcgctgggtt
   106321 ccacccagag gcgcgcccac gtaagtcaac acgccattcc tccagtcata tgcctggcca
   106381 atctgcgaca ggcatgggca agattgtcgc gtggaataaa taccggggca tgggctacaa
   106441 actcgtgaaa gaaaactggc acaccggggt gagtttctcc atcctcggac tgcgtaaaat
   106501 attttcttga ctttcttgac gaaataatgt cttttaggcg agcccttatt tgcggggcat
   106561 gtcttctctt gcaaaagaga aacatctgca aacttttctg atgtctattt gcacctgcaa
   106621 atgcggacgt cttagtacat gccatcggaa ctctgtctag ggaagtacaa atgtcttttc
   106681 gaatgttatc ggtaagctgt cttctcccga gttccccgaa tgaaaatatc atgaaaacac
   106741 tgtcaaagcc acacgagtcc aaagattcta catcttcggt gttattcgtt ttgacatgcc
   106801 cttggacggc tacgtctttt gcgtggtccg gagtaacatg agaatgcgta tcatgacatt
   106861 cgtacgatcc ggaaacacag tcaatagacg aggctccata tagaacttct gtcacagagg
   106921 ggatctcggt acccatatca gagaccacac gccaccacag agaaaggtct tcaatttatt
   106981 gtttatctcg caattttaca tatattttaa cagcaacaag ctccgcccca aaataaacac
   107041 cggcggaaaa aacatactaa tctaaattcc agtcaatcgg tgacaggccc ttagattcga
   107101 agtattgatt tgcttcctcg aaatggcgac agttgaacgg acgtcgcgtg caggtagaag
   107161 gatggatgaa ctccaacttt aaatgatttt taggcacgcg gggaataaat cgtctagctt
   107221 cttggcccca aagcatcaac accgtagatg acaacttttc tagtagcgat gagatcactc
   107281 cctttgtaaa tttgtcccag ccgatggttg agtgcgatct aggaaaacct tgttccaccg
   107341 tcaagtattt gttcaaaagc aatactccct tcctggccca agattctaga cacccgtgag
   107401 tttcctttgg aatagatggg taacagtcgc gtagagcttc caaaatgcgg cgcaagctgg
   107461 gcggtatacg gcacccccta gggacactga aagctaagcc atgcgcgtgt ccttccgtgg
   107521 gatacgggtc ttgcccaacg ataataacac gcacatcttg cggattgcag tatcttgtcc
   107581 atgcaaaaat atctccttta ggaggaaaga ttttgcggaa tctagaacag taggagtact
   107641 gtaacagcgt ctcaccgaaa tcttcatttt caattagagg tttcagaatt gactcccatg
   107701 atgatggtat tgaaaactct atggccacgt cggtccactc cggtacgagc ttcctcgcgg
   107761 atggtataac caattggacg gaagtcatgc tcggaggggg gagagtacgg cgttttttag
   107821 cagcgttggg gtcggtatct ctttggttgc tttcagtagg agagctaatg tccagcggac
   107881 gcttgaaggg actttttatg ggctgctcgc atagtccggg tgatagtggt tgatgttcgt
   107941 ttccggccat ctgaaattta tggtggtcct tttatacaac gaatcaacaa gtccacgagc
   108001 caagacgtta gcagccgcaa gcccggtagc ttccagccgg tcttgaagaa gtctaatccc
   108061 caagtacgga ttcacttttg cagcgtaccc attcttatag tagaaaacaa cttccgtgtt
   108121 tacgcacaga ggtctgtaaa taatcacagt caaattttca aagtagtctc ccgatggcaa
   108181 cggcccgaaa attcgcgcac cgttatctcg cgaattacta tcacatggtg cggccgcggc
   108241 agaaacagga tcacgaaaaa tgccaggtat atcgacactt gaacatagca taagagatgc
   108301 tattagaaaa aaacaagtca acattttaaa aatcattatc atatggagac ctaggtctcc
   108361 gttcacgatc cgtgttacgt cgacgagcag atggaactct ttgcgcccga cttctaaatg
   108421 gatcgtcgtc agaatctgag tcgtccgaat acaaatgtag tggtctacag gaaccagtag
   108481 gtactctttg tggcggactt ttgaatggat cgtcgtccga atcagagtcg tcccaatata
   108541 aatatgacgg cctagatgga gtacttcggc tctgtagtcc tgaaggacct tcacctgcgt
   108601 catcgtttcg catgcggagg ctccgattct gcatggaatc gaggtctaaa atacctctgt
   108661 ctgcggcgac gggggattcg ggttcattct ttatcccccc atgacgagtc tgtgcaccag
   108721 tcgtattttg ccctgcgcca tcataattag acgaggggtg gtggggcgaa agctgtggag
   108781 gggagcgtct agatggcgag gggagggatg ataacctgag gtctagggcc gtaggagatg
   108841 gcgcagaaaa taaagggggt atagaggacg gacgtgcggg cggtggacta tgagcggggc
   108901 tattttctat ttcatgccgc acgacccgtc gcacccacga catctcatat acatctcgca
   108961 cttctgctct actcgcaagg ccatagttgc cttccccctc ttctgtctcc ggtaacataa
   109021 acgtatcgga tacggtggtc ggccgctttt taaccattgg atgtgcgagc ccaactggct
   109081 tgacgtccgt gctgtcatga gactcgcctt tgacaggaag gcggatcgac accatcccgg
   109141 cggaattttt aaaatatttc aaatccaccg tgagtggtct ggtcagcatg tcgggctgta
   109201 tcgtctcagg aatggccatt cctaccctgt actctagacc cgatgcactc tgtaccgtcg
   109261 gggtttgttc gtacgccaaa aagctatcat atccgctagg gtgattcgtc gtaaactcac
   109321 gtatccatcc attgatcctg gttagaaacg agtaaaatac ttcaagcatc tgttcttcat
   109381 cctggaatga caattccact gcgcgtagtg cggaatttgc tccgcgcgtc accagatgac
   109441 gcgcgtttga gatttctgga gctgaggcga ttgccatact ataaacgaca cttttagccc
   109501 tcagtagagt agaatacagc gcctcaaaat ttctccacgt tagttgacga gttacaaacg
   109561 tttcaagcat tatcgccctc aaaacgacta caacgtcatc tatgggggat agccttccgg
   109621 tatggtgtct tcgagttact ggtctttcct gttccaaaat agtctggatg gcttggcgtt
   109681 ctccatcggt aataggggta ccggcctgcc gcctggtttg aagtaatctc ctaacgcttt
   109741 caactgttgt cggaaaataa gctacaacag aaaccaaacc attaatcctc gtacctcaaa
   109801 aaatcttaca cgcgtcatcc caccccacaa accacttacg cctcatcaag acccagaaat
   109861 ccatatagtg cgcttcatcg atgtccgcca cgaatgctat attgaaatct ccgttcattg
   109921 tcattcttgc gcgcgattct ttactctctc cagatcacta acgcgctcgc cgttgcactg
   109981 gaaagaatat ccgtgcagct ccgacgcacg tccttattag cccccgcgcg gatacacatg
   110041 cgcgacgtaa cggtatatcc gagttttcgg attagttcgg tagcggcaca ctcacccact
   110101 tactaatcaa ataaacacac cgtacgcgcc aaaataataa acattcgttt attgatactt
   110161 tgtcagtcta taaatcaggt ccgtcgatgg atctggatcg gttcctagac ctggacctta
   110221 actggtatct atccctgccc ctgtgaggcc caattcttct atcgtccaaa cctacattgc
   110281 gtaatatttc acgcgccctg cggacacgaa ttaaaaatac gcgcgggtcc gtcgggcgtt
   110341 gcatggggtt gttgttttct ccttcatccg cgctcaaatc agattctgag ctcaatacga
   110401 tagtctctat tggttcctcc ctccgttggg ggtcgcgggg ttcaacctca cgcacatcag
   110461 ccagcggctg cgggctctcg gccctcccgc cctgtccccc tccatgccaa ccctccacca
   110521 tttccggcgg tgggtcgtac tcagagtaat tgccgtctga atcatttgat tcggaactaa
   110581 gctgctcatc ttcggctcca aatggggcat cgtctgcgtc ttccatcagc gcttcttgta
   110641 ctgcagcgtc gttcattgag tcatcgctat cgttttcact tgtggacagt cgggcatcct
   110701 cactggagga ggagtgccgg tagtggacca caaattcgtt atctacaggt gctcggagac
   110761 gccagctctc tgactgtggt atagccacac tcacgttgac gggacgtaca gagcttacca
   110821 gggggtcccc agcatctcgg acaggcagct taattgtcac ctcccccaca gagttcttaa
   110881 atgcggcttc cctgcgcgac ttatagcgct ccggagctac aggtcgcacc ctcacaagcg
   110941 tgtctttttt gggcatcttt ctagggttga cgtaatacct catctcattt tcctggatat
   111001 ttgtgcgatg ctccaaatag cctatgtcag ctttgtgacc gcgtcgatta gttctactct
   111061 tgaacttacg acaccaccta atggagtgtc gcaggaattg taggaaatcc tctgccatcg
   111121 actctgggtc acgtactggg agaggaaatc gtaggaaaat ttcgtatgcg cccccgtaca
   111181 ccttttccgt taggagctcg ggctgatttg tacgtgtcat gatatcatat actacctcct
   111241 taagtcgtac aaaagccttt agtatgtaca gaatgtgctt tatcgtcaat ttgtgcagca
   111301 atagcatctc catcgtggcg gctttcacta ccatcaggta ttcgtctaca ggagacatgc
   111361 gacccgactg gtgtcgtctg atgacggtgc gttcgttgtc cagcacatgc tgaattgcac
   111421 tgtggtcgga tgcagagatc ttacgcccct cttccggatt ttcatgtctc gctcggacct
   111481 cccctagctt ccccaactgt tttacgtcat gcattctggt aggaaagagc gctagcaaaa
   111541 agaaacacaa aaacaatagt atggtggtgt ctcacatttg cccatgtcca ctcaggcacc
   111601 cactacccat ccacatcact cgcccaagtt tcccttcccg cccggctctt acgttcttct
   111661 atctccagta tgcgttccgt taactggggc gtcaactcga gttctaccgt caaatctttc
   111721 tgcacgcgac taagattttc ctcgtcaccc attcgcgcga aatttatcgc catgccccgc
   111781 cgggccgctg ccatttcaac gaacgggccc gatggcgctg tgggaagagc aactcccgac
   111841 gcgtcgcagc gatctaccgt ctattgcaac gaggtgctcg atgcgctgct tcttaatgac
   111901 ttgcccatcg ccgctgcccg ctctgtacta cctttctttc attttttccg ccacgcgaaa
   111961 gtgaccattg atgtactgca ttgcgtcgcg gaagcgcatg cagtgccgcg cgcgaggggt
   112021 ttcgaatagc tccacagccc cgtcgtcggc aataaacccg gggggggtgt tttgcggggg
   112081 gggctatata tgagcagcca aggatgcagg gtgtgtgcac tggtggtccg cggttttctc
   112141 cgacccgtcc cctcccagtc ccctgagtgc tccccgccct tccaatccct tgtggtttca
   112201 tgtccgaccc ctactattag atgctggaca ggttctgggg ttgcgagata cttgacggcc
   112261 cgacatcaaa cgccagcgtc cgccaacccc cccaaagttc ttccacccgt ggagagcaaa
   112321 cggtcagcgc gggcagccgt gaaactagtt ctactagatt ttccagttta gccttttcag
   112381 ccccggaaaa ggttcaggtg ggcaccggtg ggctccgact ggacctcgaa gcgcgatcac
   112441 agaatcgtca cgcagttcgc cccgtttgta agtttcgcgg cagcgcgagg tgctttgctc
   112501 agtagtcata caggtcacgc ccgtggttct tgcacaataa gcgccacact ggaattttcg
   112561 atttccagca acgctcgctg gcaagaacgg acacgaacgt gaaggccccg gggggggggt
   112621 cttattccgt ataaccgcct cactacgcgg ccacggccgg ttaccgcgag ttataatact
   112681 caaggattga aagaagacag agcggttggg tagctgacag ttgtcaggcc gaaggtaata
   112741 cgcgctatcg atgtgaaagc tatccgggta acgacacctt ggcctaaggc cgcaattagg
   112801 tgctactcag gttaagcact tagctaagcg cagtagcacc taactgtgcc cgcacttatc
   112861 tttgtagagt gtcgcggaag caccgtgctc ccagtttctg gtattcgtaa gcacgtgctg
   112921 tgagtctcag aggtttcaaa aattctcgtt ctggtaagtt gttcacgcgc aacccacggc
   112981 gggaaaattt tctgctcttg caagggctct agtgtagccg cttccgggta tagtgggggc
   113041 cagggctttc ccgccacgta aagctatata aatggtggca gtgtatcctt agggaagaac
   113101 ccagagggag aactagggga gaagtttcgc ggcggcggtt gcgcgcggtg ggaatgcctg
   113161 gcaagtcgaa acctccattg tccgccgcac tggcgttgct ggtgttacta cttggagtcg
   113221 gggatgctcg cagtatacgc gcggcaccct tgaagttact ggcggagagc atcagaatac
   113281 tgcaccgtgt gcagaaggac gtaaagcaac tcattctcgt tggaccatgc tgacatgcct
   113341 gcacggtctt tgtaactatg tacggctatt cagtctatgt tcacgttcat aactgtaggc
   113401 tctctcgctt ccttataagg gttcctgcga cggtagaaga gttccgaaca tctttacgtc
   113461 cggcacggtg agtaaaagcc agctcatttg tcacgtgttc tcaacggcaa tgccctggag
   113521 gccggccgcg cgcatgcccc agattaaaaa tgtagatttt ttgcttaggt ctaccctgcc
   113581 caataatctg ctcggcggtt tattaacgaa tcttgctttt cctgcagcgt ctaaacgaaa
   113641 ctgaagagtt gtgccaatcc ctttcggtca ttttgaaaca ccaacagtgc tacaaaaaac
   113701 tgcaggggct ctacgtcaat ttgtataacg tgctgaattc tgccagtaat ggcggtacgt
   113761 ctcgcaaggt aagataatgg cagcatcgcg cattctgtac tttgaagaga ctatctaacg
   113821 cgcagcacag tatctccgag acatcttttg tctccgtgct cacgcggtcc ttattggtcg
   113881 catgacgagt ctaacattgt atctcctatt tattacaggc accgtgccct ataacagtgg
   113941 aggattcgta tttgatgaag tcgttcctga atgacctggc gaacgctcta cagagacgtt
   114001 acgtccgtca gagcaggcaa tactagacaa tctagtattt tgattgcgat ttttatatcg
   114061 gcgcttgcaa tagtaaataa atgctgccgg ccagcattac aagcttccgt ggatctcatg
   114121 tatcaaaatg aacgaattaa atattcaagt gcattactta acacctcgtt ccgcctcctc
   114181 ccgatattcg tacttgcccc cattctcgtc ccttttctaa tatcactcca tggccgcacg
   114241 ggtagaatgt tcagcaaagc taaagtcaac ggggctagat catttccccg gtctttttct
   114301 acaagtcgtc ggtggccgac aagctccgac aagcaaaaga atgagcacgc aaccagaagt
   114361 aaattgtaca aaaagtttta ataagttaat aacggaaacc acggttacca ccaagggtca
   114421 gtgacagtgg gatgcgttag agggtagtta gtcatgcgtc tatggcgttg acgcgaccgc
   114481 ctatcctctg aagagtctaa tctaatctgg ggacaagggt tctagtttcc cccctccctg
   114541 aggagacgga tagccttggg cgcctggtgc gcgtgtgtcc ggtgcatctg agtgactctg
   114601 gcgttgctcc ccgcggagca ctccagcaac aacacattgg ggaccgattg cggggagtgt
   114661 gataatggga atagtcgtca ccaagtagca atgcgagagg ggcgggattt ctggcacgca
   114721 taagcgctag tccttccacg tgaagcgggt tccgacgcgc ccgcgcccct ggcgcatccg
   114781 ggtaataatc ggagatgatg cggagaactt cctgtggaat tttgctggga tcggaccagg
   114841 acgctgcgag agggagggcg ggaattaccg tgtccctccc ccacgcagcg acggccctaa
   114901 aggaagcgga agtgcctccc acaatatcag cacagggagt gcgcacgcgg tagtcccggc
   114961 cacggtacac gcggtcccga atcgggaggc gctggcggcc gcgccgcttt ccacctccgg
   115021 cgcgctcacg atcttctttc tcgttcttct cgtccccgtc ttcttcagat gagctggagt
   115081 ctgaagaaga cgacgacgag gagcatgagg aagaggaaga cgacgaagaa gaatgcatag
   115141 tggaactgga ctcggaaagg tccggacatg gcggcatcgc cccggcgccc acatggggct
   115201 gggccatgta cggatacaag acggctgaag cttttccgat ttcggagtgg ctccacccgg
   115261 catccatggc acgagcaacg tcgcgtaatc tcctgagagt tacgtgagtg aggaaggggt
   115321 gcttaacggg aggacacttc tctctgtctc ctgtaccctc atcgtcgttg tcggtcttcc
   115381 caacgctgag gggccatgag acagtgagtc gcctgtccat tactacgtga cctacattga
   115441 gcccaccccg ttccaaccgt tcggccgccg gaccggtaaa cagttttaca aggtaagcgt
   115501 gcgacggggg gctagtccgg gcatagacaa cacccctccg cccggtaggt atgcgcggac
   115561 ccgagcggga atcctcgtcc ccgggatccc tagcatctac gaccacgcat gcgcgcccag
   115621 atgtactgag agcgcgctca agcatccatt ctaccgcccc ggcgtatcca aggtctgtcg
   115681 tacagagaat ggccacgctg cggcccgggt ctttctcgtc gggagggata tagggatact
   115741 ccccgcgtgt ccacgattct ggccaacagg caccgcccgg catgcaggca cgtccgcaga
   115801 gggccgcgta ggcgtacgcg cgttctaaaa attcgcccgg ggcacgttct gagacaagaa
   115861 tgatgaggtc atagattttg tcagccggat gtcgcaacgt ccaggaaagc cgctcctcta
   115921 agacgcagcg tccccctctg ttcacgggtg aaatcctctt gcaaaactcc cccagggcta
   115981 ctgggtccct cgcaaaagca ggtagccaat ctgcgggtcc ggtcgcggaa tagcttcccg
   116041 ccggaccgct gctcaacccg cgcaaatagt tcgcgagccg ctccaaagca ggacgcgcgc
   116101 gatgggcggg cacgtatggc tcccctgcgg agagcgcaac gcccaagttt ttgccatggg
   116161 gacggtaaac atccccttgg ttcgggatga aaccctccgg tgcgaacagg atggtagggc
   116221 tgactggggt agaatgaaac agggcctcac ctatctcgga aatgtgaaag gacggggatt
   116281 gtggttcttg cggttcttgc ggttgttgcg gttcttctcg gggcggacat ggtggaccct
   116341 cgggagttat ggggcatggc ggaaggaggg ggttgtctct atctgtttct ggaaccgctg
   116401 gaggtaatga atctggtaag ccctggaggc cacatgtttt tttagtcgcg ttgccttctg
   116461 ggatcgggtc cgcatgatct tcagatgact ttcttttcag acctttacgg gtctcaaagt
   116521 catcatctgg agggcggtcg ggttcgggcc cgtacggtga cacagataat ggctcctgtt
   116581 catcgcacgg tggagctctg ggccaggggt tggcgggaga ttcttgggcg gccgaaggct
   116641 ctgctccgtc gccgccgcca ggactcccgt agagtaggag gtgggccgcg cgatcgggag
   116701 tgccgggagg taggtcgtac cggcaagtcg tccgccggcc gcctcgtctt ttgcgcctgt
   116761 catggtggtg ggtgtcatca tctgcgggac aatcgtccgt gacgtgctcg ctgccgggcg
   116821 cggaatcatc tcctagcatg gtagcgatca tcctccaacc agaggccgcg taggcaattg
   116881 aaggccgcac gtcaccctcg tcggagcagc caagcacgcc cacggcagct tccatggctt
   116941 ctacaagaag agtgacatca tcggtagatg gcagcggcag ggaccctatg acgaggcgac
   117001 tccatagcga agccgcgcag tacggcatgg cgcgctccca cgtaaagact gttttgggcg
   117061 ccctcgagag tgcttgatac agatccgggc gacgcttggc ggggtttatt gtaactggtg
   117121 ggcagtctat agcagtaagc gccgccatga gatctgcggc agcaacaatg caagttctag
   117181 tatggcgcaa tagcgccgaa gaggaaagtt tttccggggt tgccgcaggt ggctctttcg
   117241 ctgcggcttc cagctccctc gtggcacgcg ctattcgcct ggcgccaacg agtacagggt
   117301 ggtccccaga agcagacgcc gccgtaggat ccacggccgc tcctggaaat acaaacggga
   117361 caaacgctct cctaagagcc gccaacaggt aagttttctg cgggtggtca tagcggcggc
   117421 acacgcgtac gagctcggta aggtgcggca gagctaatga cacacggcca tcacgcatgg
   117481 cgtgcgctac gtgcgggagg cacgtcggca ccgcagaacg agacaatcct ccctcggaag
   117541 aacccggacc gcggagagcg cacagttcgc agagccgttt gtcacgtggg ctcagcttgg
   117601 ggccaccata cccatacgaa acgcgcgaca ggggatggac catgaactcc tccacaaggc
   117661 gctctaactg ttccactggc atcccgtact cttcgagata cacggaagct gatttcggat
   117721 tggcatggaa ttcggccgcg gcctcccgaa cctgcgggtc atcgaccaaa gactgtctat
   117781 agccacttcc atgatatact tgtcctctac tgggtgggga tgggataata gcttctggaa
   117841 caaaaacgcg agcctcggaa ctatggaggt cgacggccaa cgctcgtgag agtacattca
   117901 gggtaatgcc gcggcctagg tctgggagct ccgtaggcgc ggttactgac tgaaccgacc
   117961 cgtctgtacc gtccgtttcg acccactccc tcaaaactcg ccagagtggc tctagcgcga
   118021 catcgggaca ttctccaggt agcactaatt gggcagagtc ccggtcgggg ctttcggtgg
   118081 atttttcact tcctgcgctt tccagccttc gggcgagacg tcccctcctc cctgacagcg
   118141 agaatgagga agaggaggaa gaggaggaag aggtaaggtg gctcgggccc atcttcttcg
   118201 aaaattccct cttccctcgc ttggggagac ggtctttgct ggtcctctgc ggcgaaggga
   118261 cggggcgccg gttgctccaa agatcgcgcc acggccgtcg cgaacgagat ctggccactc
   118321 tctctgactt cctcaccact tcttgacgcc tcacagcggt tgttttctct actgcaggta
   118381 atggacacgg gcattcaacg tgctgctgct ccatgggagt ttcgcaggga tgcgcgagcg
   118441 agtcgatgac cgtataaact ccgggctgat cggtatccac gttaatatct agtgccacga
   118501 catcactggt agcgttcgga cacggttcta tagagtttat gttttcggga tccatgtcgt
   118561 ttaacatcgc tataaggtcg cggagagaca tttctcgccc gtccacgtct tgggccgcgt
   118621 cttgggccgc attctcagcg atgacagagt gaaagagctc gtcctcgctg gaaaaaagag
   118681 gtggcgtgct gtacgaaaag ctatcagtag tggtctcaca ggtaggtgcg tttggagggt
   118741 tcgggatggg agaacccaaa gaatcgtagc gcccactctt atcggcgcgc aaaaaggtaa
   118801 atagatctga gggcgggcca gttgagaatc ccgactcatc aacaattgga gcggccaaat
   118861 tactcggcgt cgaggaatca gaggacatga tagaatgcta gtggaaggac tagcgatttc
   118921 cagaatcctg cagaacaaga cccgagtgac aaggttacgt aagttttgtg cagaagttgg
   118981 aagaaacgtg aagctttctg gtggggagta gtaacagaaa aaataaagat gcgcgactct
   119041 cgaaacctcc cgtttctcgc gttggcctgt ttatttccgt ccccgcaatg cagagcacaa
   119101 taaagctccg caaccatagg cacaattttg gaacagcaat acatgctaaa gaagtggatt
   119161 atcgttttgt gcgcttcatg ttcatccata acagcagccc atactcttga ctgtatgggg
   119221 gaattattcg aagcccacag tcatattttt gcacgatacc ccatgcaaaa ggatatttcg
   119281 tggtcccctc aaataatgac agcccaccta atcccacccc aaaatttata acagaatatt
   119341 ggtttcatga cttacgtttt gcgaagaggt cctttccacg ctgggtaggt ttcagcaaag
   119401 gtgttgtgaa gaaagaactt tggagagtca acccctcggt cttgtgcagt tggtttgggt
   119461 atggcatttg tattgaggca tgatataatt cagatccaat ggcgcccatg cggcctgcat
   119521 atcgttagcg agcgtatttc cagttccggt gtgccatagc caatgcatgc catgcgccca
   119581 gcataccatt accgtaccag gaacttccgg cattttttat gagccaacat aataaacaaa
   119641 cctgagccta ctgtagaaca gatgacgaag ataacaaaac aatacattac ttgtgtccac
   119701 aggtacgtgc aattcggtgc cggggtgtgt gcctactcta gaaaggtcac gcgtgtgttt
   119761 tgttggcatt gatattaccc gagaaacacg ctcgcttgta cgttattggc cacaccggga
   119821 agcagtgaag tttattttga atgccaacga aagcacatgg gtcacgcttc ctgggagtgc
   119881 caaggaagtt gtgacagaaa aaagatcccc atatgggaga gttgacatgt gtaaatatca
   119941 ccgtgagcac ttgtgttact tgtgtgttct aatctctagc aattttccac gaaagattat
   120001 tatcttctag ccacccctct aacccagcct aaataaaaaa ttcagacaac gcaaaagctt
   120061 ggttccatgt tccacgcgag tagttcgcgg gaacacataa ttactttatt gagacatttg
   120121 ccgctcggga tgcacgaatc gcaaattttg aatctcggga tgcgttctgt atttgcaggg
   120181 cacttttctt cttttgagag atatggcgag aaggtccatg ctcgggaata tagttcgcaa
   120241 tctggtttgc gatttacaaa cgtccctgta attttcttac gcggatctgg aagtaatcgc
   120301 aggagcctct ctgcaggaga cttgccgatt cgccggtgaa tcgcaaatac acttccagat
   120361 atatatgtcg ggggtcacgg tactgtctct acaggtttct tttaggaaac gcacctatgt
   120421 cgggttgccc gtgggactaa aaccagttac ttgcgcgtgg aaggcagccg caggcttagc
   120481 agatgcgctc gaaacaaagc acgagttgca atagccggta taatatcaag gtacgggcta
   120541 tatacatgcg cgtaatacat ccatactgga tctacccagt aatcgtgtta actggcggtg
   120601 ttacaacgca gtcgtagcag taatatgaaa gtatgcaata tgtatgcaat aagcaagggc
   120661 aacgaagccg ataacctgca cgtcggtggg cccaaacaac tcagcggccc tattaaagag
   120721 caaataaagt agtgagcccg gcacatgccg aacagctcaa gtaaaaacaa aaattcataa
   120781 agtgcacacc gcctatggcg gttcagtgtt aactagctct tcacgacaat cgactttgtt
   120841 gggtccttat tttctgggtc aggtaaactc gaacatgagc tttcgtagag tatttttaac
   120901 ccgcgatgtc ttggagagta tcggtcacgc agcctccgga tgagttcatc ccgccgaata
   120961 tcacttcccg atcacattca gggtcggggg tcgagggggg tgctcgaccc gggtcgtgtg
   121021 tatcgtgagg acaagcctct ccgatcggtg acccatcccc atctgggaca gtgcatggct
   121081 ttaaacggag cctgcgtcgg cgtggtctgg aggcatcggc ggggggattt tcgggttgct
   121141 catgtgagaa gacaatgacc cctcccattg tgtccccagt atgaaatctt ctcccctctt
   121201 cctggggtaa tccgagcagg acccgatggt cccgctatat gcggggacag cgacccggat
   121261 cgttctttta tgcagtgccc gaagaggcaa gtcacagctc attggctgga aggggggatg
   121321 caggaccctc ggtgcgaacg tgacgtaggt gggtgccacc cacatcatgt aaattaggtc
   121381 acggggtagg gttctggatc caaaaaggat cccgaagagc tctcccagaa gtttttcttt
   121441 tcggacgtat cggaggacga agaaccggca cgcgggagga gctggagcga cccggagtcg
   121501 gaggaagagc agcctgggtg ccggggagtg gacttgggcg aggaggacac gggacacagc
   121561 tccaccgagt cagagcccac gcaatctgac ttagacttta ttgacgacag ctctccggcg
   121621 ccgccgccat ttgctatccc ccgcgtccgt gcgttattgc ggtgcgcggc acccgcaaag
   121681 acccacggaa ggcttcggcc gccagggcgg gtaggcgcac tcttaaaaga cggaggttgt
   121741 cattttcttc ttcctctgac gaggaatccg aggagagaag taaaaaagaa gaagcggcct
   121801 cgacccctgc acggcgacgc aaggccgagg cctcgacgag cagatagagg agacgcgggg
   121861 cagaacctcc ccctccctcc caccccccta ctctggacat ttattgcccg ctcgatccat
   121921 tctcatccag aacttctttc ccgctcagcc ttcacgcaga agcggacgcg cgcccctttg
   121981 cgaccgccgg acatcccgcc gccccccccc cttcacgccc ggcgcaatcc gtagccgtcc
   122041 aactcggccc agcacaaccg cagtagaccg cccggaccgc tctcctctag acacatccct
   122101 aaatggaaaa catgctcgac gggtgctacc cgctggcgct gatggacagc gatcacatta
   122161 ctgcgcacgc ggtacctcgt ggcgagcgca ggcggcaagg tgccgctgtc gcctcgtcgg
   122221 agtcggccga ctcggtagac ccgtgcattc ggatcgcctc gcggctctgg cgcgagttag
   122281 tcgagatatc gtccgaactc aaggacggtt acggagagtt cacgtcagcg agagaccgcc
   122341 gcaacgcgct gattgctgcc aacgaacggc tacgttcggc ttttctgggg gccagccggg
   122401 cgacgcgcgg cctaggtttg aggccgcggt gggcgtcgac ggagagcgtc gccaactccc
   122461 ccactgaccc gaataacggc aacgggttgg gagaattaga ggaggcaatg gaagggatcg
   122521 agggcgattt ctggctcgac tctctggacg gtgaccgctt cgaggacgag agccgtacca
   122581 tgcagagcga gaatatgcgt ttcgtgatcg agaaagaact gttatcctgg ctgtcccgac
   122641 acctgccggc cgacctcgcg tccgccgagc gagagacctc ccggtctctc ctggcggccg
   122701 ggcactggtg ctgcttgtgg caccctcggc cgtgccgcga agcgtgtttg tacgactcga
   122761 tttacgtgca gagtcttttc tgcgtcggga cggggagagt cccgcaatcg gagatgcgcc
   122821 gtcgcgaata cctggccgcc ttgcgcgccg gcgcggctgc cgccaactct cccgaagtga
   122881 gcgcctcgat ctttgcgagg gacgctggaa tcgcgctggc gctggcgcgg cgccgttgac
   122941 gggagaatga cgccctctag cggcttcctt acctccgcgt ccctgacaac ctcgcgggtt
   123001 tttacactgt cctccgtcca ctctcccccc tcacccactc cgcggcagcg aaacacaacc
   123061 cccccccccc cccagaaacg agcgacacgc gagcgctgcg aaataaataa agtaatatta
   123121 ttgtgtgttt ttcacgttgt tgcaatcgag aggccgtttg tctgtctgtg tctgtgcgga
   123181 gctaggcttt cccgggcggc cccgttccac cgttcggtta ggccggtggc gacgggacat
   123241 agagaaagat agagcgcgcg ccctggcggc gagagggtgt tgcgggggta aatgggaccc
   123301 tgagctcacc attttggcgg gggattgcac gggtaacaaa aagctctctc gcacataatg
   123361 atttccctta aacagtggct gtaaaagctt tcttcgactg ggacgcgcac gtccggagac
   123421 atgatcttat cggtagctac acagttcatg aggtgggcca cgaacgcgcg gatcgagttt
   123481 tgggaacctt cggggaggtc ttccgggagg gtgaagtttg acagaggcag cgctatcacc
   123541 aggaggctcc gcaccatctc catgcctatc cttatcgccg cgagtccggc ggccggcgcg
   123601 ctgctctggt tattccagtg cgcggaccgc gagtgcgccc ctccccgggc tctgatatag
   123661 agcaccggca gctcgacggc ggcggagaaa aaagaaagaa tgtccggccc aatgactgga
   123721 actttgggca cgtctcttat ttcccacgcg gcggcccggg gaatctgctt gccccagacc
   123781 ttgctttcca actccccgtt cggcccccca actaactccg acagcgcggt ccacagtcct
   123841 accgccgctg cgacggcgcg cttagccgcg ggcgctattc gcgggtcgtg cgccgtgata
   123901 tcttcggcga cctgcagact gcccagcctt tccttccctt caaaatacgc gcgggcggcc
   123961 tgtacgatca ccgcggccag atcgggccaa aagaaaatat cgcaactctg cgacgcccgc
   124021 cagaatctcc ctccgggcag gtccgtgccc ctaaaggccg ccgagaaagc taagtccaaa
   124081 tgtgacgtcg gaggtctcga catggtcgcc aaccctccaa atgctacccg ccggcccacg
   124141 caacgcgggc ttttataaag atggcgcgcg agacaataac acttactcat ccgcgtacgc
   124201 gtttattatt gtcaatattt gtgtggttat tattactgct accgcccttg tttctgcaag
   124261 gccctcgccg cggcccaggc cactattccg gcagcggccg ccgacgcggc gagcgtcgcc
   124321 gctaacgtcg gcgccgcggg gagcggggtt tcttcgactt aaatagactc ccgagaaaaa
   124381 attttggctg ccgttcgcca tcatccgagt cggaaacaca gtatgcggcc gagttaggtt
   124441 ttacttttaa aaactttacc gtgctgtacg gccagggcgt tctcaggctc gaaggggcaa
   124501 gagttgtcca gactgatggg tgactcagag acagcgttgt cttgtctccg tttaccaaaa
   124561 atatttccac tcctctctca aaatttttac ctccggtttc ggtaattagg aaagtttttg
   124621 gcgcagggag gtttaaagct gccatgcata tgtcagcggt acccagcacc cacaaatgga
   124681 actcttttgc ggcatacgcg ccagatgaca aatggtaaaa ccctgcgtcc aagccgctcc
   124741 actcgggact tactccaggc gggtcgcccc cctcaccgaa ccgaatcacg ggtctgcaca
   124801 tcctgggaag ggaaaacagc tccccggaaa cttcgtacag agatgccggg cgcacgatta
   124861 ccgataatgt actcggacga tcgtaactcg ccatagtttt cactgcgtga accaattctt
   124921 tccatccaga atccgagagc tcaaatctag aattaggtag tttgtagtgc gaatcgaccg
   124981 cagaaactat agtcactttt acaggcgcca tcgccgctca gactccaccc cgctatgatg
   125041 tcagaaatat aacgctctta ttctagcaga gtcaggccaa tatatacagc ttagagaaga
   125101 tgcggtttcg gcgcatctgt tcacgctcta gggcagaaaa acgaagaaga acaaccgaga
   125161 atccgcttac ctcaaaacgc gtttgcgtat tggatagttt ctcacggaca atgtcattgc
   125221 gcccctatgc agaaattttg ccgaccgcgg aaggcgtcga gcgcctcgcc gaacttgtta
   125281 gtgtgacaat gacagaacgc gcggaacctg tgacagagaa tacagctgta aacagtatcc
   125341 ccccggctaa cgagaacggg cagaacttcg catatgcagg cgatgggccc tcgactactg
   125401 aaaaagttga cggctcgcat acagacttcg atgaagcatc gagcgactac gccggccctg
   125461 tcccgctcgc gcaaactaga ttgaagcatt cggatgaatt tcttcagcac ttccgagttt
   125521 tagacgattt ggtggagggg gcttacgggt ttatctgcga cgtccgtcgc tacaccgagg
   125581 aagagcaacg tcgaagaggg gttaacagta ctaaccaggg gaaatcaaaa tgtaagcgcc
   125641 tgatagctaa atatgtgaaa aatggaacaa gggcggcctc tcagctggaa aatgaaattt
   125701 tggttctcgg gcgcctaaat cacgagaatg ttctcaagat ccaggaaatc cttcggtacc
   125761 cggataatac gtacatgtta acgcagaggt atcagttcga cttgtacagc tacatgtacg
   125821 atgaagcgtt cgactggaaa gacagtccaa tgcttaaaca gactagacgc atcatgaagc
   125881 agctcatgtc agcggtctcg tatatccatt caaagaaact gattcacagg gacatcaaac
   125941 tcgaaaatat tttcttaaac tgcgacggca agacagtgct gggcgacttt ggaactgtca
   126001 cgccttttga aaatgagcgg gagcccttcg aatatggatg ggtggggacc gtggctacta
   126061 actctcccga gatactcgcc agggattcgt actgtgaaat tacagacatt tggagctgcg
   126121 gagtagtatt gctggaaatg gtaagccatg aattttgccc gatcggcgat ggcgggggaa
   126181 atccgcacca gcaattgctg aaagttatcg actctctctc agtttgtgat gaagagttcc
   126241 cagacccccc gtgtaatctg tacaattatt tgcattatgc gagcatcgat cgcgccggac
   126301 atacggtccc gtcgctcata cggaacctcc accttccggc ggatgtggaa taccctctag
   126361 ttaaaatgct tacttttgac tggcgtttga gacccagcgc ggccgaagta ttggcaatgc
   126421 cactgttttc ggctgaagag gaacggacca taacaattat tcatggaaaa cataaaccca
   126481 tccgacccga aatccgtgcg cgggtgccac ggtccatgag tgaaggttaa taataaagga
   126541 cggagataga gaactgaagc gtcagatttt tttaaaaaaa taaatgatcg agaacttatg
   126601 atttgtcttt cttgaatgac cttgccccat cgattaacga aaagaccttt cgcgcgtcga
   126661 ttctgctcgg tctttgtgat acattatagt gagactaaac tcgaccgata taacaagaca
   126721 atgttactct atagaccgga ctcaaccatg cggcatagcg gaggcgacgc aaatcacaga
   126781 gggataaggc cgaggcggaa atctattgga gcgtttagcg cgcgcgaaaa gactggaaaa
   126841 cgaaatgcgc tgacggaaag cagctcctcc tccgacatgc tagatccgtt ttccacggat
   126901 aaggaatttg gcggtaagtg gacggtagac ggacctgccg acattactgc cgaggtcctt
   126961 tctcaggcat gggacgttct ccaattagtg aagcatgaag atgcggagga ggagagagtg
   127021 acttatgagt ccaaaccgac cccgatacag ccgttcaatg cctggccgga cgggccgagt
   127081 tggaacgcgc aggattttac tcgagcgcca atagtttatc cctctgcgga ggtattggac
   127141 gcagaggcgt tgaaagtagg ggcattcgtt agccgagttt tacaatgtgt accgttcacg
   127201 cgatcaaaga aaagcgttac ggtgcgggat gcgcagtcgt ttttggggga ctcgttctgg
   127261 agaataatgc agaacgttta cacggttgtc ttacgacagc acataactcg actcaggcac
   127321 ccttccagca aaagcattgt taactgcaac gaccctctat ggtacgccta cgcgaatcaa
   127381 tttcactgga gaggaatgcg cgtgccgtcg cttaaattag cctctccccc ggaggagaat
   127441 attcaacacg gcccaatggc cgccgttttt agaaacgcgg gggctggtct gttcctgtgg
   127501 cctgccatgc gcgcagcctt tgaagagcgc gacaagcgac tgttaagagc atgcctgtct
   127561 tcactcgata tcatggacgc agccgtcctc gcgtcgtttc cattttactg gcgcggcgtc
   127621 caagacacct cgcgcttcga gcctgcgctg ggctgtttgt cagagtactt tgcactagtg
   127681 gtgttactgg ccgagacggt cttagcgacc atgttcgacc acgcactggt attcatgagg
   127741 gcgctggcag acggcaattt cgatgactat gacgaaacta gatatataga ccccgttaaa
   127801 aacgagtacc tgaacggagc cgagggtact ctgttacggg gcatagtggc ctccaacacc
   127861 gctctggcgg tggtttgcgc aaacacctat tcgacgataa gaaaactccc gtccgtggca
   127921 actagcgcgt gcaatgttgc ctacaggacc gaaacgctga aagcgaggcg ccctggcatg
   127981 agcgacatat accggatatt acaaaaagag tttttctttt acattgcgtg gctccagagg
   128041 gttgcaacac acgcaaattt ctgtttaaac attctgaaga gaagcgtgga tacgggggcc
   128101 ccgccatttt tgttcagggc cagctcggag aagcggctgc agcagttaaa taaaatgctc
   128161 tgcccccttc tcgtgccgat tcaatatgaa gacttttcga aggccatggg gtctgagctc
   128221 aagagggaaa agttagagac attcgttaaa gctatttcca gcgacaggga cccgaggggg
   128281 tccttaagat ttctcatttc ggaccatgca agggaaatta ttgcagacgg agtacggttt
   128341 aagccggtga tagacgagcc ggttcgggct tcagttgcgc tgagtaccgc tgccgctggg
   128401 aaagtgaaag cgcgacgctt aacctcagtt cgcgcgcccg taccgggcgc aggcgccgtt
   128461 tccgcgcgcc ggaaatcgga aatatgataa aaatgcttgg catttgcggg cgaagaggcg
   128521 tgatctgaag ggctccacaa tgacgtaact gagctacgca tccctataaa gtgtacccgc
   128581 tgaccgctag cccatacagt gttacaggag gggagagaga caacttcagc tcgaagtctg
   128641 aagagacatc atgagcggct tcagtaacat aggatcgatt gccaccgttt ccctagtatg
   128701 ctcgcttttg tgcgcatctg tattaggggc gccggtactg gacgggctcg agtcgagccc
   128761 tttcccgttc gggggcaaaa ttatagccca ggcgtgcaac cgcaccacga ttgaggtgac
   128821 ggtcccgtgg agcgactact ctggtcgcac cgaaggagtg tcagtcgagg tgaaatggtt
   128881 ctacgggaat agtaatcccg aaagcttcgt gttcggggtg gatagcgaaa cgggcagtgg
   128941 acacgaggac ctgtctacgt gctgggctct aatccataat ctgaacgcgt ctgtgtgcag
   129001 ggcgtctgac gccgggatac ctgatttcga caagcagtgc gaaaaagtgc agagaagact
   129061 gcgctccggg gtggaacttg gtagttacgt gtctggcaat ggatccctgg tgctgtaccc
   129121 agggatgtac gatgccggca tctacgccta ccagctctca gtgggtggga agggatatac
   129181 cgggtctgtt tatctagacg tcggaccaaa ccccggatgc cacgaccagt atgggtacac
   129241 ctattacagc ctggccgacg aggcgtcaga cttatcatct tatgacgtag cctcgcccga
   129301 actcgacggt cctatggagg aagattattc caattgtcta gacatgcccc cgctacgccc
   129361 atggacaacc gtttgttcgc atgacgtcga ggagcaggaa aacgccacgg acgagcttta
   129421 cctatgggac gaggaatgcg ccggtccgct ggacgagtac gtcgacgaaa ggtcagagac
   129481 gatgcccagg atggttgtct tttcaccgcc ctctacgctc cagcagtagc cacccgagag
   129541 tgttttttgt gagcgcccac gcaacatacc taactgcttc atttctgatc aattattgcg
   129601 tattgaataa ataaacagta caaaagcatc aggtgtggtt tgcgtgtctg tgctaaacca
   129661 tggcgtgtgc gggtgaaacc gtaaattacg tgataataaa tagcatagga gttggcgtgc
   129721 agcgtatttc gccgagagat ggggacaatg ttagtgttgc gccttttcct acttgcagta
   129781 gcggacgcgg cgttgccgac cggcagattc tgccgagttt ggaaggtgcc tccgggagga
   129841 accatccaag agaacctggc ggtgctcgcg gaatcgccgg tcacgggaca cgcgacatat
   129901 ccgccgcctg aaggcgccgt cagctttcag atttttgcgg acacccctac tttgcgcatt
   129961 cgctacggcg ctacggagga cgaacttgca ctggagcgcg ggacgtccgc ctcagacgcg
   130021 gacaacgtga cattttcgct gtcatatcgc ccgcgcccag aaattcacgg agcatacttc
   130081 accatagggg tattcgctac tggccagagc acggaaagca gctattcggt catcagtcgg
   130141 gtcttagtta acgcctctct ggaacggtcc gtgcgcctgg aaacgccgtg cgatgaaaat
   130201 tttttgcaga acgagcctac atggggctcg aagcgttggt taggcccccc gtcgccttat
   130261 gtgcgagata acgatgtcgc cgtgttgaca aaagcgcagt acattgggga gtgctactcc
   130321 aactcggcgg cccagacggg gctcacgtct ctcaacatga cctttttcta ttcgcctaaa
   130381 agaatagtaa acgtcacgtg gacaaccggc ggcccctccc cctcgcgcat aacggtatac
   130441 tcgtcgcggg agaacgggca gcccgtgttg aggaacgttt ctgacgggtt cttggttaag
   130501 tacactcccg acattgacgg ccgggccatg ataaacgtta ttgccaatta ttcgccggcg
   130561 gactccggca gcgtcctcgc gtttacggcc tttagggaag gaaaactccc atccgcgatt
   130621 caactgcacc ggatagatat gtccgggact gagccgccgg ggactgaaac gaccttcgac
   130681 tgtcaaaaaa tgatagaaac cccgtaccga gcgctcggga gcaatgttcc cagggacgac
   130741 tctatccgtc cgggggccac tctgcctccg ttcgataccg cagcacctga tttcgataca
   130801 ggtacttccc cgacccccac taccgtgcca gagccagcca ttactacact cataccgcgc
   130861 agcactagcg atatgggatt cttctccacg gcacgtgcta ccggatcaga aactctttcg
   130921 gtacccgtcc aggaaacgga tagaactctt tcgacaactc ctcttaccct tccactgact
   130981 cccggtgagt cagaaaatac actgtttcct acgaccgcgc cggggatttc taccgagacc
   131041 ccgagcgcgg cacatgaaac tacacagacc cagagtgcag aaacggtggt ctttactcag
   131101 agtccgagta ccgagtcgga aaccgcgcgg tcccagagtc aggaaccgtg gtattttact
   131161 cagactccga gtactgaaca ggcggctctt actcagacgc agatcgcaga aacggaggcg
   131221 ttgtttactc agactccgag tgctgaacag atgactttta ctcagactcc gggtgcagaa
   131281 accgaggcac ctgcccagac cccgagcacg atacccgaga tatttactca gtctcgtagc
   131341 acgccccccg aaaccgctcg cgctccgagc gcggcgccgg aggtttttac acagagttcg
   131401 agtacggtaa cggaggtgtt tactcagacc ccgagcacgg taccgaaaac tactctgagt
   131461 tcgagtactg aaccggcgat ttttactcgg actcagagcg cgggaactga ggcctttact
   131521 cagacttcga gtgccgagcc ggacactatg cgaactcaga gtactgaaac acactttttc
   131581 actcaggccc cgagtacggt accgaaagct actcagactc cgagtacaga gccggaggtg
   131641 ttgactcaga gtccgagtac cgaacctgtg cctttcaccc ggactctggg cgcagagccg
   131701 gaaattactc agaccccgag cgcggcaccg gaggtttata ctcggagttc gagtacgatg
   131761 ccagaaactg cacagagcac acccctggcc tcgcaaaacc ctaccagttc gggaaccggg
   131821 acgcataata ctgaaccgag gacttatcca gtgcaaacga caccacatac ccagaaactc
   131881 tacacagaaa ataagacttt atcgtttcct actgttgttt cagaattcca tgagatgtcg
   131941 acggcagagt cgcagacgcc cctattggac gtcaaaattg tagaggtgaa gttttcaaac
   132001 gatggcgaag taacggcgac ttgcgtttcc accgtcaaat ctccctatag ggtagaaact
   132061 aattggaaag tagacctcgt agatgtaatg gatgaaattt ctgggaacag tcccgccggg
   132121 gtttttaaca gtaatgagaa atggcagaaa cagctgtact acagagtaac cgatggaaga
   132181 acatcggtcc agctaatgtg cctgtcgtgc acgagccatt ctccggaacc ttactgtctt
   132241 ttcgacacgt ctcttatagc gagggaaaaa gatatcgcgc cagagttata ctttacctct
   132301 gatccgcaaa cggcatactg cacaataact ctgccgtccg gcgttgttcc gagattcgaa
   132361 tggagcctta ataatgtttc actgccggaa tatttgacgg ccacgaccgt tgtttcgcat
   132421 accgctggcc aaagtacagt gtggaagagc agcgcgagag caggcgaggc gtggatttct
   132481 ggccggggag gcaatatata cgaatgcacc gtcctcatct cagacggcac tcgcgttact
   132541 acgcgaaagg agaggtgctt aacaaacaca tggattgcgg tggaaaacgg tgctgctcag
   132601 gcgcagctgt attcactctt ttctggactt gtgtcaggat tatgcgggag catatctgct
   132661 ttgtacgcaa cgctatggac cgccatttat ttttgaggaa tgctttttgg actatcgtac
   132721 tgctttcttc cttcgctagc cagagcaccg ccgccgtcac gtacgactac attttaggcc
   132781 gtcgcgcgct cgacgcgcta accataccgg cggttggccc gtataacaga tacctcacta
   132841 gggtatcaag aggctgcgac gttgtcgagc tcaacccgat ttctaacgtg gacgacatga
   132901 tatcggcggc caaagaaaaa gagaaggggg gccctttcga ggcctccgtc gtctggttct
   132961 acgtgattaa gggcgacgac ggcgaggaca agtactgtcc aatctataga aaagagtaca
   133021 gggaatgtgg cgacgtacaa ctgctatctg aatgcgccgt tcaatctgca cagatgtggg
   133081 cagtggacta tgttcctagc acccttgtat cgcgaaatgg cgcgggactg actatattct
   133141 cccccactgc tgcgctctct ggccaatact tgctgaccct gaaaatcggg agatttgcgc
   133201 aaacagctct cgtaactcta gaagttaacg atcgctgttt aaagatcggg tcgcagctta
   133261 actttttacc gtcgaaatgc tggacaacag aacagtatca gactggattt caaggcgaac
   133321 acctttatcc gatcgcagac accaatacac gacacgcgga cgacgtatat cggggatacg
   133381 aagatattct gcagcgctgg aataatttgc tgaggaaaaa gaatcctagc gcgccagacc
   133441 ctcgtccaga tagcgtcccg caagaaattc ccgctgtaac caagaaagcg gaagggcgca
   133501 ccccggacgc agaaagcagc gaaaagaagg cccctccaga agactcggag gacgacatgc
   133561 aggcagaggc ttctggagaa aatcctgccg ccctccccga agacgacgaa gtccccgagg
   133621 acaccgagca cgatgatcca aactcggatc ctgactatta caatgacatg cccgccgtga
   133681 tcccggtgga ggagactact aaaagttcta atgccgtctc catgcccata ttcgcggcgt
   133741 tcgtagcctg cgcggtcgcg ctcgtggggc tactggtttg gagcatcgta aaatgcgcgc
   133801 gtagctaatc gagcctagaa taggtggttt cttcctacat gccacgcctc acgctcataa
   133861 tataaatcac atggaatagc ataccaatgc ctattcattg ggacgttcga aaagcatggc
   133921 atcgctactt ggaactctgg ctctccttgc cgcgacgctc gcacccttcg gcgcgatggg
   133981 aatcgtgatc actggaaatc acgtctccgc caggattgac gacgatcaca tcgtgatcgt
   134041 cgcgcctcgc cccgaagcta caattcaact gcagctattt ttcatgcctg gccagagacc
   134101 ccacaaaccc tactcaggaa ccgtccgcgt cgcgtttcgg tctgatataa caaaccagtg
   134161 ctaccaggaa cttagcgagg agcgctttga aaattgcact catcgatcgt cttctgtttt
   134221 tgtcggctgt aaagtgaccg agtacacgtt ctccgcctcg aacagactaa ccggacctcc
   134281 acacccgttt aagctcacta tacgaaatcc tcgtccgaac gacagcggga tgttctacgt
   134341 aattgttcgg ctagacgaca ccaaagaacc cattgacgtc ttcgcgatcc aactatcggt
   134401 gtatcaattc gcgaacaccg ccgcgactcg cggactctat tccaaggctt cgtgtcgcac
   134461 cttcggatta cctaccgtcc aacttgaggc ctatctcagg accgaggaaa gttggcgcaa
   134521 ctggcaagcg tacgttgcca cggaggccac gacgaccagc gccgaggcga caaccccgac
   134581 gcccgtcact gcaaccagcg cctccgaact tgaagcggaa cactttacct ttccctggct
   134641 agaaaatggc gtggatcatt acgaaccgac acccgcaaac gaaaattcaa acgttactgt
   134701 ccgtctcggg acaatgagcc ctacgctaat tggggtaacc gtggctgccg tcgtgagcgc
   134761 aacgatcggc ctcgtcattg taatttccat cgtcaccaga aacatgtgca ccccgcaccg
   134821 aaaattagac acggtctcgc aagacgacga agaacgttcc caaactagaa gggaatcgcg
   134881 aaaatttgga cccatggttg cgtgcgaaat aaacaagggg gctgaccagg atagtgaact
   134941 tgtggaactg gttgcgattg ttaacccgtc tgcgctaagc tcgcccgact caataaaaat
   135001 gtgattaagt ctgaatgtgg ctctccaatc atttcgattc tctaatctcc caatcctctc
   135061 aaaaggggca gtatcggaca cggactggga ggggcgtaca cgatagttat atggtacagc
   135121 agaggcctct gaacacttag gaggagaatt cagccgggga gagcccctgt tgagtaggct
   135181 tgggagcata ttgcaggatg aacatgttag tgatagttct cgcctcttgt cttgcgcgcc
   135241 taacttttgc gacgcgacac gtcctctttt tggaaggcac tcaggctgtc ctcggggaag
   135301 atgatcccag aaacgttccg gaagggactg taatcaaatg gacaaaagtc ctgcggaacg
   135361 cgtgcaagat gaaggcggcc gatgtctgct cttcgcctaa ctattgcttt catgatttaa
   135421 tttacgacgg aggaaagaaa gactgcccgc ccgcgggacc cctgtctgca aacctggtaa
   135481 ttttactaaa gcgcggcgaa agcttcgtcg tgctgggttc tgggctacac aacagcaata
   135541 taactaatat catgtggaca gagtacggag gcctgctctt tgatcctgta actcgttcgg
   135601 acgagggaat ctattttcga cggatctctc agccagatct ggccatggaa actacatcgt
   135661 acaacgtcag cgttctttcg cacgtagacg agaaggctcc agcaccgcac gaggtggaga
   135721 tagacaccat caagccgtca gaggcccacg cgcacgtgga attacaaatg ctgccgtttc
   135781 atgaactcaa cgacaacagc cccacctatg tgacccctgt tcttagagtc ttcccaccga
   135841 ccgagcacgt aaaatttaac gttacgtatt cgtggtatgg gtttgatgtc aaagaggagt
   135901 gcgaagaagt gaaactgttc gagccgtgcg tataccatcc tacagacggc aaatgtcagt
   135961 ttcccgcaac caaccagaga tgcctcatag gatctgtctt gatggcggaa ttcttgggcg
   136021 cggcctcttt gctggattgt tcccgcgata ctctagaaga ctgccacgaa aatcgcgtgc
   136081 cgaacctacg gttcgattcg cgactctccg agtcacgcgc aggcctggtg atcagtcctc
   136141 ttatagccat ccccaaagtt ttgattatag tcgtttccga cggagacatt ttgggatgga
   136201 gctacacggt gctcgggaaa cgtaacagtc cgcgcgtagt agtcgaaacg cacatgccct
   136261 cgaaggtccc gatgaacaaa gtagtaattg gcagtcccgg accaatggac gaaacgggta
   136321 actataaaat gtacttcgtc gtcgcggggg tggccgcgac gtgcgtaatt cttacatgcg
   136381 ctctgcttgt ggggaaaaag aagtgccccg cgcaccaaat gggtactttt tccaagaccg
   136441 aaccattgta cgcgccgctc cccaaaaacg agtttgaggc cggcgggctt acggacgatg
   136501 aggaagtgat ttatgacgaa gtatacgaac ccctatttcg cggctactgt aagcaggaat
   136561 tccgcgaaga tgtgaatacc tttttcggtg cggtcgtgga gggagaaagg gccttaaact
   136621 ttaaatccgc catcgcatca atggcagatc gcatcctggc aaataaaagc ggcagaagga
   136681 atatggatag ctattagttg gtcatgcctt ttaagaccag aggggccgaa gacgcggccg
   136741 cgggcaagaa caggtttaag aaatcgagaa atcgggaaat cttaccgacc agactgcgtg
   136801 gcaccggtaa gaaaactgcc ggattgtcca attataccca gcctattccc tggaacccta
   136861 aattctgcag cgcgcgcggg gaatctgaca accacgcgtg taaagacact ttttatcgca
   136921 ggacgtgctg cgcatcgcgc tctaccgttt ccagtcaacc cgattccccc cacacaccca
   136981 tgcctactga gtatgggcgc gtgccctccg caaagcgcaa aaaactatca tcttcagact
   137041 gcgagggcgc gcaccaaccc ctagtatcct gtaaacttcc ggattctcaa gcagcaccgg
   137101 cgcgaaccta tagttctgcg caaagatata ctgttgacga ggtttcgtcg ccaactccgc
   137161 caggcgtcga cgctgttgcg gacttagaaa cgcgcgcgga acttcctggc gctacgacgg
   137221 aacaaacgga aagtaaaaat aagctcccca accaacaatc gcgcctgaag ccgaaaccca
   137281 caaacgagca cgtcggaggg gagcggtgcc cctccgaagg cacggtcgag gcgccatcgc
   137341 tcggcatcct ctcgcgcgtc ggggcagcga tagcaaacga gctggctcgt atgcggaggg
   137401 cgtgtcttcc gctcgccgcg tcggcggccg ctgccggaat agtggcctgg gccgcggcga
   137461 gggccttgca gaaacaaggg cggtagcagt aataataacc acacaaatat tgacaataat
   137521 aaacgcgtac gcggatgagt aagtgttatt gtctcgcgcg ccatctttat aaaagcccgc
   137581 gttgcgtggg ccggcgggta gcatttggag ggttggcgac catgtcgaga cctccgacgt
   137641 cacatttgga cttagctttc tcggcggcct ttaggggcac ggacctgccc ggagggagat
   137701 tctggcgggc gtcgcagagt tgcgatattt tcttttggcc cgatctggcc gcggtgatcg
   137761 tacaggccgc ccgcgcgtat tttgaaggga aggaaaggct gggcagtctg caggtcgccg
   137821 aagatatcac ggcgcacgac ccgcgaatag cgcccgcggc taagcgcgcc gtcgcagcgg
   137881 cggtaggact gtggaccgcg ctgtcggagt tagttggggg gccgaacggg gagttggaaa
   137941 gcaaggtctg gggcaagcag attccccggg ccgccgcgtg ggaaataaga gacgtgccca
   138001 aagttccagt cattgggccg gacattcttt cttttttctc cgccgccgtc gagctgccgg
   138061 tgctctatat cagagcccgg ggaggggcgc actcgcggtc cgcgcactgg aataaccaga
   138121 gcagcgcgcc ggccgccgga ctcgcggcga taaggatagg catggagatg gtgcggagcc
   138181 tcctggtgat agcgctgcct ctgtcaaact tcaccctccc ggaagacctc cccgaaggtt
   138241 cccaaaactc gatccgcgcg ttcgtggccc acctcatgaa ctgtgtagct accgataaga
   138301 tcatgtctcc ggacgtgcgc gtcccagtcg aagaaagctt ttacagccac tgtttaaggg
   138361 aaatcattat gtgcgagaga gctttttgtt acccgtgcaa tcccccgcca aaatggtgag
   138421 ctcagggtcc catttacccc cgcaacaccc tctcgccgcc agggcgcgcg ctctatcttt
   138481 ctctatgtcc cgtcgccacc ggcctaaccg aacggtggaa cggggccgcc cgggaaagcc
   138541 tagctccgca cagacacaga cagacaaacg gcctctcgat tgcaacaacg tgaaaaacac
   138601 acaataatat tactttattt atttcgcagc gctcgcgtgt cgctcgtttc tggggggggg
   138661 ggggggttgt gtttcgctgc cgcggagtgg gtgagggggg agagtggacg gaggacagtg
   138721 taaaaacccg cgaggttgtc agggacgcgg aggtaaggaa gccgctagag ggcgtcattc
   138781 tcccgtcaac ggcgccgcgc cagcgccagc gcgattccag cgtccctcgc aaagatcgag
   138841 gcgctcactt cgggagagtt ggcggcagcc gcgccggcgc gcaaggcggc caggtattcg
   138901 cgacggcgca tctccgattg cgggactctc cccgtcccga cgcagaaaag actctgcacg
   138961 taaatcgagt cgtacaaaca cgcttcgcgg cacggccgag ggtgccacaa gcagcaccag
   139021 tgcccggccg ccaggagaga ccgggaggtc tctcgctcgg cggacgcgag gtcggccggc
   139081 aggtgtcggg acagccagga taacagttct ttctcgatca cgaaacgcat attctcgctc
   139141 tgcatggtac ggctctcgtc ctcgaagcgg tcaccgtcca gagagtcgag ccagaaatcg
   139201 ccctcgatcc cttccattgc ctcctctaat tctcccaacc cgttgccgtt attcgggtca
   139261 gtgggggagt tggcgacgct ctccgtcgac gcccaccgcg gcctcaaacc taggccgcgc
   139321 gtcgcccggc tggcccccag aaaagccgaa cgtagccgtt cgttggcagc aatcagcgcg
   139381 ttgcggcggt ctctcgctga cgtgaactct ccgtaaccgt ccttgagttc ggacgatatc
   139441 tcgactaact cgcgccagag ccgcgaggcg atccgaatgc acgggtctac cgagtcggcc
   139501 gactccgacg aggcgacagc ggcaccttgc cgcctgcgct cgccacgagg taccgcgtgc
   139561 gcagtaatgt gatcgctgtc catcagcgcc agcgggtagc acccgtcgag catgttttcc
   139621 atttagggat gtgtctagag gagagcggtc cgggcggtct actgcggttg tgctgggccg
   139681 agttggacgg ctacggattg cgccgggcgt gaaggggggg gggcggcggg atgtccggcg
   139741 gtcgcaaagg ggcgcgcgtc cgcttctgcg tgaaggctga gcgggaaaga agttctggat
   139801 gagaatggat cgagcgggca ataaatgtcc agagtagggg ggtgggaggg agggggaggt
   139861 tctgccccgc gtctcctcta tctgctcgtc gaggcctcgg ccttgcgtcg ccgtgcaggg
   139921 gtcgaggccg cttcttcttt tttacttctc tcctcggatt cctcgtcaga ggaagaagaa
   139981 aatgacaacc tccgtctttt aagagtgcgc ctacccgccc tggcggccga agccttccgt
   140041 gggtctttgc gggtgccgcg caccgcaata acgcacggac gcgggggata gcaaatggcg
   140101 gcggcgccgg agagctgtcg tcaataaagt ctaagtcaga ttgcgtgggc tctgactcgg
   140161 tggagctgtg tcccgtgtcc tcctcgccca agtccactcc ccggcaccca ggctgctctt
   140221 cctccgactc cgggtcgctc cagctcctcc cgcgtgccgg ttcttcgtcc tccgatacgt
   140281 ccgaaaagaa aaacttctgg gagagctctt cgggatccaa aaaggatcca gaaccctacc
   140341 ccgtgaccta atttacatga tgtgggtggc acccacctac gtcacgttcg caccgagggt
   140401 cctgcatccc cccttccagc caatgagctg tgacttgcct cttcgggcac tgcataaaag
   140461 aacgatccgg gtcgctgtcc ccgcatatag cgggaccatc gggtcctgct cggattaccc
   140521 caggaagagg ggagaagatt tcatactggg gacacaatgg gaggggtcat tgtcttctca
   140581 catgagcaac ccgaaaatcc ccccgccgat gcctccagac cacgccgacg caggctccgt
   140641 ttaaagccat gcactgtccc agatggggat gggtcaccga tcggagaggc ttgtcctcac
   140701 gatacacacg acccgggtcg agcacccccc tcgacccccg accctgaatg tgatcgggaa
   140761 gtgatattcg gcgggatgaa ctcatccgga ggctgcgtga ccgatactct ccaagacatc
   140821 gcgggttaaa aatactctac gaaagctcat gttcgagttt acctgaccca gaaaataagg
   140881 acccaacaaa gtcgattgtc gtgaagagct agttaacact gaaccgccat aggcggtgtg
   140941 cactttatga atttttgttt ttacttgagc tgttcggcat gtgccgggct cactacttta
   141001 tttgctcttt aatagggccg ctgagttgtt tgggcccacc gacgtgcagg ttatcggctt
   141061 cgttgccctt gcttattgca tacatattgc atactttcat attactgcta cgactgcgtt
   141121 gtaacaccgc cagttaacac gattactggg tagatccagt atggatgtat tacgcgcatg
   141181 tatatagccc gtaccttgat attataccgg ctattgcaac tcgtgctttg tttcgagcgc
   141241 atctgctaag cctgcggctg ccttccacgc gcaagtaact ggttttagtc ccacgggcaa
   141301 cccgacatag gtgcgtttcc taaaagaaac ctgtagagac agtaccgtga cccccgacat
   141361 atatatctgg aagtgtattt gcgattcacc ggcgaatcgg caagtctcct gcagagaggc
   141421 tcctgcgatt acttccagat ccgcgtaaga aaattacagg gacgtttgta aatcgcaaac
   141481 cagattgcga actatattcc cgagcatgga ccttctcgcc atatctctca aaagaagaaa
   141541 agtgccctgc aaatacagaa cgcatcccga gattcaaaat ttgcgattcg tgcatcccga
   141601 gcggcaaatg tctcaataaa gtaattatgt gttcccgcga actactcgcg tggaacatgg
   141661 aaccaagctt ttgcgttgtc tgaatttttt atttaggctg ggttagaggg gtggctagaa
   141721 gataataatc tttcgtggaa aattgctaga gattagaaca cacaagtaac acaagtgctc
   141781 acggtgatat ttacacatgt caactctccc atatggggat cttttttctg tcacaacttc
   141841 cttggcactc ccaggaagcg tgacccatgt gctttcgttg gcattcaaaa taaacttcac
   141901 tgcttcccgg tgtggccaat aacgtacaag cgagcgtgtt tctcgggtaa tatcaatgcc
   141961 aacaaaacac acgcgtgacc tttctagagt aggcacacac cccggcaccg aattgcacgt
   142021 acctgtggac acaagtaatg tattgttttg ttatcttcgt catctgttct acagtaggct
   142081 caggtttgtt tattatgttg gctcataaaa aatgccggaa gttcctggta cggtaatggt
   142141 atgctgggcg catggcatgc attggctatg gcacaccgga actggaaata cgctcgctaa
   142201 cgatatgcag gccgcatggg cgccattgga tctgaattat atcatgcctc aatacaaatg
   142261 ccatacccaa accaactgca caagaccgag gggttgactc tccaaagttc tttcttcaca
   142321 acacctttgc tgaaacctac ccagcgtgga aaggacctct tcgcaaaacg taagtcatga
   142381 aaccaatatt ctgttataaa ttttggggtg ggattaggtg ggctgtcatt atttgagggg
   142441 accacgaaat atccttttgc atggggtatc gtgcaaaaat atgactgtgg gcttcgaata
   142501 attcccccat acagtcaaga gtatgggctg ctgttatgga tgaacatgaa gcgcacaaaa
   142561 cgataatcca cttctttagc atgtattgct gttccaaaat tgtgcctatg gttgcggagc
   142621 tttattgtgc tctgcattgc ggggacggaa ataaacaggc caacgcgaga aacgggaggt
   142681 ttcgagagtc gcgcatcttt attttttctg ttactactcc ccaccagaaa gcttcacgtt
   142741 tcttccaact tctgcacaaa acttacgtaa ccttgtcact cgggtcttgt tctgcaggat
   142801 tctggaaatc gctagtcctt ccactagcat tctatcatgt cctctgattc ctcgacgccg
   142861 agtaatttgg ccgctccaat tgttgatgag tcgggattct caactggccc gccctcagat
   142921 ctatttacct ttttgcgcgc cgataagagt gggcgctacg attctttggg ttctcccatc
   142981 ccgaaccctc caaacgcacc tacctgtgag accactactg atagcttttc gtacagcacg
   143041 ccacctcttt tttccagcga ggacgagctc tttcactctg tcatcgctga gaatgcggcc
   143101 caagacgcgg cccaagacgt ggacgggcga gaaatgtctc tccgcgacct tatagcgatg
   143161 ttaaacgaca tggatcccga aaacataaac tctatagaac cgtgtccgaa cgctaccagt
   143221 gatgtcgtgg cactagatat taacgtggat accgatcagc ccggagttta tacggtcatc
   143281 gactcgctcg cgcatccctg cgaaactccc atggagcagc agcacgttga atgcccgtgt
   143341 ccattacctg cagtagagaa aacaaccgct gtgaggcgtc aagaagtggt gaggaagtca
   143401 gagagagtgg ccagatctcg ttcgcgacgg ccgtggcgcg atctttggag caaccggcgc
   143461 cccgtccctt cgccgcagag gaccagcaaa gaccgtctcc ccaagcgagg gaagagggaa
   143521 ttttcgaaga agatgggccc gagccacctt acctcttcct cctcttcctc ctcttcctca
   143581 ttctcgctgt cagggaggag gggacgtctc gcccgaaggc tggaaagcgc aggaagtgaa
   143641 aaatccaccg aaagccccga ccgggactct gcccaattag tgctacctgg agaatgtccc
   143701 gatgtcgcgc tagagccact ctggcgagtt ttgagggagt gggtcgaaac ggacggtaca
   143761 gacgggtcgg ttcagtcagt aaccgcgcct acggagctcc cagacctagg ccgcggcatt
   143821 accctgaatg tactctcacg agcgttggcc gtcgacctcc atagttccga ggctcgcgtt
   143881 tttgttccag aagctattat cccatcccca cccagtagag gacaagtata tcatggaagt
   143941 ggctatagac agtctttggt cgatgacccg caggttcggg aggccgcggc cgaattccat
   144001 gccaatccga aatcagcttc cgtgtatctc gaagagtacg ggatgccagt ggaacagtta
   144061 gagcgccttg tggaggagtt catggtccat cccctgtcgc gcgtttcgta tgggtatggt
   144121 ggccccaagc tgagcccacg tgacaaacgg ctctgcgaac tgtgcgctct ccgcggtccg
   144181 ggttcttccg agggaggatt gtctcgttct gcggtgccga cgtgcctccc gcacgtagcg
   144241 cacgccatgc gtgatggccg tgtgtcatta gctctgccgc accttaccga gctcgtacgc
   144301 gtgtgccgcc gctatgacca cccgcagaaa acttacctgt tggcggctct taggagagcg
   144361 tttgtcccgt ttgtatttcc aggagcggcc gtggatccta cggcggcgtc tgcttctggg
   144421 gaccaccctg tactcgttgg cgccaggcga atagcgcgtg ccacgaggga gctggaagcc
   144481 gcagcgaaag agccacctgc ggcaaccccg gaaaaacttt cctcttcggc gctattgcgc
   144541 catactagaa cttgcattgt tgctgccgca gatctcatgg cggcgcttac tgctatagac
   144601 tgcccaccag ttacaataaa ccccgccaag cgtcgcccgg atctgtatca agcactctcg
   144661 agggcgccca aaacagtctt tacgtgggag cgcgccatgc cgtactgcgc ggcttcgcta
   144721 tggagtcgcc tcgtcatagg gtccctgccg ctgccatcta ccgatgatgt cactcttctt
   144781 gtagaagcca tggaagctgc cgtgggcgtg cttggctgct ccgacgaggg tgacgtgcgg
   144841 ccttcaattg cctacgcggc ctctggttgg aggatgatcg ctaccatgct aggagatgat
   144901 tccgcgcccg gcagcgagca cgtcacggac gattgtcccg cagatgatga cacccaccac
   144961 catgacaggc gcaaaagacg aggcggccgg cggacgactt gccggtacga cctacctccc
   145021 ggcactcccg atcgcgcggc ccacctccta ctctacggga gtcctggcgg cggcgacgga
   145081 gcagagcctt cggccgccca agaatctccc gccaacccct ggcccagagc tccaccgtgc
   145141 gatgaacagg agccattatc tgtgtcaccg tacgggcccg aacccgaccg ccctccagat
   145201 gatgactttg agacccgtaa aggtctgaaa agaaagtcat ctgaagatca tgcggacccg
   145261 atcccagaag gcaacgcgac taaaaaaaca tgtggcctcc agggcttacc agattcatta
   145321 cctccagcgg ttccagaaac agatagagac aaccccctcc ttccgccatg ccccataact
   145381 cccgagggtc caccatgtcc gccccgagaa gaaccgcaac aaccgcaaga accgcaagaa
   145441 ccacaatccc cgtcctttca catttccgag ataggtgagg ccctgtttca ttctacccca
   145501 gtcagcccta ccatcctgtt cgcaccggag ggtttcatcc cgaaccaagg ggatgtttac
   145561 cgtccccatg gcaaaaactt gggcgttgcg ctctccgcag gggagccata cgtgcccgcc
   145621 catcgcgcgc gtcctgcttt ggagcggctc gcgaactatt tgcgcgggtt gagcagcggt
   145681 ccggcgggaa gctattccgc gaccggaccc gcagattggc tacctgcttt tgcgagggac
   145741 ccagtagccc tgggggagtt ttgcaagagg atttcacccg tgaacagagg gggacgctgc
   145801 gtcttagagg agcggctttc ctggacgttg cgacatccgg ctgacaaaat ctatgacctc
   145861 atcattcttg tctcagaacg tgccccgggc gaatttttag aacgcgcgta cgcctacgcg
   145921 gccctctgcg gacgtgcctg catgccgggc ggtgcctgtt ggccagaatc gtggacacgc
   145981 ggggagtatc cctatatccc tcccgacgag aaagacccgg gccgcagcgt ggccattctc
   146041 tgtacgacag accttggata cgccggggcg gtagaatgga tgcttgagcg cgctctcagt
   146101 acatctgggc gcgcatgcgt ggtcgtagat gctagggatc ccggggacga ggattcccgc
   146161 tcgggtccgc gcatacctac cgggcggagg ggtgttgtct atgcccggac tagccccccg
   146221 tcgcacgctt accttgtaaa actgtttacc ggtccggcgg ccgaacggtt ggaacggggt
   146281 gggctcaatg taggtcacgt agtaatggac aggcgactca ctgtctcatg gcccctcagc
   146341 gttgggaaga ccgacaacga cgatgagggt acaggagaca gagagaagtg tcctcccgtt
   146401 aagcacccct tcctcactca cgtaactctc aggagattac gcgacgttgc tcgtgccatg
   146461 gatgccgggt ggagccactc cgaaatcgga aaagcttcag ccgtcttgta tccgtacatg
   146521 gcccagcccc atgtgggcgc cggggcgatg ccgccatgtc cggacctttc cgagtccagt
   146581 tccactatgc attcttcttc gtcgtcttcc tcttcctcat gctcctcgtc gtcgtcttct
   146641 tcagactcca gctcatctga agaagacggg gacgagaaga acgagaaaga agatcgtgag
   146701 cgcgccggag gtggaaagcg gcgcggccgc cagcgcctcc cgattcggga ccgcgtgtac
   146761 cgtggccggg actaccgcgt gcgcactccc tgtgctgata ttgtgggagg cacttccgct
   146821 tcctttaggg ccgtcgctgc gtgggggagg gacacggtaa ttcccgccct ccctctcgca
   146881 gcgtcctggt ccgatcccag caaaattcca caggaagttc tccgcatcat ctccgattat
   146941 tacccggatg cgccaggggc gcgggcgcgt cggaacccgc ttcacgtgga aggactagcg
   147001 cttatgcgtg ccagaaatcc cgcccctctc gcattgctac ttggtgacga ctattcccat
   147061 tatcacactc cccgcaatcg gtccccaatg tgttgttgct ggagtgctcc gcggggagca
   147121 acgccagagt cactcagatg caccggacac acgcgcacca ggcgcccaag gctatccgtc
   147181 tcctcaggga ggggggaaac tagaaccctt gtccccagat tagattagac tcttcagagg
   147241 ataggcggtc gcgtcaacgc catagacgca tgactaacta ccctctaacg catcccactg
   147301 tcactgaccc ttggtggtaa ccgtggtttc cgttattaac ttattaaaac tttttgtaca
   147361 atttacttct ggttgcgtgc tcattctttt gcttgtcgga gcttgtcggc caccgacgac
   147421 ttgtagaaaa agaccgggga aatgatctag ccccgttgac tttagctttg ctgaacattc
   147481 tacccgtgcg gccatggagt gatattagaa aagggacgag aatgggggca agtacgaata
   147541 tcgggaggag gcggaacgag gtgttaagta atgcacttga atatttaatt cgttcatttt
   147601 gatacatgag atccacggaa gcttgtaatg ctggccggca gcatttattt actattgcaa
   147661 gcgccgatat aaaaatcgca atcaaaatac tagattgtct agtattgcct gctctgacgg
   147721 acgtaacgtc tctgtagagc gttcgccagg tcattcagga acgacttcat caaatacgaa
   147781 tcctccactg ttatagggca cggtgcctgt aataaatagg agatacaatg ttagactcgt
   147841 catgcgacca ataaggaccg cgtgagcacg gagacaaaag atgtctcgga gatactgtgc
   147901 tgcgcgttag atagtctctt caaagtacag aatgcgcgat gctgccatta tcttaccttg
   147961 cgagacgtac cgccattact ggcagaattc agcacgttat acaaattgac gtagagcccc
   148021 tgcagttttt tgtagcactg ttggtgtttc aaaatgaccg aaagggattg gcacaactct
   148081 tcagtttcgt ttagacgctg caggaaaagc aagattcgtt aataaaccgc cgagcagatt
   148141 attgggcagg gtagacctaa gcaaaaaatc tacattttta atctggggca tgcgcgcggc
   148201 cggcctccag ggcattgccg ttgagaacac gtgacaaatg agctggcttt tactcaccgt
   148261 gccggacgta aagatgttcg gaactcttct accgtcgcag gaacccttat aaggaagcga
   148321 gagagcctac agttatgaac gtgaacatag actgaatagc cgtacatagt tacaaagacc
   148381 gtgcaggcat gtcagcatgg tccaacgaga atgagttgct ttacgtcctt ctgcacacgg
   148441 tgcagtattc tgatgctctc cgccagtaac ttcaagggtg ccgcgcgtat actgcgagca
   148501 tccccgactc caagtagtaa caccagcaac gccagtgcgg cggacaatgg aggtttcgac
   148561 ttgccaggca ttcccaccgc gcgcaaccgc cgccgcgaaa cttctcccct agttctccct
   148621 ctgggttctt ccctaaggat acactgccac catttatata gctttacgtg gcgggaaagc
   148681 cctggcc
//

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH