Job Title: BlastpHsmar2

Show Conserved Domains

RID=53JZN1JM012, BLASTP 2.2.16 [Mar-25-2007]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 53JZN1JM012


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           4,970,641 sequences; 1,719,627,930 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports

Query=  
Length=351


Distance tree of resultsNew  
Score E Sequences producing significant alignments: (Bits) Value gb|AAC52011.1| mariner transposase [Homo sapiens] 693 0.0 emb|CAD45368.1| transposase [Bythograea thermydron] 270 7e-71 emb|CAD45370.1| transposase [Ventiella sulfuris] 264 5e-69 emb|CAD45367.1| transposase [Bythograea thermydron] 261 5e-68 emb|CAD45369.1| transposase [Bythograea thermydron] 254 8e-66 gb|AAC46945.1| mariner transposase [Chrysoperla plorabunda] 253 1e-65 gb|AAC46946.1| mariner transposase [Chrysoperla plorabunda] 251 6e-65 gb|AAC46948.1| mariner transposase [Chrysoperla plorabunda] 251 6e-65 gb|AAU04866.1| mariner transposase [Mariner transposase deliv... 250 8e-65 gb|AAA28265.1| mariner transposase >gb|AAC46947.1| mariner tr... 250 8e-65 gb|AAM82289.1| mariner transposase C9 mutant [Transposon deli... 250 9e-65 gb|AAT79489.1| mariner transposase C9 mutant [Mutagenesis vector 249 2e-64 gb|ABF51498.1| mariner transposase [Bombyx mori] 240 9e-62 UniGene info gb|ABA55502.1| transposase [Heliothis virescens] 213 1e-53 emb|CAH03740.1| transposase [Messor bouvieri] 198 4e-49 emb|CAH03742.1| transposase [Messor bouvieri] 197 1e-48 emb|CAH03741.1| transposase [Messor bouvieri] 193 1e-47 emb|CAH03739.1| transposase [Messor bouvieri] 193 2e-47 gb|AAA66077.1| transposase [Mayetiola destructor] 192 2e-47 gb|AAO12862.1| Camar1 transposase [Chymomyza amoena] 191 4e-47 gb|AAO12864.1| Ccmar2 transposase [Ceratitis capitata] 189 3e-46 gb|AAP51091.1| transposase [Forficula auricularia] 187 7e-46 gb|AAP51087.1| transposase [Forficula auricularia] 187 9e-46 gb|AAP51098.1| transposase [Forficula auricularia] >gb|AAP510... 186 1e-45 gb|AAP51082.1| transposase [Forficula auricularia] 186 1e-45 gb|AAP51093.1| transposase [Forficula auricularia] 186 1e-45 gb|AAO12863.1| Famar1 transposase [Forficula auricularia] 186 1e-45 gb|AAP51083.1| transposase [Forficula auricularia] 186 2e-45 gb|AAP51092.1| transposase [Forficula auricularia] 186 2e-45 gb|AAP51089.1| transposase [Forficula auricularia] 185 3e-45 gb|AAP51090.1| transposase [Forficula auricularia] >gb|AAP510... 185 3e-45 gb|AAP51096.1| transposase [Forficula auricularia] 185 3e-45 gb|AAP51084.1| transposase [Forficula auricularia] 185 3e-45 gb|AAP51095.1| transposase [Forficula auricularia] 185 4e-45 ref|NP_001073580.1| Ammar1 transposase [Apis mellifera] >gb|A... 185 4e-45 UniGene infoGene info gb|AAP51086.1| transposase [Forficula auricularia] 184 5e-45 gb|AAY57408.1| v3 [Mayetiola destructor] 184 6e-45 gb|AAP51088.1| transposase [Forficula auricularia] 182 2e-44 gb|AAP51085.1| transposase [Forficula auricularia] 182 4e-44 gb|AAP51097.1| transposase [Forficula auricularia] 181 5e-44 ref|XP_001099426.1| PREDICTED: similar to SET domain and mari... 175 4e-42 Gene info gb|AAC16616.1| transposase [Drosophila simulans] 174 6e-42 gb|AAC16618.1| transposase [Drosophila simulans] 174 7e-42 gb|AAA28678.1| mariner transposition protein (put.); putative... 174 7e-42 gb|AAK54758.1| mariner-like transposase [Musca domestica] 174 8e-42 gb|AAC16610.1| transposase [Drosophila simulans] >gb|AAC16611... 174 8e-42 ref|NP_006506.1| SET domain and mariner transposase fusion [H... 174 9e-42 UniGene infoGene info ref|XP_526121.2| PREDICTED: SET domain and mariner transposas... 173 1e-41 Gene info gb|EAW63905.1| SET domain and mariner transposase fusion gene... 173 1e-41 Gene info sp|Q53H47|SETMR_HUMAN Histone-lysine N-methyltransferase SETM... 173 1e-41 Gene info gb|AAC09350.1| unknown [Homo sapiens] 173 1e-41 UniGene infoGene info gb|AAC52010.1| mariner transposase [Homo sapiens] 173 1e-41 Gene info dbj|BAB86288.1| mariner transposase [Apis cerana] 173 1e-41 gb|AAC16612.1| transposase [Drosophila simulans] 173 1e-41 gb|AAC16614.1| transposase [Drosophila simulans] 173 2e-41 gb|AAC16613.1| transposase [Drosophila simulans] 172 2e-41 gb|AAC16617.1| transposase [Drosophila simulans] 171 4e-41 dbj|BAE87709.1| unnamed protein product [Macaca fascicularis] 171 5e-41 UniGene info gb|AAC16609.1| transposase [Drosophila sechellia] 171 8e-41 gb|AAB17945.1| mariner transposase [Ceratitis capitata] 170 1e-40 gb|AAC16608.1| transposase [Drosophila sechellia] 170 1e-40 gb|EAW63904.1| SET domain and mariner transposase fusion gene... 167 6e-40 Gene info gb|ABC72089.1| SETMAR [Gorilla gorilla] 167 6e-40 gb|ABC72093.1| SETMAR [Aotus trivirgatus] 167 8e-40 gb|ABC72092.1| SETMAR [Cercopithecus aethiops] 167 1e-39 ref|XP_001120719.1| PREDICTED: similar to T12B5.6 [Apis mellifer 167 1e-39 Gene info gb|ABC72088.1| SETMAR [Pan troglodytes] 167 1e-39 gb|AAC28261.1| transposase [Drosophila teissieri] 166 1e-39 gb|AAC28262.1| transposase [Drosophila teissieri] 166 2e-39 gb|ABC72090.1| SETMAR [Pongo pygmaeus] 166 2e-39 gb|AAH08931.2| SETMAR protein [Homo sapiens] 166 2e-39 UniGene infoGene info gb|ABC72087.1| SETMAR [Homo sapiens] 165 4e-39 Gene info gb|AAL69970.1|AF465247_1 transposase [Mamestra brassicae] 164 8e-39 gb|ABC72091.1| SETMAR [Symphalangus syndactylus] 162 2e-38 ref|XP_972527.1| PREDICTED: similar to SET domain and mariner... 162 2e-38 Gene info dbj|BAA21826.1| transposase [Attacus atlas] >dbj|BAB32436.1| ... 161 5e-38 emb|CAA56856.1| planarian mariner-9 gene [Girardia tigrina] 160 1e-37 emb|CAA50801.1| mariner-1 protein [Girardia tigrina] 159 2e-37 gb|AAZ67092.1| transposase [Adineta vaga] 158 4e-37 emb|CAA56858.1| planarian mariner-5 gene [Girardia tigrina] 158 5e-37 prf||1917335A mariner 1 element 158 5e-37 prf||2124399A transposase-like protein 157 8e-37 gb|AAZ67091.1| transposase [Adineta vaga] 157 1e-36 emb|CAA56859.1| planarian mariner-3 gene [Girardia tigrina] 156 2e-36 emb|CAD26968.1| transposase [Meloidogyne chitwoodi] 154 8e-36 gb|AAZ67093.1| transposase [Adineta vaga] 154 8e-36 gb|AAZ67098.1| transposase [Adineta vaga] 154 9e-36 gb|AAZ67094.1| transposase [Adineta vaga] 154 1e-35 gb|AAZ67096.1| transposase [Adineta vaga] 154 1e-35 emb|CAA56857.1| planarian mariner-8 gene [Girardia tigrina] 154 1e-35 gb|AAZ67097.1| transposase [Adineta vaga] 153 1e-35 emb|CAA56763.1| manirer-2 [Girardia tigrina] 153 2e-35 gb|AAZ67095.1| transposase [Adineta vaga] 152 2e-35 gb|AAZ67101.1| transposase [Adineta vaga] 152 3e-35 gb|AAZ67099.1| transposase [Adineta vaga] 151 7e-35 dbj|BAA23532.1| transposase [Bombyx mori] 150 1e-34 ref|NP_001077195.1| hypothetical protein LOC534913 [Bos tauru... 150 2e-34 Gene info gb|AAZ67106.1| transposase [Adineta vaga] 147 9e-34 pir||T32726 hypothetical protein C45H4.5 - Caenorhabditis elegan 147 1e-33 ref|XP_001121351.1| PREDICTED: similar to SET domain and mari... 147 1e-33 Gene info
Alignments
>gb|AAC52011.1| mariner transposase [Homo sapiens] Length=351 Score = 693 bits (1789), Expect = 0.0, Method: Composition-based stats. Identities = 351/351 (100%), Positives = 351/351 (100%), Gaps = 0/351 (0%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE Sbjct 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR Sbjct 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP Sbjct 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK Sbjct 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 Query 241 RPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSL 300 RPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSL Sbjct 241 RPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSL 300 Query 301 KGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 KGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK Sbjct 301 KGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 >emb|CAD45368.1| transposase [Bythograea thermydron] Length=349 Score = 270 bits (691), Expect = 7e-71, Method: Composition-based stats. Identities = 149/348 (42%), Positives = 208/348 (59%), Gaps = 2/348 (0%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 KIE R I F+ K G +I D L VY D AP + +W +F GR+ +ED+ R G Sbjct 3 KIEYRAVINFLTKEGKNAKKIHDRLVAVYNDTAPSYATATRWHKKFHHGRESLEDDPRVG 62 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS + E+ ++ V A I E+RR+ E I+ IS GS TI+ L +SK+S RWVP+ Sbjct 63 RPSEATSEDIVDRVEATITENRRVKVEEISLEIGISHGSVCTIIHHHLGMSKVSARWVPR 122 Query 125 PLR-PDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGG 183 L PD+LQ R S E+L ++ DP F R+VTGDETW++ +DPE K +S +G Sbjct 123 NLSLPDRLQ-RHTSSEELLTLYNADPAGFESRVVTGDETWVHHWDPETKIESMARKHKGS 181 Query 184 SGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPG 243 P+K + S K+MAT+FWDA+G+LLVDFL TIT YY+ VL +L ++ +KR G Sbjct 182 LVPLKFRTQPSAGKIMATIFWDAEGVLLVDFLLRGSTITGEYYDGVLGRLRDSIRQKRRG 241 Query 244 KLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 KL + +LL HDN P + + +A LR+ +E + HPPYSPDLAPSD+FLF LK SL+ Sbjct 242 KLTRGILLLHDNTPVRKARRAQAALRDCGFEQLNHPPYSPDLAPSDYFLFRQLKSSLRER 301 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 F + + VK+ + WL Q F+ + KC+++ G Y EK Sbjct 302 RFDNDDEVKEAVMLWLEKQSESFWLARYQSLRDKWFKCIQVKGNYFEK 349 >emb|CAD45370.1| transposase [Ventiella sulfuris] Length=347 Score = 264 bits (675), Expect = 5e-69, Method: Composition-based stats. Identities = 150/348 (43%), Positives = 206/348 (59%), Gaps = 4/348 (1%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 KIE R I F+ K G +I D L VY D AP + +W +F GR+ +ED+ R G Sbjct 3 KIEYRAVINFLTKEGKNAKKIHDRLVAVYNDTAPSYATATRWHKKFHHGRESLEDDPRVG 62 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS + E+ ++ V A I E+RR+ E I+ IS GS TI+ L +SK+S RWVP+ Sbjct 63 RPSEATSEDIVDRVEATITENRRVKVEEISLEIGISHGSVCTIIHHHLGMSKVSARWVPR 122 Query 125 PLR-PDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGG 183 L PD+LQ R S E+L Q AF R+VTGDETW++ +DPE K +S W +G Sbjct 123 NLSLPDRLQ-RHTSSEELLTT--QTQRAFESRVVTGDETWVHHWDPETKNESMAWKHKGS 179 Query 184 SGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPG 243 P+K + S K+MAT+FWDA+G+LLVDF TIT YY+ VL +L ++ +KR G Sbjct 180 LVPLKFRTQPSAGKIMATIFWDAEGVLLVDFQPRGSTITGEYYDGVLGRLRDSIRQKRRG 239 Query 244 KLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 KL + VLL HDN P + + +A LR+ +E + HPPYSPDLAPSD+FLF LK SL+ Sbjct 240 KLTRGVLLLHDNTPVRKARRAQAALRDCGFEQLNHPPYSPDLAPSDYFLFRQLKSSLRER 299 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 F + + VK+ + WL Q F+ + KC+++ G Y EK Sbjct 300 RFDNDDEVKEALMMWLEKQSESFWLARYQSLRDKWFKCIQVKGNYFEK 347 >emb|CAD45367.1| transposase [Bythograea thermydron] Length=350 Score = 261 bits (666), Expect = 5e-68, Method: Composition-based stats. Identities = 145/350 (41%), Positives = 204/350 (58%), Gaps = 3/350 (0%) Query 4 AKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARS 63 KIE IKF+ K+G EI D L VY D A + V +W F+ GR+ +ED++R Sbjct 2 GKIEYHAVIKFLTKVGKNAKEIHDRLVAVYNDTASSYATVTRWHKEFRHGRESLEDDSRV 61 Query 64 GRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVP 123 GR + E+ ++ V A+I E+RR+ E I+ IS GS TI+ L +SK+S RWVP Sbjct 62 GRTFEATSEDTVDRVEAMIMENRRVKVEEISLEIRISHGSVCTIINHHLGMSKVSARWVP 121 Query 124 KPLR-PDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRG 182 + L D+LQ + S E+L ++ P F R++TGDETW++ +DPE K +S W +G Sbjct 122 RNLSLHDRLQGQTS-SEELLTLYNAYPAGFKSRVMTGDETWVHHWDPETKLESMAWKQKG 180 Query 183 GSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP 242 P+K K+MAT+FWDA G+LLVD L TIT YY VL +L ++ +KR Sbjct 181 SPTPLKFWTQPLAGKIMATIFWDAGGVLLVDVLPRGSTITGKYYAGVLGRLRDSIRQKRR 240 Query 243 GKLHQRV-LLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLK 301 GKL + V LL HDNAP H +H +A LR+ +E HP YSPDLAP+D+FLF LK SL+ Sbjct 241 GKLTRGVLLLLHDNAPVHKAHHAQAALRDCGFEQFNHPSYSPDLAPNDYFLFRQLKSSLR 300 Query 302 GTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 G F + VK+ + WL Q F+ G+ ++ + + G Y+EK Sbjct 301 GRRFDDNDEVKEAVMMWLEEQLESFWLAGIQSPSRQVVQMYSIKGNYIEK 350 >emb|CAD45369.1| transposase [Bythograea thermydron] Length=349 Score = 254 bits (648), Expect = 8e-66, Method: Composition-based stats. Identities = 144/348 (41%), Positives = 202/348 (58%), Gaps = 2/348 (0%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 KIE R IKF+ K G EI D L +Y D AP + V +W + GR+ +ED+ R G Sbjct 3 KIEYRAVIKFLTKEGKNAKEIHDRLVAMYNDTAPSYTTVTRWHKEVRHGRESLEDDPRVG 62 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS + E+ ++ V A+I E+RR+ E I+ IS GS TI+ L +SK+S RWVP+ Sbjct 63 RPSKATSEDNVDRVEAMIMENRRVKVEEISLEIGISHGSVCTIIHHHLGMSKVSARWVPR 122 Query 125 -PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGG 183 P D+ Q R +S E+L ++ DP F R+VTGDE W++ +DP+ K +S W +G Sbjct 123 NPSLHDRFQRRT-ISEELLTFYNADPAGFESRVVTGDEAWVHHWDPKAKLESMAWKHKGF 181 Query 184 SGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPG 243 P+K S K+M T+FWD +G+L VDFL TIT YY VL +L ++ +KR G Sbjct 182 PTPLKFWTQSSAGKIMDTIFWDTKGVLPVDFLLHGSTITREYYAGVLGRLRDSIRQKRRG 241 Query 244 KLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 KL + VLL HDNAP H + + RA L + + + H PYSP LAP D FLF LK S G Sbjct 242 KLTRGVLLLHDNAPVHRARRARAALSDSGFGPLNHSPYSPALAPRDSFLFRPLKSSFWGR 301 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 F + VK+ + WL +Q F+ G + + KC+++ G Y+EK Sbjct 302 RFDDDDEVKEAVMMWLGAQSESFWMAGNQTLHDKWFKCIQVKGHYIEK 349 >gb|AAC46945.1| mariner transposase [Chrysoperla plorabunda] Length=348 Score = 253 bits (646), Expect = 1e-65, Method: Composition-based stats. Identities = 137/346 (39%), Positives = 190/346 (54%), Gaps = 0/346 (0%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K E R IK+ G E L + D+AP KS + W +FK+G ED RSG Sbjct 3 KKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWYAKFKRGEMSTEDGERSG 62 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RP + +E I + +I DR++ IA IS I+ + L + KL +WVP+ Sbjct 63 RPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGHIIHQYLDMRKLCAKWVPR 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L DQ Q R + S L ++ FLRR VT DETWL+ Y PE K QS +W G Sbjct 123 ELTFDQKQQRVDDSERCLQLLTRNTPEFLRRYVTMDETWLHHYTPESKRQSAEWTATGEP 182 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 P + K S KVMA+VFWDA GI+ +D+LE +TI S YY ++L +L +A KRP Sbjct 183 SPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSDYYMALLERLKVEIAAKRPHM 242 Query 245 LHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTH 304 ++VL H DNAP H S +T A + E +E++ HPPYSPDLAPSDFFLF +LK+ L G Sbjct 243 KKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSPDLAPSDFFLFSDLKRMLAGKK 302 Query 305 FSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F V + ++ +++++G+ R +C+ L+G YVE Sbjct 303 FGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCIALEGNYVE 348 >gb|AAC46946.1| mariner transposase [Chrysoperla plorabunda] Length=348 Score = 251 bits (640), Expect = 6e-65, Method: Composition-based stats. Identities = 135/346 (39%), Positives = 189/346 (54%), Gaps = 0/346 (0%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K E R IK+ G E L + D+AP KS + W +FK+G ED RSG Sbjct 3 KKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWYAKFKRGEMSTEDGERSG 62 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RP + +E I + +I D ++ IA IS I+ + L + KL +WVP+ Sbjct 63 RPKEVVTDENIKKIHKMILNDCKMKLIEIAEALKISKERVGHIIHQYLDMRKLCAKWVPR 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L DQ Q R + S L ++ FLRR VT DETWL+ Y PE QS +W G Sbjct 123 ELTFDQKQQRVDDSERCLQLLTRNTPEFLRRYVTMDETWLHHYTPESNRQSAEWTATGEP 182 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 P + K S KVMA+VFWDA GI+ +D+LE +TI S YY ++L +L +A KRP Sbjct 183 SPKRGKTQKSDCKVMASVFWDAHGIIFIDYLEKGKTINSDYYMALLERLKVEIAAKRPHM 242 Query 245 LHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTH 304 ++VL H DNAP H S +T A + E +E++ HPPYSPDLAPSDFFLF +LK+ L G Sbjct 243 KKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSPDLAPSDFFLFSDLKRMLAGKK 302 Query 305 FSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + V + ++ +++++G+ R +C+ L+G YVE Sbjct 303 FGCIEEVIVETEAYFEAKPKEYYQNGIKKLEGRYNRCIALEGNYVE 348 >gb|AAC46948.1| mariner transposase [Chrysoperla plorabunda] Length=348 Score = 251 bits (640), Expect = 6e-65, Method: Composition-based stats. Identities = 136/346 (39%), Positives = 189/346 (54%), Gaps = 0/346 (0%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K E R IK+ G E L + D+AP KS + W +FK+G ED RSG Sbjct 3 KKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWYAKFKRGEMSTEDGERSG 62 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RP + +E I + +I DR++ IA IS I+ + L + KL +WVP+ Sbjct 63 RPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGHIIHQYLDMRKLCAKWVPR 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L DQ Q R + S L ++ FLRR VT DETWL+ Y PE QS +W G Sbjct 123 ELTFDQKQQRVDDSERCLQLLTRNTPEFLRRYVTMDETWLHHYTPEFNRQSAEWTATGEP 182 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 P + K S KVMA+VFWDA GI+ +D+LE +TI S YY ++L +L +A KRP Sbjct 183 SPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSDYYMALLERLKVEIAAKRPHM 242 Query 245 LHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTH 304 ++VL H DNAP H S +T A + E +E++ HPPYSPDLAPSDFFLF +LK+ L G Sbjct 243 KKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSPDLAPSDFFLFSDLKRMLAGKK 302 Query 305 FSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F V + ++ +++++G+ R +C+ L+G YVE Sbjct 303 FGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCIALEGNYVE 348 >gb|AAU04866.1| mariner transposase [Mariner transposase delivery vector pFA545] gb|ABB59013.1| transposase [Himar1-delivery and mutagenesis vector pFNLTP16 H3] Length=348 Score = 250 bits (639), Expect = 8e-65, Method: Composition-based stats. Identities = 135/346 (39%), Positives = 188/346 (54%), Gaps = 0/346 (0%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K E R IK+ G E L + D+AP KS + W +FK+G ED RSG Sbjct 3 KKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWYAKFKRGEMSTEDGERSG 62 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RP + +E I + +I DR++ IA IS I+ + L + KL +WVP+ Sbjct 63 RPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGHIIHQYLDMRKLCAKWVPR 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L DQ Q R + S L ++ F RR VT DETWL+ Y PE QS +W G Sbjct 123 ELTFDQKQQRVDDSERCLQLLTRNTPEFFRRYVTMDETWLHHYTPESNRQSAEWTATGEP 182 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 P + K S KVMA+VFWDA GI+ +D+LE +TI S YY ++L +L +A KRP Sbjct 183 SPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSDYYMALLERLKVEIAAKRPHM 242 Query 245 LHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTH 304 ++VL H DNAP H S +T A + E +E++ HPPYSPDLAPSDFFLF +LK+ L G Sbjct 243 KKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSPDLAPSDFFLFSDLKRMLAGKK 302 Query 305 FSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F V + ++ +++++G+ R +C+ L+G YVE Sbjct 303 FGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCIALEGNYVE 348 >gb|AAA28265.1| mariner transposase gb|AAC46947.1| mariner transposase [Chrysoperla plorabunda] Length=348 Score = 250 bits (639), Expect = 8e-65, Method: Composition-based stats. Identities = 136/346 (39%), Positives = 190/346 (54%), Gaps = 0/346 (0%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K E R IK+ G E L + D+AP KS + W +FK+G ED RSG Sbjct 3 KKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWYAKFKRGEMSTEDGERSG 62 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RP + +E I + +I DR++ IA IS I+ + L + KL +WVP+ Sbjct 63 RPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGHIIHQYLDMRKLCAKWVPR 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L DQ Q R + S L ++ FLRR VT DETWL+ Y PE K QS +W G Sbjct 123 ELTFDQKQQRVDDSERCLQLLTRNTPEFLRRYVTMDETWLHHYTPESKRQSAEWTATGEP 182 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 P + K S KVMA+VF+DA GI+ +D+LE +TI S YY ++L +L +A KRP Sbjct 183 SPKRGKTQKSAGKVMASVFFDAHGIIFIDYLEKGKTINSDYYMALLERLKVEIAAKRPHM 242 Query 245 LHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTH 304 ++VL H DNAP H S +T A + E +E++ HPPYSPDLAPSDFFLF +LK+ L G Sbjct 243 KKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSPDLAPSDFFLFSDLKRMLAGKK 302 Query 305 FSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F V + ++ +++++G+ R +C+ L+G YVE Sbjct 303 FGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCIALEGNYVE 348 >gb|AAM82289.1| mariner transposase C9 mutant [Transposon delivery vector pSC189] gb|ABN54776.1| Tnp [Expression vector pBT20-Dbla-T7pol] Length=348 Score = 250 bits (638), Expect = 9e-65, Method: Composition-based stats. Identities = 135/346 (39%), Positives = 188/346 (54%), Gaps = 0/346 (0%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K E R IK+ G E L + D+AP KS + W +FK+G ED RSG Sbjct 3 KKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWYAKFKRGEMSTEDGERSG 62 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RP + +E I + +I DR++ IA IS I+ + L + KL +WVP+ Sbjct 63 RPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGHIIHQYLDMRKLCAKWVPR 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L DQ Q R + S L ++ F RR VT DETWL+ Y PE QS +W G Sbjct 123 ELTFDQKQRRVDDSKRCLQLLTRNTPEFFRRYVTMDETWLHHYTPESNRQSAEWTATGEP 182 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 P + K S KVMA+VFWDA GI+ +D+LE +TI S YY ++L +L +A KRP Sbjct 183 SPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSDYYMALLERLKVEIAAKRPHM 242 Query 245 LHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTH 304 ++VL H DNAP H S +T A + E +E++ HPPYSPDLAPSDFFLF +LK+ L G Sbjct 243 KKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSPDLAPSDFFLFSDLKRMLAGKK 302 Query 305 FSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F V + ++ +++++G+ R +C+ L+G YVE Sbjct 303 FGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCIALEGNYVE 348 >gb|AAT79489.1| mariner transposase C9 mutant [Mutagenesis vector pCAM45] Length=348 Score = 249 bits (636), Expect = 2e-64, Method: Composition-based stats. Identities = 134/346 (38%), Positives = 188/346 (54%), Gaps = 0/346 (0%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K E R IK+ G E L + D+AP KS + W +FK+G ED RSG Sbjct 3 KKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWYAKFKRGEMSTEDGERSG 62 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RP + +E I + +I DR++ IA IS I+ + L + KL +WVP+ Sbjct 63 RPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGHIIHQYLDMRKLCAKWVPR 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L DQ Q R + S L ++ F RR VT DETWL+ Y PE QS +W G Sbjct 123 ELTFDQKQRRVDDSKRCLQLLTRNTPEFFRRYVTMDETWLHHYTPESNRQSAEWTATGEP 182 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 P + K S KVMA+VFWDA GI+ +D+LE +TI S YY ++L +L +A KRP Sbjct 183 SPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSDYYMALLERLKVEIAAKRPHM 242 Query 245 LHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTH 304 ++VL H DNAP H S +T A + E +E++ HPPYSPDLAPSDFFLF ++K+ L G Sbjct 243 KKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSPDLAPSDFFLFSDIKRMLAGKK 302 Query 305 FSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F V + ++ +++++G+ R +C+ L+G YVE Sbjct 303 FGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCIALEGNYVE 348 >gb|ABF51498.1| UniGene info mariner transposase [Bombyx mori] Length=350 Score = 240 bits (613), Expect = 9e-62, Method: Composition-based stats. Identities = 123/351 (35%), Positives = 191/351 (54%), Gaps = 2/351 (0%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + +R I + + G + D + +GD AP K+ +Y+W F++GR + D+ Sbjct 1 MELTRENSRAMIYYDFRSGLTQKQCVDRMISAFGDEAPSKTTIYRWFAEFQRGRVKLSDD 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 R GRP T++ +E ++ VR LIEEDR +T I T DI + IL E+L + KL +R Sbjct 61 PRQGRPKTAVTQENVDAVRKLIEEDRHVTYREIQATLDIGMSQIQIILHEQLGVKKLFSR 120 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 W+P L +Q R + L ++ + IV+GDE+W+Y Y+PE K QS+ W+ Sbjct 121 WIPHSLCEEQKAARVTWCVRTLERFHAGSSNAVYNIVSGDESWIYAYEPETKNQSRVWVF 180 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 P K S AK M F G + LEGQRT+ + +Y S+ L + ++E Sbjct 181 ENELKPTKIVRSRSVAKKMVATFVSKTGHVTTIPLEGQRTVNAEWYASIC--LPQVVSEL 238 Query 241 RPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSL 300 R ++R++LHHDNA +H++H+T+ L + E++ HPPYSPDL+P+DF+ FP +K L Sbjct 239 RKENCNRRIILHHDNASSHTAHRTKEFLEQENIELLDHPPYSPDLSPNDFYTFPKIKNKL 298 Query 301 KGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 +G FSS T + + N W+HR++KC++ G Y EK Sbjct 299 RGQRFSSPEEAVDAYKTAILETPTSEWNGCFNDWFHRMEKCVKFRGEYFEK 349 >gb|ABA55502.1| transposase [Heliothis virescens] Length=354 Score = 213 bits (542), Expect = 1e-53, Method: Composition-based stats. Identities = 119/329 (36%), Positives = 173/329 (52%), Gaps = 1/329 (0%) Query 24 EITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRPSTSICEEKINLVRALIE 83 E ++ V G+ P ++ VY+W F++G +V D ARSGRP + E + V L++ Sbjct 25 ECVSEMKTVLGEKCPHRTTVYRWYREFERGNFNVNDAARSGRPVEATSSENVAKVEKLLK 84 Query 84 EDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKPLRPDQLQTRAELSMEILN 143 EDRR+T I IS S + IL + L++ K+ T WVP L+P+Q TR + ++L Sbjct 85 EDRRITYSQIEEALQISAPSVHKILHDILRVKKVCTLWVPHDLKPEQKDTRVKWCKKMLQ 144 Query 144 KWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGPVKAKADWSRAKVMATVF 203 ++ + IVTGDETWLY +D K ++K WL PV+ + S K M VF Sbjct 145 MYENGTSNNINNIVTGDETWLYYFDLPSKNKNKVWLFENEQTPVQVRKSRSVKKKMIAVF 204 Query 204 WDAQGILLVDFLEGQRTITSAYY-ESVLRKLAKALAEKRPGKLHQRVLLHHDNAPAHSSH 262 + +GIL LE QRT+T+++Y L K+ + L E RP HHDNAPAH + Sbjct 205 FTRRGILERVLLESQRTVTASWYINECLPKVFQRLQEIRPNSRMDTPHFHHDNAPAHRAR 264 Query 263 QTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTHFSSVNNVKKTALTWLNSQ 322 T L ++ HP YSPDLAP DF LFP +K LKG F + + Sbjct 265 DTVEFLNSSGVRVLDHPAYSPDLAPCDFALFPIIKDQLKGRKFQIEVELLSAWDQACSEL 324 Query 323 DPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 + ++D N W+ R+ KC+ +G Y E+ Sbjct 325 SEEKWKDIFNDWFLRMTKCINCNGNYFER 353 >emb|CAH03740.1| transposase [Messor bouvieri] Length=345 Score = 198 bits (503), Expect = 4e-49, Method: Composition-based stats. Identities = 118/347 (34%), Positives = 188/347 (54%), Gaps = 12/347 (3%) Query 6 IEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGR 65 + R + F+ + E L + YG++AP W +FK G +V+D+ R GR Sbjct 9 VHLRHALLFLFHQKKRAAESHRLLVETYGEHAPTIRTCETWFRQFKCGDFNVQDKERPGR 68 Query 66 PSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKP 125 P T E ++ L++ED T + +A ++S + L K+ K+ RWVP Sbjct 69 PKTFEDAE----LQELLDEDSTQTQKQLAEKLNVSRVAICERLQAMGKIQKMG-RWVPHE 123 Query 126 LRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSG 185 L Q++ R +S +L ++++ ++FL RIVTGDE W+Y +P+ K K WL G +G Sbjct 124 LNDRQMENRKIVSEMLLQRYER--KSFLHRIVTGDEKWIYFENPKRK---KSWLSPGEAG 178 Query 186 PVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP--G 243 P A+ + K M V+WD G++ + L+ T+ + Y + L AL EKRP Sbjct 179 PSTARPNRFGRKTMLCVWWDQIGVVYYELLKPGETVNTDRYRQQMINLNCALIEKRPQYA 238 Query 244 KLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 + H +V+L HDNAP+H++ + +L+ WE++ HPPYSPDLAPSD+ LF ++ +L Sbjct 239 QRHDKVILQHDNAPSHTAKPVKEMLKSLGWEVLSHPPYSPDLAPSDYHLFASMGHALAEQ 298 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 HF+ VKK W +S++ FF +G++ R KC+E +G Y E Sbjct 299 HFADFEEVKKWLDEWFSSKEKLFFWNGIHKLSERWTKCIESNGQYFE 345 >emb|CAH03742.1| transposase [Messor bouvieri] Length=345 Score = 197 bits (500), Expect = 1e-48, Method: Composition-based stats. Identities = 118/347 (34%), Positives = 187/347 (53%), Gaps = 12/347 (3%) Query 6 IEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGR 65 + R + F+ K E L + YG++AP W +FK G +V+D+ R GR Sbjct 9 VHLRHALLFLFHQKKKAAESHRLLVETYGEHAPTIRTCETWFRQFKCGDFNVQDKERPGR 68 Query 66 PSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKP 125 P T E ++ L++ED T + +A ++S + L K+ K+ RWVP Sbjct 69 PKTFEDAE----LQELLDEDSTQTQKQLAEKLNVSRVAICERLQAMGKIQKMG-RWVPHE 123 Query 126 LRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSG 185 L Q++ R +S +L ++++ ++FL RIVTG E W+Y +P+ K K WL G +G Sbjct 124 LNDRQMENRKIVSEMLLQRYER--KSFLHRIVTGGEKWIYFENPKRK---KSWLSPGEAG 178 Query 186 PVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP--G 243 P A+ + K M V+WD G++ + L+ T+ + Y + L AL EKRP Sbjct 179 PSTARPNRFGRKTMLCVWWDQIGVVYYELLKPGETVNTDRYRQQMINLNCALIEKRPQYA 238 Query 244 KLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 + H +V+L HDNAP+H++ + +L+ WE++ HPPYSPDLAPSD+ LF ++ +L Sbjct 239 QRHDKVILQHDNAPSHTAKPVKEMLKSLGWEVLSHPPYSPDLAPSDYHLFASMGHALAEQ 298 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 HF+ VKK W +S++ FF +G++ R KC+E +G Y E Sbjct 299 HFADFEEVKKWLDEWFSSKEKLFFWNGIHKLSERWTKCIESNGQYFE 345 >emb|CAH03741.1| transposase [Messor bouvieri] Length=345 Score = 193 bits (490), Expect = 1e-47, Method: Composition-based stats. Identities = 117/347 (33%), Positives = 186/347 (53%), Gaps = 12/347 (3%) Query 6 IEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGR 65 + R + F+ K E L + YG++AP W +FK G +V+D+ R GR Sbjct 9 VHLRHALLFLFHQKKKAAESHRLLVETYGEHAPTIRTCETWFRQFKCGDFNVQDKERPGR 68 Query 66 PSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKP 125 T E ++ L++ED T + +A ++S + L K+ K+ RWVP Sbjct 69 LKTFEDAE----LQELLDEDSTQTQKQLAEKLNVSRVAICERLQAMGKIQKMG-RWVPHE 123 Query 126 LRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSG 185 L Q++ R +S +L ++++ ++FL RIVTGD W+Y +P+ K K WL G +G Sbjct 124 LNDRQMENRKIVSEMLLQRYER--KSFLHRIVTGDGKWIYFENPKRK---KSWLSPGEAG 178 Query 186 PVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP--G 243 P A+ + K M V+WD G++ + L+ T+ + Y + L AL EKRP Sbjct 179 PSTARPNRFGRKTMLCVWWDQIGVVYYELLKPGETVNTDRYRQQMINLNCALIEKRPQYA 238 Query 244 KLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 + H +V+L HDNAP+H++ + +L+ WE++ HPPYSPDLAPSD+ LF ++ +L Sbjct 239 QRHDKVILQHDNAPSHTAKPVKEMLKSLGWEVLSHPPYSPDLAPSDYHLFASMGHALAEQ 298 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 HF+ VKK W +S++ FF +G++ R KC+E +G Y E Sbjct 299 HFADFEEVKKWLDEWFSSKEKLFFWNGIHKLSERWTKCIESNGQYFE 345 >emb|CAH03739.1| transposase [Messor bouvieri] Length=345 Score = 193 bits (490), Expect = 2e-47, Method: Composition-based stats. Identities = 117/347 (33%), Positives = 186/347 (53%), Gaps = 12/347 (3%) Query 6 IEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGR 65 + R + F+ K E L + YG++AP W +FK G +V+D+ R GR Sbjct 9 VHLRHALLFLFHQKKKAAESHRLLVETYGEHAPTIRTCETWFRQFKCGDFNVQDKERPGR 68 Query 66 PSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKP 125 T E ++ L++ED T + +A ++S + L K+ K+ RWVP Sbjct 69 LKTFEDAE----LQELLDEDSTQTQKQLAEKLNVSRVAICERLQAMGKIQKMG-RWVPHE 123 Query 126 LRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSG 185 L Q++ R +S +L ++++ ++FL RIVTGDE W+Y +P+ K K WL G +G Sbjct 124 LNDRQMENRKIVSEMLLQRYER--KSFLHRIVTGDEKWIYFENPKRK---KSWLSPGEAG 178 Query 186 PVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP--G 243 P A+ + K M V+WD G++ + L+ T+ + Y + L AL EKRP Sbjct 179 PSTARPNRFGRKTMLCVWWDQIGVVYYELLKPGETVNTDRYRQQMINLNCALIEKRPQYA 238 Query 244 KLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 + H +V+L HDNAP+H++ + +L+ WE++ HPPYSPDLAPSD+ LF ++ +L Sbjct 239 QRHDKVILQHDNAPSHTAKPVKEMLKSLGWEVLSHPPYSPDLAPSDYHLFASMGHALAEQ 298 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 HF+ VKK W +S++ FF +G++ KC+E +G Y E Sbjct 299 HFADFEEVKKWLDEWFSSKEKLFFWNGIHKLSEGWTKCIESNGQYFE 345 >gb|AAA66077.1| transposase [Mayetiola destructor] Length=347 Score = 192 bits (488), Expect = 2e-47, Method: Composition-based stats. Identities = 118/327 (36%), Positives = 184/327 (56%), Gaps = 18/327 (5%) Query 29 LRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRPSTSICEEKINLVRALIEEDRRL 88 L +VYG++A K+ ++W RFK G D ED+ R G+P EE + AL++ED Sbjct 34 LVEVYGEHALAKTQCFEWFQRFKSGDFDTEDKERPGQPKKFEDEE----LEALLDEDCCQ 89 Query 89 TAETIANTTDISIGSAYTILTEKLKLS---KLSTRWVPKPLRPDQLQTRAELSMEILNKW 145 T E +A S+G ++++LK + + WVP L+P ++ R +S +L + Sbjct 90 TQEELAK----SLGVTQQAISKRLKAAGYIQKQGNWVPHELKPRDVERRFCMSEMLLQR- 144 Query 146 DQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGPVKAKADWSRAKVMATVFWD 205 ++FL RI+TGDE W++ YD + + K ++ RGG K++ AKVM ++WD Sbjct 145 -HKKKSFLSRIITGDEKWIH-YD--NSKRKKSYVKRGGRAKSTPKSNLHGAKVMLCIWWD 200 Query 206 AQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP--GKLHQRVLLHHDNAPAHSSHQ 263 +G+L + LE +TIT Y + L +L +ALAEKRP K H V+ HHDNA H + Sbjct 201 QRGVLYYELLEPGQTITGDLYRTQLIRLKQALAEKRPEYAKRHGAVIFHHDNARPHVALP 260 Query 264 TRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTHFSSVNNVKKTALTWLNSQD 323 + L WE++ HPPYSPDLAPSD+ LF +++ L G F+S ++K ++L ++ Sbjct 261 VKNYLENSGWEVLPHPPYSPDLAPSDYHLFRSMQNDLAGKRFTSEQGIRKWLDSFLAAKP 320 Query 324 PQFFRDGLNGWYHRLQKCLELDGAYVE 350 +FF G++ R +K + DG Y E Sbjct 321 AKFFEKGIHELSERWEKVIASDGQYFE 347 >gb|AAO12862.1| Camar1 transposase [Chymomyza amoena] Length=342 Score = 191 bits (486), Expect = 4e-47, Method: Composition-based stats. Identities = 122/350 (34%), Positives = 182/350 (52%), Gaps = 11/350 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M S K R + + + G ++ LR VYGD A K+ W +F+ G ++DE Sbjct 1 MESTKEHFRHILYYYFRKGKNAEQVAKKLRDVYGDKALKERQCQNWFRKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP+ E + ++ALIE DR +T I +I + + + + L L K Sbjct 61 PRSGRPN----EVDDDQIKALIELDRHVTEREIGEKLNIPKSTVHYHI-KSLGLVKKLDI 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R L + + DP FL+RI+TGDE W+ + K + W Sbjct 116 WVPHELKEIHLTNRINACDMHLKRNEFDP--FLKRIITGDEKWIVYNNVNRK---RSWSK 170 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +KAD + KVM +V+WD +G++ + L +TI S Y L KL A+ EK Sbjct 171 HGEPAQTTSKADIHQKKVMLSVWWDWKGVVYFELLPRNQTINSDVYCQQLDKLNAAINEK 230 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 RP ++++ V+ H DNA H+S TR LRE WE++ HPPYSPDLAPSD+ LF +L+ S Sbjct 231 RPELINRKGVIFHQDNARPHTSLMTRQKLRELGWEVLMHPPYSPDLAPSDYHLFRSLQNS 290 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L G F + +K + + + +F+ G+ R QK +E +G Y+ Sbjct 291 LNGKTFGNDEAIKSHLVQFFADKGQKFYERGIQNLPGRWQKVIEQNGNYI 340 >gb|AAO12864.1| Ccmar2 transposase [Ceratitis capitata] Length=342 Score = 189 bits (479), Expect = 3e-46, Method: Composition-based stats. Identities = 121/350 (34%), Positives = 189/350 (54%), Gaps = 11/350 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F + G + L VYGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFRKGKTASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E L++A+I+ DR T IA +S L + + KL T Sbjct 61 KRSGRP----VEVDDALIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDT- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R S ++L K +++ + FL+R++TGDE W+ + + K + W Sbjct 116 WVPHELKETHLTQRIN-SCDLLKKRNEN-DPFLKRLITGDEKWVVYNNIKRK---RSWSR 170 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +KAD + KV+ +V+WD +GI+ + L RTI S Y L KL A+ EK Sbjct 171 PGEPTQTTSKADIHQKKVLLSVWWDYKGIVYFELLPPNRTINSDVYIEQLTKLNNAVEEK 230 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 RP +++ ++ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF +L+ S Sbjct 231 RPELTNRKSIVFHHDNARPHTSLATRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNS 290 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L G +F++ ++VK + + +++ +F+ G+ R QK ++ +G Y+ Sbjct 291 LNGKNFNNDDDVKSYLIQFFANKNQKFYERGIMMLPERWQKIIDQNGQYI 340 >gb|AAP51091.1| transposase [Forficula auricularia] Length=342 Score = 187 bits (475), Expect = 7e-46, Method: Composition-based stats. Identities = 118/350 (33%), Positives = 185/350 (52%), Gaps = 11/350 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F + G + L +YGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFRKGKNASQAHKKLCAIYGDEAFKERQCQNWFAKFRSGGFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E +L++A+I+ DR T IA +S L + + KL T Sbjct 61 KRSGRP----VEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDT- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R + + + + DP FL+R++TGDE W+ + + K + W Sbjct 116 WVPHELKETHLTQRINICDLLKKRNENDP--FLKRLITGDEKWVVYNNIKRK---RSWSR 170 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +KA + KV+ +V+WD +GI+ + L RTI S Y L KL A+ EK Sbjct 171 PGEPAQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEK 230 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 R +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF +L+ S Sbjct 231 RAELTNRKGVVFHHDNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNS 290 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L G +F++ ++VK + + +++ +F+ G+ R QK ++ +G Y+ Sbjct 291 LNGKNFNNDDDVKSYLIQFFANKNQKFYERGIMMLPERWQKVIDHNGQYI 340 >gb|AAP51087.1| transposase [Forficula auricularia] Length=342 Score = 187 bits (475), Expect = 9e-46, Method: Composition-based stats. Identities = 119/350 (34%), Positives = 184/350 (52%), Gaps = 11/350 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F G + L VYGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFLKGKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E +L++A+I+ DR T IA +S L + + KL T Sbjct 61 KRSGRP----VEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDT- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R + + + + DP FL+R++TGDE W+ + + K + W Sbjct 116 WVPHELKETHLTQRINICDLLKKRNENDP--FLKRLITGDEKWVVYNNIKRK---RSWSR 170 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +KA + KV+ +V+WD +GI+ + L RTI S Y L KL A+ EK Sbjct 171 PGEPAQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEK 230 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 R +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF +L+ S Sbjct 231 RAELTNRKGVVFHHDNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNS 290 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L G +F++ ++VK + + +++ +F+ G+ R QK ++ +G Y+ Sbjct 291 LNGKNFNNDDDVKSYLIQFFANKNQKFYERGIMMLLERWQKVIDQNGQYI 340 >gb|AAP51098.1| transposase [Forficula auricularia] gb|AAP51099.1| transposase [Forficula auricularia] gb|AAP51100.1| transposase [Forficula auricularia] Length=342 Score = 186 bits (473), Expect = 1e-45, Method: Composition-based stats. Identities = 119/350 (34%), Positives = 185/350 (52%), Gaps = 11/350 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F + G + L VYGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFRKGKNASQSHKRLCAVYGDEALKERQCQNWFAKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E +L++A+I+ DR T IA +S L + + KL T Sbjct 61 KRSGRP----VEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDT- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R + + + + DP FL+R++TGDE W+ + + K + W Sbjct 116 WVPHELKETHLTQRINICDLLKKRNENDP--FLKRLITGDEKWVVYNNIKRK---RSWGR 170 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +KA + KV+ +V+WD +GI+ + L RTI S Y L KL A+ EK Sbjct 171 PGEPAQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEK 230 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 R +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF +L+ S Sbjct 231 RAELTNRKGVVFHHDNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNS 290 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L G +F++ ++VK + + +++ +F+ G+ R QK ++ +G Y+ Sbjct 291 LNGKNFNNDDDVKSYLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQYI 340 >gb|AAP51082.1| transposase [Forficula auricularia] Length=342 Score = 186 bits (473), Expect = 1e-45, Method: Composition-based stats. Identities = 121/354 (34%), Positives = 189/354 (53%), Gaps = 19/354 (5%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F G + L VYGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFLKGKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLK----LSK 116 RSGRP E +L++A+I+ DR T IA +S +T + +K + K Sbjct 61 KRSGRP----VEVDDDLIKAIIDSDRHSTTREIAEKLHVS----HTCIENHIKHLGYVQK 112 Query 117 LSTRWVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSK 176 L T WVP L+ L R + + + + DP FL+R++TGDE W+ + + K + Sbjct 113 LDT-WVPHELKETHLAQRINICDLLKKRNENDP--FLKRLITGDEKWVVYNNIKRK---R 166 Query 177 QWLPRGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKA 236 W G +KA + KV+ +V+WD +GI+ + L RTI SA Y L KL A Sbjct 167 SWSRPGEPAQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSAVYIEQLTKLNNA 226 Query 237 LAEKRPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPN 295 + EKR +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF + Sbjct 227 VEEKRAELTNRKGVVFHHDNARPHTSLVTRQKLLELDWDVLPHPPYSPDLAPSDYFLFRS 286 Query 296 LKKSLKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L+ SL G +F++ ++VK + + ++++ +F+ G+ R QK ++ +G Y+ Sbjct 287 LQNSLNGKNFNNDDDVKLYLIQFFDNKNQKFYERGIMMLPERWQKVIDQNGQYI 340 >gb|AAP51093.1| transposase [Forficula auricularia] Length=342 Score = 186 bits (473), Expect = 1e-45, Method: Composition-based stats. Identities = 119/350 (34%), Positives = 185/350 (52%), Gaps = 11/350 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F + G + L VYGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFRKGKNASQAHKKLCAVYGDEAFKERQCQNWFAKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E +L++A+I+ DR T IA +S L + + KL T Sbjct 61 KRSGRP----VEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDT- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R + + + + DP FL+R++TGDE W+ + + K + W Sbjct 116 WVPHELKETHLTQRINICDLLKKRNENDP--FLKRLITGDEKWVVYNNIKRK---RSWSR 170 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +KA + KV+ +V+WD +GI+ + L RTI S Y L KL A+ EK Sbjct 171 PGEPAQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEK 230 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 R +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF +L+ S Sbjct 231 RAELTNRKGVVFHHDNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNS 290 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L G +F++ ++VK + + +++ +F+ G+ R QK ++ +G Y+ Sbjct 291 LNGKNFNNDDDVKLYLIQFFANKNQKFYERGIMMLPERWQKVIDHNGQYI 340 >gb|AAO12863.1| Famar1 transposase [Forficula auricularia] Length=342 Score = 186 bits (473), Expect = 1e-45, Method: Composition-based stats. Identities = 120/350 (34%), Positives = 188/350 (53%), Gaps = 11/350 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F + G + L VYGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFRKGKNASQAHKKLCAVYGDEAFKERQCQNWFAKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E +L++A+I+ DR T IA +S L + + KL T Sbjct 61 KRSGRP----VEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDT- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R S ++L K +++ + FL+R++TGDE W+ + + K + W Sbjct 116 WVPHELKETHLTQRIN-SCDLLKKRNEN-DPFLKRLITGDEKWVVYNNIKRK---RSWSR 170 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +KA + KV+ +V+WD +GI+ + L RTI S Y L KL A+ EK Sbjct 171 PGEPAQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEK 230 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 R +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF +L+ S Sbjct 231 RAELTNRKGVVFHHDNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNS 290 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L G +F++ ++VK + + +++ +F+ G+ R QK ++ +G Y+ Sbjct 291 LNGKNFNNDDDVKSYLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQYI 340 >gb|AAP51083.1| transposase [Forficula auricularia] Length=342 Score = 186 bits (472), Expect = 2e-45, Method: Composition-based stats. Identities = 119/350 (34%), Positives = 185/350 (52%), Gaps = 11/350 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F + G + L VYGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFRKGTNALQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E +L++A+I+ DR T IA +S L + + KL T Sbjct 61 KRSGRP----VEVNDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDT- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R + + + + DP FL+R++TGDE W+ + + K + W Sbjct 116 WVPHELKETHLTQRINICDLLKKRNENDP--FLKRLITGDEKWVVYNNIKRK---RSWSR 170 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +KA + KV+ +V+WD +GI+ + L RTI S Y L KL A+ EK Sbjct 171 PGEPAQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSVDYIEQLTKLNNAVEEK 230 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 R +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF +L+ S Sbjct 231 RAELTNRKGVVFHHDNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNS 290 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L G +F++ ++VK + + +++ +F+ G+ R QK ++ +G Y+ Sbjct 291 LNGKNFNNDDDVKSYLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQYI 340 >gb|AAP51092.1| transposase [Forficula auricularia] Length=342 Score = 186 bits (471), Expect = 2e-45, Method: Composition-based stats. Identities = 120/354 (33%), Positives = 187/354 (52%), Gaps = 19/354 (5%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F + G + L VYGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFRKGKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLK----LSK 116 RSGRP E +L++A+I+ DR T IA +S +T + +K + K Sbjct 61 KRSGRP----VEVDDDLIKAIIDSDRHSTTREIAEKLHVS----HTCIENHIKHLGYVQK 112 Query 117 LSTRWVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSK 176 L T WVP L+ L R + + + + DP FL+R++TGDE W+ + + K + Sbjct 113 LDT-WVPHELKETHLTQRINICDLLKKRNENDP--FLKRLITGDEKWVVYNNIKRK---R 166 Query 177 QWLPRGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKA 236 W G +KA + KV+ +V+WD +GI+ + L RTI S Y L KL A Sbjct 167 SWSRPGEPAQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNA 226 Query 237 LAEKRPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPN 295 + EKR +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF Sbjct 227 VEEKRAELTNRKGVVFHHDNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRF 286 Query 296 LKKSLKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L+ SL G +F++ ++VK + + +++ +F+ G+ R QK ++ +G Y+ Sbjct 287 LQNSLNGKNFNNDDDVKSYLIQFFANKNQKFYERGIMMLSERWQKVIDQNGQYI 340 >gb|AAP51089.1| transposase [Forficula auricularia] Length=342 Score = 185 bits (470), Expect = 3e-45, Method: Composition-based stats. Identities = 119/350 (34%), Positives = 189/350 (54%), Gaps = 11/350 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F + G + L VYG+ A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFRKGKNASQAHKKLCAVYGNEAFKERQCQNWFAKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E +L++A+I+ DR T IA +S L + + KL T Sbjct 61 KRSGRP----VEVDDDLIKAIIDSDRHSTTREIAEKPHVSHTCIENHLKQLGYVQKLDT- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R S ++L K +++ + FL+R++TGDE W+ + + K + W Sbjct 116 WVPHELKETHLTQRIN-SCDLLKKRNEN-DPFLKRLITGDEKWVVYNNIKRK---RSWSR 170 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +KA + KV+ +V+WD +GI+ + L RTI S Y L KL A+ EK Sbjct 171 PGEPAQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEK 230 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 R +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF +L+ S Sbjct 231 RAELTNRKGVVFHHDNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNS 290 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L G +F++ ++VK + + +++ +F++ G+ R QK ++ +G Y+ Sbjct 291 LNGKNFNNDDDVKSYLIQFFANKNQKFYKRGIMMLPERWQKVIDQNGQYI 340 >gb|AAP51090.1| transposase [Forficula auricularia] gb|AAP51094.1| transposase [Forficula auricularia] Length=342 Score = 185 bits (470), Expect = 3e-45, Method: Composition-based stats. Identities = 119/350 (34%), Positives = 185/350 (52%), Gaps = 11/350 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F + G + L VYGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFRKGKNASQAHKKLCAVYGDEAFKERQCQNWFAKFRFGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E +L++A+I+ DR T IA +S L + + KL T Sbjct 61 KRSGRP----VEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDT- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R + + + + DP FL+R++TGDE W+ + + K + W Sbjct 116 WVPHELKETHLTRRINICDLLKKRNENDP--FLKRLITGDEKWVVYNNIKRK---RSWSR 170 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +KA + KV+ +V+WD +GI+ + L RTI S Y L KL A+ EK Sbjct 171 PGEPAQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEK 230 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 R +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF +L+ S Sbjct 231 RAELTNRKGVVFHHDNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNS 290 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L G +F++ ++VK + + +++ +F+ G+ R QK ++ +G Y+ Sbjct 291 LNGKNFNNDDDVKLYLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQYI 340 >gb|AAP51096.1| transposase [Forficula auricularia] Length=345 Score = 185 bits (470), Expect = 3e-45, Method: Composition-based stats. Identities = 120/350 (34%), Positives = 187/350 (53%), Gaps = 11/350 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F + G + L VYGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFRKGKNALQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E +L++A+I+ DR T IA +S L + + KL T Sbjct 61 KRSGRP----VEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDT- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R S ++L K +++ + FL+R++TGDE W+ + + K + W Sbjct 116 WVPHELKETHLTQRIN-SCDLLKKRNEN-DPFLKRLITGDEKWVVYNNIKRK---RSWSR 170 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +KA + KV+ +V+WD +GI+ + L RTI S Y L KL A+ EK Sbjct 171 PGEPAQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEK 230 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 R +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF +L+ S Sbjct 231 RAELTNRKGVVFHHDNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNS 290 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L G +F++ ++VK + + ++ +F+ G+ R QK ++ +G Y+ Sbjct 291 LNGKNFNNDDDVKSYLIQFFANKSQKFYERGIMMLPERWQKVIDQNGKYI 340 >gb|AAP51084.1| transposase [Forficula auricularia] Length=342 Score = 185 bits (470), Expect = 3e-45, Method: Composition-based stats. Identities = 120/354 (33%), Positives = 188/354 (53%), Gaps = 19/354 (5%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F G + L VYGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFLKGKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLK----LSK 116 RSGRP E +L++A+I+ DR T IA +S +T + +K + K Sbjct 61 KRSGRP----VEVDDDLIKAIIDSDRHSTTREIAEKLHVS----HTCIENHIKHLGYVQK 112 Query 117 LSTRWVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSK 176 L T WVP L+ L R + + + + DP FL+R++TGDE W+ + + K + Sbjct 113 LDT-WVPHELKETHLTQRINICDLLKKRNENDP--FLKRLITGDEKWVVYNNIKRK---R 166 Query 177 QWLPRGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKA 236 W G +KA + KV+ +V+WD +GI+ + L RTI S Y L KL A Sbjct 167 SWSRPGEPAQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNA 226 Query 237 LAEKRPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPN 295 + EKR +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF + Sbjct 227 VEEKRAELTNRKGVVFHHDNARPHTSLVTRQKLLELDWDVLPHPPYSPDLAPSDYFLFRS 286 Query 296 LKKSLKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L+ SL G +F++ ++VK + + ++++ +F+ G+ R QK ++ +G Y+ Sbjct 287 LQNSLNGKNFNNDDDVKLYLIQFFDNKNQKFYERGIMMLPERWQKVIDQNGQYI 340 >gb|AAP51095.1| transposase [Forficula auricularia] Length=341 Score = 185 bits (469), Expect = 4e-45, Method: Composition-based stats. Identities = 120/350 (34%), Positives = 188/350 (53%), Gaps = 11/350 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F + G + L VYGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFRKGKNALQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E +L++A+I+ DR T IA+ +S L + + KL T Sbjct 61 KRSGRP----VEVDDDLIKAIIDSDRHSTTREIAHKLHVSHTCIENHLKQLGFVQKLDT- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R S ++L K +++ + FL+R++TGDE W+ + + K + W Sbjct 116 WVPHELKETHLTQRIN-SCDLLKKRNEN-DPFLKRLITGDEKWVVYNNIKRK---RSWSR 170 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +KA + KV+ +V+WD +GI+ + L RTI S Y L KL A+ EK Sbjct 171 PGEPAQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEK 230 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 R +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF +L+ S Sbjct 231 RAELTNRKGVVFHHDNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNS 290 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L G +F++ ++VK + + ++ +F+ G+ R QK ++ +G Y+ Sbjct 291 LNGKNFNNDDDVKSYLIQFFANKSQKFYERGIMMLPERWQKVIDQNGKYI 340 >ref|NP_001073580.1| UniGene infoGene info Ammar1 transposase [Apis mellifera] gb|AAO12861.1| Gene info Ammar1 transposase [Apis mellifera] Length=342 Score = 185 bits (469), Expect = 4e-45, Method: Composition-based stats. Identities = 119/350 (34%), Positives = 188/350 (53%), Gaps = 11/350 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F + G + L VYGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHYRHILLFYFRKGKNASQAHKKLCAVYGDEALKERQCQNWFDKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E +L++A+I+ DR T IA +S L + + KL T Sbjct 61 KRSGRP----VEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDT- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R S ++L K +++ + FL+R++TGDE W+ + + K + W Sbjct 116 WVPHELKEKHLTQRIN-SCDLLKKRNEN-DPFLKRLITGDEKWVVYNNIKRK---RSWSR 170 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 +KA R KV+ +V+WD +GI+ + L RTI S Y L KL A+ EK Sbjct 171 PREPAQTTSKAGIHRKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEK 230 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 RP +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF +L+ S Sbjct 231 RPELTNRKGVVFHHDNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNS 290 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L G +F++ +++K + + +++ +F+ G+ R QK ++ +G ++ Sbjct 291 LNGKNFNNDDDIKSYLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQHI 340 >gb|AAP51086.1| transposase [Forficula auricularia] Length=341 Score = 184 bits (468), Expect = 5e-45, Method: Composition-based stats. Identities = 120/350 (34%), Positives = 187/350 (53%), Gaps = 11/350 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F + G + L VYGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFRKGKNALQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E +L++A+I+ DR T IA +S L + + KL T Sbjct 61 KRSGRP----VEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDT- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R S ++L K +++ + FL+R++TGDE W+ + + K + W Sbjct 116 WVPHELKETHLTQRIN-SCDLLKKRNEN-DPFLKRLITGDEKWVVYNNIKRK---RSWSR 170 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +KA + KV+ +V+WD +GI+ + L RTI S Y L KL A+ EK Sbjct 171 PGEPAQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEK 230 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 R +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF +L+ S Sbjct 231 RAELTNRKGVVFHHDNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNS 290 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L G +F++ ++VK + + ++ +F+ G+ R QK ++ +G Y+ Sbjct 291 LNGKNFNNDDDVKSYLIQFFANKSQKFYERGIMMLPERWQKVIDQNGKYI 340 >gb|AAY57408.1| v3 [Mayetiola destructor] Length=347 Score = 184 bits (468), Expect = 6e-45, Method: Composition-based stats. Identities = 116/327 (35%), Positives = 182/327 (55%), Gaps = 18/327 (5%) Query 29 LRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRPSTSICEEKINLVRALIEEDRRL 88 L +VYG++A K+ ++W RFK G D ED+ R G+P EE + AL++ED Sbjct 34 LVEVYGEHALAKTQCFEWFQRFKCGDFDTEDKERPGQPKKFEDEE----LEALLDEDCCQ 89 Query 89 TAETIANTTDISIGSAYTILTEKLKLS---KLSTRWVPKPLRPDQLQTRAELSMEILNKW 145 T E +A S+G ++++LK + + WVP L+P ++ R +S +L + Sbjct 90 TQEELAK----SLGVTQQAISKRLKAAGYIQKQGNWVPHELKPRDVERRFCMSEMLLQR- 144 Query 146 DQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGPVKAKADWSRAKVMATVFWD 205 ++FL RI+TGDE W++ +P+ K K ++ RG AK + AKVM ++W Sbjct 145 -HKKKSFLSRIITGDEKWIHYDNPKRK---KSYVKRGKRVKPTAKRNIHGAKVMLCIWWG 200 Query 206 AQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP--GKLHQRVLLHHDNAPAHSSHQ 263 +G+L + LE +TIT Y + L +L +ALAEKRP K H V+ HHDNA H + Sbjct 201 QKGVLYYELLEPGQTITGDLYRTQLIRLKQALAEKRPEYAKRHGAVIFHHDNARPHVALP 260 Query 264 TRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTHFSSVNNVKKTALTWLNSQD 323 + L WE++ HPPYSPDLAPSD+ LF +++ L G F+S ++K ++L ++ Sbjct 261 VKNYLENSGWEVLPHPPYSPDLAPSDYHLFRSMQNDLAGKRFTSEQGIRKWLDSFLAAKP 320 Query 324 PQFFRDGLNGWYHRLQKCLELDGAYVE 350 +FF+ G++ +K + DG Y E Sbjct 321 AKFFKKGIHELPEIWEKVIASDGQYFE 347 >gb|AAP51088.1| transposase [Forficula auricularia] Length=342 Score = 182 bits (463), Expect = 2e-44, Method: Composition-based stats. Identities = 114/319 (35%), Positives = 177/319 (55%), Gaps = 11/319 (3%) Query 32 VYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRPSTSICEEKINLVRALIEEDRRLTAE 91 VYGD A K+ W +F+ G ++DE RSGRP E +L++A+I+ DR T Sbjct 32 VYGDEALKERQCQNWFAKFRSGDFSLKDEKRSGRP----VEVDDDLIKAIIDSDRHSTTR 87 Query 92 TIANTTDISIGSAYTILTEKLKLSKLSTRWVPKPLRPDQLQTRAELSMEILNKWDQDPEA 151 IA +S L + + KL T WVP L+ L R S ++L K +++ + Sbjct 88 EIAEKLHVSHTCIENHLKQLGYVQKLDT-WVPHELKETHLTQRIN-SCDLLKKRNEN-DP 144 Query 152 FLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGPVKAKADWSRAKVMATVFWDAQGILL 211 FL+R++TGDE W+ + + K + W G +KA + KV+ +V+WD +GI+ Sbjct 145 FLKRLITGDEKWVVYNNIKRK---RSWSRPGEPAQTTSKAGIHQKKVLLSVWWDYKGIVY 201 Query 212 VDFLEGQRTITSAYYESVLRKLAKALAEKRPGKLHQR-VLLHHDNAPAHSSHQTRAILRE 270 + L RTI S Y L KL A+ EKR +++ V+ HHDNA H+S TR L E Sbjct 202 FELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHHDNARPHTSLVTRQKLLE 261 Query 271 FRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTHFSSVNNVKKTALTWLNSQDPQFFRDG 330 W+++ HPPYSPDLAPSD+FLF +L+ SL G +F++ ++VK + + +++ +F+ G Sbjct 262 LGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKLYLIQFFANKNQKFYERG 321 Query 331 LNGWYHRLQKCLELDGAYV 349 + R QK ++ G Y+ Sbjct 322 IMMLPERWQKVIDQHGQYI 340 >gb|AAP51085.1| transposase [Forficula auricularia] Length=342 Score = 182 bits (461), Expect = 4e-44, Method: Composition-based stats. Identities = 117/350 (33%), Positives = 184/350 (52%), Gaps = 11/350 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F + G + L +YG+ A K+ W +F G ++DE Sbjct 1 MENQKEHFRHILLFYFRKGKNASQAHKKLCALYGNEALKERQCQNWFAKFCSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E +L++A+I+ DR T IA +S L + + KL T Sbjct 61 KRSGRP----VEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDT- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R + + + + DP FL+R++TGDE W+ + + K + W Sbjct 116 WVPHELKETHLTQRINICDLLKKRNENDP--FLKRLITGDEKWVVYNNIKRK---RSWSR 170 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +KA + KV+ +V+WD +GI+ + L RTI S Y L KL A+ EK Sbjct 171 PGEPTQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEK 230 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 R +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF +L+ S Sbjct 231 RAELTNRKGVVFHHDNARPHTSLVTRKKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNS 290 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L G +F++ ++VK + + +++ +F+ G+ R QK ++ +G Y+ Sbjct 291 LNGKNFNNDDDVKLYLVQFFANKNQKFYERGIMMLPERWQKVIDQNGQYI 340 >gb|AAP51097.1| transposase [Forficula auricularia] Length=342 Score = 181 bits (460), Expect = 5e-44, Method: Composition-based stats. Identities = 119/354 (33%), Positives = 185/354 (52%), Gaps = 19/354 (5%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K R + F + G + L VYGD A K+ W +F+ G ++DE Sbjct 1 MENQKEHFRHILLFYFRKGKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDE 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLK----LSK 116 RSGRP E +L++A+I D T IA +S +T + LK + K Sbjct 61 KRSGRP----VEVDDDLIKAIINSDCHSTTREIAEKLHVS----HTCIENHLKHLGYVQK 112 Query 117 LSTRWVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSK 176 L T WVP L+ L R + + + + DP FL+R++TGDE W+ + + K + Sbjct 113 LDT-WVPHELKETHLTQRINICDLLKKRNENDP--FLKRLITGDEKWVVYNNIKRK---R 166 Query 177 QWLPRGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKA 236 W G +KA + KV+ +V+WD +GI+ + L RTI S Y L KL Sbjct 167 SWSRPGEPAQTTSKAGIHQKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNE 226 Query 237 LAEKRPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPN 295 + EKR +++ V+ HHDNA H+S TR L E W+++ HPPYSPDLAPSD+FLF + Sbjct 227 VEEKRAELTNRKGVVFHHDNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRS 286 Query 296 LKKSLKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L+ SL G +F++ ++VK + + +++ +F+ G+ R QK ++ +G Y+ Sbjct 287 LQNSLNGKNFNNDDDVKLYLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQYI 340 >ref|XP_001099426.1| Gene info PREDICTED: similar to SET domain and mariner transposase fusion gene [Macaca mulatta] Length=671 Score = 175 bits (443), Expect = 4e-42, Method: Composition-based stats. Identities = 109/347 (31%), Positives = 178/347 (51%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A +++ + L + K+ KL +WVP Sbjct 395 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLD-KWVPH 449 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + +P FL RIVT DE W+ YD ++ +S QWL + + Sbjct 450 ELTENQKNRRFEVSSSLILRNHNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLDQEAA 504 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 +K K+M T++W A G++ FL TITS Y + ++ + L + Sbjct 505 PKHFSKPILHPKKIMVTIWWSAAGVIHYSFLNPGETITSEKYAQEIDEMHQKLQHLQLAL 564 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ HPPYSPDL P+++ +F +L L+G Sbjct 565 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHIFKHLNNFLQGK 624 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ S+ F+ G+N R QKC++ +GAY + Sbjct 625 RFHNQQDAENAFQEFVKSRSTDFYATGINQLISRWQKCVDCNGAYFD 671 >gb|AAC16616.1| transposase [Drosophila simulans] Length=345 Score = 174 bits (441), Expect = 6e-42, Method: Composition-based stats. Identities = 111/348 (31%), Positives = 179/348 (51%), Gaps = 12/348 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + RT + F L E L + +G+ P +W RFK G DV+D+ G Sbjct 8 KEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDKVH-G 66 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 +P + ++ +AL++ED T + +A ++S + L E K+ K+ RWVP Sbjct 67 KPPKRYEDAEL---QALLDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVG-RWVPH 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L Q++ R +L+++ + ++FL RIVTGDE W++ +P+ K K ++ G Sbjct 123 ELNERQMERRKNTCEILLSRYKR--KSFLHRIVTGDEKWIFFVNPKRK---KSYVDPGQP 177 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP-- 242 A+ + K M V+WD G++ + L+ T+ +A Y+ L L +AL KRP Sbjct 178 ATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNTARYQQQLINLNRALQRKRPEY 237 Query 243 GKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKG 302 K +V+ HDNAP+H++ R L WE++ H YSPDLAPSD+ LF ++ +L Sbjct 238 QKRQHKVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAE 297 Query 303 THFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F S +VKK W ++D +F+ G++ R +KC+ DG Y E Sbjct 298 QRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE 345 >gb|AAC16618.1| transposase [Drosophila simulans] Length=345 Score = 174 bits (441), Expect = 7e-42, Method: Composition-based stats. Identities = 112/348 (32%), Positives = 179/348 (51%), Gaps = 12/348 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + RT + F L E L + +G+ P +W RFK G DV+D+ G Sbjct 8 KEQTRTVLIFCFHLKKTAAESHRILVEAFGEQVPTVKKCERWFQRFKSGDFDVDDK-EHG 66 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 +P + ++ +AL++ED T + +A ++S + L E K+ K+ RWVP Sbjct 67 KPPKRYEDAEL---QALLDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVG-RWVPH 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L Q++ R +L+++ + ++FL RIVTGDE W++ P+ K K ++ G Sbjct 123 ELNERQMERRKNTCEILLSRYKR--KSFLHRIVTGDEKWIFFVSPKRK---KSYVDPGQP 177 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP-- 242 A+ + K M V+WD G++ + L+ T+ +A Y+ L L +AL KRP Sbjct 178 ATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNTARYQQQLINLNRALQRKRPEY 237 Query 243 GKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKG 302 K RV+ HDNAP+H++ R L WE++ H YSPDLAPSD+ LF ++ +L Sbjct 238 QKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAE 297 Query 303 THFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F S +VKK W ++D +F+ G++ R +KC+ DG Y+E Sbjct 298 QRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYLE 345 >gb|AAA28678.1| mariner transposition protein (put.); putative gb|AAK40118.1| mariner-like transposase [Blattella germanica] Length=345 Score = 174 bits (441), Expect = 7e-42, Method: Composition-based stats. Identities = 112/348 (32%), Positives = 179/348 (51%), Gaps = 12/348 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + RT + F L E L + +G+ P +W RFK G DV+D+ G Sbjct 8 KEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKKCERWFQRFKSGDFDVDDK-EHG 66 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 +P + ++ +AL++ED T + +A ++S + L E K+ K+ RWVP Sbjct 67 KPPKRYEDAEL---QALLDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVG-RWVPH 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L Q++ R +L+++ + ++FL RIVTGDE W++ P+ K K ++ G Sbjct 123 ELNERQMERRKNTCEILLSRYKR--KSFLHRIVTGDEKWIFFVSPKRK---KSYVDPGQP 177 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP-- 242 A+ + K M V+WD G++ + L+ T+ +A Y+ L L +AL KRP Sbjct 178 ATSTARPNRFGKKTMLCVWWDQSGVIYYELLKRGETVNTARYQQQLINLNRALQRKRPEY 237 Query 243 GKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKG 302 K RV+ HDNAP+H++ R L WE++ H YSPDLAPSD+ LF ++ +L Sbjct 238 QKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAE 297 Query 303 THFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F S +VKK W ++D +F+ G++ R +KC+ DG Y+E Sbjct 298 QRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYLE 345 >gb|AAK54758.1| mariner-like transposase [Musca domestica] Length=346 Score = 174 bits (440), Expect = 8e-42, Method: Composition-based stats. Identities = 112/349 (32%), Positives = 179/349 (51%), Gaps = 12/349 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + RT + F L E L + +G+ P +W RFK G DV+D+ G Sbjct 8 KEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKKCERWFQRFKSGDFDVDDK-EHG 66 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 +P + ++ +AL++ED T + +A ++S + L E K+ K+ RWVP Sbjct 67 KPPKRYEDAEL---QALLDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVG-RWVPH 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L Q++ R +L+++ + ++FL RIVTGDE W++ P+ K K ++ G Sbjct 123 ELNERQMERRKNTCEILLSRYKR--KSFLHRIVTGDEKWIFFVSPKRK---KSYVDPGQP 177 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP-- 242 A+ + K M V+WD G++ + L+ T+ +A Y+ L L +AL KRP Sbjct 178 ATSTARPNRFGKKTMLCVWWDQSGVIYYELLKRGETVNTARYQQQLINLNRALQRKRPEY 237 Query 243 GKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKG 302 K RV+ HDNAP+H++ R L WE++ H YSPDLAPSD+ LF ++ +L Sbjct 238 QKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAE 297 Query 303 THFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 F S +VKK W ++D +F+ G++ R +KC+ DG Y +K Sbjct 298 QRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFDK 346 >gb|AAC16610.1| transposase [Drosophila simulans] gb|AAC16611.1| transposase [Drosophila simulans] gb|AAC16615.1| transposase [Drosophila simulans] Length=345 Score = 174 bits (440), Expect = 8e-42, Method: Composition-based stats. Identities = 111/348 (31%), Positives = 179/348 (51%), Gaps = 12/348 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + RT + F L E L + +G+ P +W RFK G DV+D+ G Sbjct 8 KEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDK-EHG 66 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 +P + ++ +AL++ED T + +A ++S + L E K+ K+ RWVP Sbjct 67 KPPKRYEDAEL---QALLDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVG-RWVPH 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L Q++ R +L+++ + ++FL RIVTGDE W++ +P+ K K ++ G Sbjct 123 ELNERQMERRKNTCEILLSRYKR--KSFLHRIVTGDEKWIFFVNPKRK---KSYVDPGQP 177 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP-- 242 A+ + K M V+WD G++ + L+ T+ +A Y+ L L +AL KRP Sbjct 178 ATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNTARYQQQLINLNRALQRKRPEY 237 Query 243 GKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKG 302 K +V+ HDNAP+H++ R L WE++ H YSPDLAPSD+ LF ++ +L Sbjct 238 QKRQHKVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAE 297 Query 303 THFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F S +VKK W ++D +F+ G++ R +KC+ DG Y E Sbjct 298 QRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE 345 >ref|NP_006506.1| UniGene infoGene info SET domain and mariner transposase fusion [Homo sapiens] gb|AAC52012.1| UniGene infoGene info unknown [Homo sapiens] Length=671 Score = 174 bits (440), Expect = 9e-42, Method: Composition-based stats. Identities = 110/347 (31%), Positives = 177/347 (51%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A +++ + L + K+ KL +WVP Sbjct 395 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLD-KWVPH 449 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + +P FL RIVT DE W+ YD ++ +S QWL + + Sbjct 450 ELTENQKNRRFEVSSSLILRNHNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLDQEEA 504 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 K KVM T++W A G++ FL TITS Y + ++ + L + Sbjct 505 PKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLAL 564 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ HPPYSPDL P+++ +F +L L+G Sbjct 565 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 624 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ SQ F+ G+N R QKC++ +G+Y + Sbjct 625 RFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 >ref|XP_526121.2| Gene info PREDICTED: SET domain and mariner transposase fusion [Pan troglodytes] Length=684 Score = 173 bits (439), Expect = 1e-41, Method: Composition-based stats. Identities = 110/347 (31%), Positives = 177/347 (51%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 348 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 407 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A +++ + L + K+ KL +WVP Sbjct 408 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLD-KWVPH 462 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + +P FL RIVT DE W+ YD ++ +S QWL + + Sbjct 463 ELTENQKNRRFEVSSSLILRNHNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLDQEEA 517 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 K KVM T++W A G++ FL TITS Y + ++ + L + Sbjct 518 PKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLAL 577 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ HPPYSPDL P+++ +F +L L+G Sbjct 578 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 637 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ SQ F+ G+N R QKC++ +G+Y + Sbjct 638 RFHNQQDAENAFREFVESQSTDFYTTGINQLISRWQKCVDCNGSYFD 684 >gb|EAW63905.1| Gene info SET domain and mariner transposase fusion gene, isoform CRA_c [Homo sapiens] Length=684 Score = 173 bits (439), Expect = 1e-41, Method: Composition-based stats. Identities = 110/347 (31%), Positives = 177/347 (51%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 348 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 407 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A +++ + L + K+ KL +WVP Sbjct 408 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLD-KWVPH 462 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + +P FL RIVT DE W+ YD ++ +S QWL + + Sbjct 463 ELTENQKNRRFEVSSSLILRNHNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLDQEEA 517 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 K KVM T++W A G++ FL TITS Y + ++ + L + Sbjct 518 PKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLAL 577 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ HPPYSPDL P+++ +F +L L+G Sbjct 578 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 637 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ SQ F+ G+N R QKC++ +G+Y + Sbjct 638 RFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 684 >sp|Q53H47|SETMR_HUMAN Gene info Histone-lysine N-methyltransferase SETMAR (SET domain and mariner transposase fusion gene-containing protein) (Metnase) (Hsmar1) [Includes: Histone-lysine N-methyltransferase; Mariner transposase Hsmar1] dbj|BAD96454.1| UniGene infoGene info SET domain and mariner transposase fusion gene variant [Homo sapiens] gb|AAY29570.1| UniGene infoGene info metnase [Homo sapiens] Length=671 Score = 173 bits (439), Expect = 1e-41, Method: Composition-based stats. Identities = 110/347 (31%), Positives = 177/347 (51%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A +++ + L + K+ KL +WVP Sbjct 395 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLD-KWVPH 449 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + +P FL RIVT DE W+ YD ++ +S QWL + + Sbjct 450 ELTENQKNRRFEVSSSLILRNHNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLDQEEA 504 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 K KVM T++W A G++ FL TITS Y + ++ + L + Sbjct 505 PKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLAL 564 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ HPPYSPDL P+++ +F +L L+G Sbjct 565 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 624 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ SQ F+ G+N R QKC++ +G+Y + Sbjct 625 RFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 >gb|AAC09350.1| UniGene infoGene info unknown [Homo sapiens] Length=671 Score = 173 bits (439), Expect = 1e-41, Method: Composition-based stats. Identities = 110/347 (31%), Positives = 177/347 (51%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A +++ + L + K+ KL +WVP Sbjct 395 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLD-KWVPH 449 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + +P FL RIVT DE W+ YD ++ +S QWL + + Sbjct 450 ELTENQKNRRFEVSSSLILRNHNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLDQEEA 504 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 K KVM T++W A G++ FL TITS Y + ++ + L + Sbjct 505 PKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLAL 564 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ HPPYSPDL P+++ +F +L L+G Sbjct 565 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 624 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ SQ F+ G+N R QKC++ +G+Y + Sbjct 625 RFHNQQDAENAFQEFVESQSTDFYATGINQLIFRWQKCVDCNGSYFD 671 >gb|AAC52010.1| Gene info mariner transposase [Homo sapiens] Length=343 Score = 173 bits (439), Expect = 1e-41, Method: Composition-based stats. Identities = 112/347 (32%), Positives = 179/347 (51%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A ++ + L + K+ KL +WVP Sbjct 67 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLD-KWVPH 121 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + + +P FL RIVT DE W+ YD ++ + QWL R + Sbjct 122 ELSENQKNRRFEVSSSLILRNNNEP--FLDRIVTCDEKWIL-YD--NRRRPAQWLDREEA 176 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 K + + KVM TV+W A G++ FL TITS Y + ++ + L +P Sbjct 177 PKHFPKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPAL 236 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ HPPYSPDL+P+D+ F +L L+G Sbjct 237 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGK 296 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ S+ F+ G+N R QKC++ +G+Y + Sbjct 297 RFHNQQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 >dbj|BAB86288.1| mariner transposase [Apis cerana] Length=336 Score = 173 bits (438), Expect = 1e-41, Method: Composition-based stats. Identities = 117/353 (33%), Positives = 183/353 (51%), Gaps = 19/353 (5%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M K R + F + G + L ++YG+ W ++F+ D++D Sbjct 1 MQDQKEHFRHILLFYYRKGKNAVQARKKLCEIYGEGILTVRQCQNWFSKFRSDNFDIKDA 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E + ++ALIE +RR+T IA ++S + + + +SKL Sbjct 61 PRSGRP----VEADEDKIKALIEANRRITTREIATRLNLSNSTVHDHMKRLGFVSKLDI- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R ++ +L + + DP FL+RIVTGDE W+ YD + Sbjct 116 WVPHVLKEKDLLCRIDICDSLLKREENDP--FLKRIVTGDEKWIV-YDN---------IK 163 Query 181 RGGSGPVKAKADWS-RAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAE 239 R + P + + + KVM +V+WD +G++ + L TI S Y + L KL ++ + Sbjct 164 RELNEPAQRTSKNNIHKKVMLSVWWDFKGVVFFELLPNNCTINSEVYCNQLDKLNNSIKQ 223 Query 240 KRPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKK 298 KRP ++++ V+ HHDNA AH S TR L + WE++ HPPYSPDLAPSD+ LF +L+ Sbjct 224 KRPELINRKGVVFHHDNAKAHMSLMTRQKLLQLGWEVLPHPPYSPDLAPSDYHLFRSLQN 283 Query 299 SLKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 SL F+S +VK + ++D +F+ G+ R Q L+ +G YV K Sbjct 284 SLNDKTFTSNEDVKNYLDQFFANKDQKFYERGIMLLPKRWQYVLDHNGQYVIK 336 >gb|AAC16612.1| transposase [Drosophila simulans] Length=345 Score = 173 bits (438), Expect = 1e-41, Method: Composition-based stats. Identities = 111/348 (31%), Positives = 179/348 (51%), Gaps = 12/348 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + RT + F L E L + +G+ P +W RFK G DV+D+ G Sbjct 8 KEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDK-EHG 66 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 +P + ++ +AL++ED T + +A ++S + L E K+ K+ RWVP Sbjct 67 KPPKRYEDAEL---QALLDEDGAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVG-RWVPH 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L Q++ R +L+++ + ++FL RIVTGDE W++ +P+ K K ++ G Sbjct 123 ELNERQMERRKNTCEILLSRYKR--KSFLHRIVTGDEKWIFFVNPKRK---KSYVDPGQP 177 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP-- 242 A+ + K M V+WD G++ + L+ T+ +A Y+ L L +AL KRP Sbjct 178 ATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNTARYQQQLINLNRALQRKRPEY 237 Query 243 GKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKG 302 K +V+ HDNAP+H++ R L WE++ H YSPDLAPSD+ LF ++ +L Sbjct 238 QKRQHKVIFLHDNAPSHTARAFRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAE 297 Query 303 THFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F S +VKK W ++D +F+ G++ R +KC+ DG Y E Sbjct 298 QRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE 345 >gb|AAC16614.1| transposase [Drosophila simulans] Length=345 Score = 173 bits (438), Expect = 2e-41, Method: Composition-based stats. Identities = 111/348 (31%), Positives = 179/348 (51%), Gaps = 12/348 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + RT + F L E L + +G+ P +W RFK G DV+D+ G Sbjct 8 KEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDK-EHG 66 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 +P + ++ +AL++ED T + +A ++S + L E K+ K+ RWVP Sbjct 67 KPPKRYEDAEL---QALLDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVG-RWVPH 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L Q++ R +L+++ + ++FL RIVTGDE W++ +P+ K K ++ G Sbjct 123 ELNERQMERRKNTCEILLSRYKR--KSFLHRIVTGDEKWIFFVNPKRK---KSYVDPGQP 177 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP-- 242 A+ + K M V+WD G++ + L+ T+ +A Y+ L L +AL KRP Sbjct 178 ATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNTARYQQQLINLNRALQRKRPEY 237 Query 243 GKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKG 302 K +V+ HDNAP+H++ R L WE++ H YSPDLAPSD+ LF ++ +L Sbjct 238 QKRQHKVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYQLFASMGHALAE 297 Query 303 THFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F S +VKK W ++D +F+ G++ R +KC+ DG Y E Sbjct 298 QRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE 345 >gb|AAC16613.1| transposase [Drosophila simulans] Length=345 Score = 172 bits (437), Expect = 2e-41, Method: Composition-based stats. Identities = 111/348 (31%), Positives = 178/348 (51%), Gaps = 12/348 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + RT + F L E L + +G+ P +W RFK G DV+D+ G Sbjct 8 KEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDK-EHG 66 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 +P + ++ +AL++ED T + +A ++S + L E K+ K+ RWVP Sbjct 67 KPPKRYEDAEL---QALLDEDGAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVG-RWVPH 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L Q++ R +L+++ + ++FL RIVTGDE W++ +P+ K K ++ G Sbjct 123 ELNERQMERRKNTCEILLSRYKR--KSFLHRIVTGDEKWIFFVNPKRK---KSYVDPGQP 177 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP-- 242 A+ + K M V+WD G++ + L+ T+ +A Y+ L L +AL KRP Sbjct 178 ATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNTARYQQQLINLNRALQRKRPEY 237 Query 243 GKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKG 302 K V+ HDNAP+H++ R L WE++ H YSPDLAPSD+ LF ++ +L Sbjct 238 QKRQHGVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAE 297 Query 303 THFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F S +VKK W ++D +F+ G++ R +KC+ DG Y E Sbjct 298 QRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE 345 >gb|AAC16617.1| transposase [Drosophila simulans] Length=345 Score = 171 bits (434), Expect = 4e-41, Method: Composition-based stats. Identities = 106/324 (32%), Positives = 171/324 (52%), Gaps = 12/324 (3%) Query 29 LRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRPSTSICEEKINLVRALIEEDRRL 88 L + +G+ P +W RFK G DV+D+ G+P + ++ +AL++ED Sbjct 32 LVEAFGEQVPTVKKCERWFQRFKSGDFDVDDK-EHGKPPKRYEDAEL---QALLDEDDAQ 87 Query 89 TAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKPLRPDQLQTRAELSMEILNKWDQD 148 T + +A ++S + L E K+ K+ RWVP L Q++ R +L+++ + Sbjct 88 TQKQLAEQLEVSQQAVSNRLREMGKIQKVG-RWVPHELNERQMERRKNTCEILLSRYKR- 145 Query 149 PEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGPVKAKADWSRAKVMATVFWDAQG 208 ++FL RIVTGDE W++ P+ K K ++ G A+ + K M V+WD G Sbjct 146 -KSFLHRIVTGDEKWIFFVSPKRK---KSYVDPGQPATSTARPNRFGKKTMLCVWWDQSG 201 Query 209 ILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP--GKLHQRVLLHHDNAPAHSSHQTRA 266 ++ + L+ T+ +A Y+ L L +AL KRP K RV+ HDNAP+H++ R Sbjct 202 VIYYELLKRGETVNTARYQQQLINLNRALQRKRPEYQKRQHRVIFLHDNAPSHTARAVRD 261 Query 267 ILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTHFSSVNNVKKTALTWLNSQDPQF 326 L WE++ H YSPDLAPSD+ LF ++ +L F S +VKK W ++D +F Sbjct 262 TLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEF 321 Query 327 FRDGLNGWYHRLQKCLELDGAYVE 350 + G++ R +KC+ DG Y+E Sbjct 322 YWRGIHKLPERWEKCVASDGKYLE 345 >dbj|BAE87709.1| UniGene info unnamed protein product [Macaca fascicularis] Length=479 Score = 171 bits (433), Expect = 5e-41, Method: Composition-based stats. Identities = 109/347 (31%), Positives = 178/347 (51%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 143 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 202 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A +++ + L + K+ KL +WVP Sbjct 203 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLD-KWVPH 257 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + +P FL RIVT DE W+ YD ++ +S QWL + + Sbjct 258 ELTENQKNRRFEVSSSLILRNHNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLDQEAA 312 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 +K K+M T++W A G++ FL TITS Y + ++ + L + Sbjct 313 PKHFSKPILHPKKIMVTIWWSAAGVIHYSFLNPGETITSEKYAQEIDEMHQKLQHLQLAL 372 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ HPPYSPDL P+++ +F +L L+G Sbjct 373 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHIFKHLNNFLQGK 432 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ S+ F+ G+N R QKC++ +GAY + Sbjct 433 RFHNQQDAENAFQEFVKSRSTDFYATGINQLISRWQKCVDCNGAYFD 479 >gb|AAC16609.1| transposase [Drosophila sechellia] Length=345 Score = 171 bits (432), Expect = 8e-41, Method: Composition-based stats. Identities = 110/348 (31%), Positives = 177/348 (50%), Gaps = 12/348 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + T + F L E L + +G+ P +W RFK G DV+D+ G Sbjct 8 KEQTLTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDK-EHG 66 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 +P + ++ +AL++ED T + +A ++S + L E K+ K+ RWVP Sbjct 67 KPPKRYEDAEL---QALLDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVG-RWVPH 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L Q++ R +L+++ + ++FL RIVTGDE W++ P+ K K ++ G Sbjct 123 ELNERQMERRKNTCEILLSRYKR--KSFLHRIVTGDEKWIFFVSPKRK---KSYVDPGQP 177 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP-- 242 A+ + K M V+WD G++ + L+ T+ +A Y+ L L +AL KRP Sbjct 178 ATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNTASYQQQLINLNRALQRKRPEY 237 Query 243 GKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKG 302 K +V+ HDNAP+H++ R L WE++ H YSPDLAPSD+ LF ++ +L Sbjct 238 QKRQHKVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAE 297 Query 303 THFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F S +VKK W ++D +F+ G++ R +KC+ DG Y E Sbjct 298 QRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE 345 >gb|AAB17945.1| mariner transposase [Ceratitis capitata] Length=338 Score = 170 bits (431), Expect = 1e-40, Method: Composition-based stats. Identities = 110/331 (33%), Positives = 175/331 (52%), Gaps = 17/331 (5%) Query 23 GEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRPSTSICEEKINLVRALI 82 G T +R+VY D AP V KW +F+ G ++ED RSGRP CE +++R + Sbjct 19 GAATKDIREVYSDRAPALRTVKKWFAKFRSGDFNLEDRPRSGRP----CELDNDVLRISV 74 Query 83 EEDRRLTAETIANTTDISIGSAYTILTE---KLKLSKLSTRWVPKPLRPDQLQTRAELSM 139 + R++ + +A+ +++ +A+ L + LKL K WVP L R ++ Sbjct 75 ANNSRISTKEVASELNVNKPTAFRRLKKVGYTLKLDK----WVPHQLSEKNKVDRMSTAI 130 Query 140 EILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGPVKAKADWSRAKVM 199 +L + +P FL R++TGDE W+ + + K KQ G+ P+ +K V+ Sbjct 131 SLLRRVKNEP--FLDRLLTGDEKWILYNNVQRKRTWKQ--AHEGAEPM-SKGGLHPMMVL 185 Query 200 ATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGKLHQR-VLLHHDNAPA 258 ++WD +G++ + L TIT+ Y L +L KA+ EKRP +++ VL H+DNA Sbjct 186 LCIWWDIRGVIYFELLPAGETITANKYCQQLVELKKAIDEKRPIFANRKGVLFHYDNARP 245 Query 259 HSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTHFSSVNNVKKTALTW 318 H + T A L+E WEI+ H PYSPD+APSD+ LF +L+ +L G F +V +VK + Sbjct 246 HVAKPTLAKLKEMNWEIMPHSPYSPDIAPSDYHLFRSLQNNLNGKKFKNVEDVKSHLDNF 305 Query 319 LNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 N + F+ G+ R + E DG Y+ Sbjct 306 FNEKPRDFYESGIRKLVERWEWIAEHDGEYI 336 >gb|AAC16608.1| transposase [Drosophila sechellia] Length=345 Score = 170 bits (431), Expect = 1e-40, Method: Composition-based stats. Identities = 114/350 (32%), Positives = 181/350 (51%), Gaps = 16/350 (4%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + T + F L E L + +G+ P +W RFK G DV+D+ G Sbjct 8 KEQTLTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDK-EHG 66 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 +P + ++ +AL++ED T + +A ++S + L E K+ K+ RWVP Sbjct 67 KPPKRYEDAEL---QALLDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVG-RWVPH 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L Q++ R +L+++ + ++FL RIVTGDE W++ +P+ K K ++ G Sbjct 123 ELNERQMERRKNTCEILLSRYKR--KSFLHRIVTGDEKWIFFVNPKRK---KSYVDPGQ- 176 Query 185 GPVKAKADWSR--AKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP 242 PV + A +R K M V+WD G++ + L+ T+ +A Y+ L L +AL KRP Sbjct 177 -PVTSTALPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNTARYQQQLINLNRALQRKRP 235 Query 243 --GKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSL 300 K RV+ HDNAP+H++ R L WE++ H YSPDLAPSD+ LF ++ +L Sbjct 236 EYQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHAL 295 Query 301 KGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F S +VKK W ++D +F+ G++ R +KC+ DG Y E Sbjct 296 AEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE 345 >gb|EAW63904.1| Gene info SET domain and mariner transposase fusion gene, isoform CRA_b [Homo sapiens] Length=448 Score = 167 bits (424), Expect = 6e-40, Method: Composition-based stats. Identities = 110/347 (31%), Positives = 177/347 (51%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 112 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 171 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A +++ + L + K+ KL +WVP Sbjct 172 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLD-KWVPH 226 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + +P FL RIVT DE W+ YD ++ +S QWL + + Sbjct 227 ELTENQKNRRFEVSSSLILRNHNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLDQEEA 281 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 K KVM T++W A G++ FL TITS Y + ++ + L + Sbjct 282 PKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLAL 341 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ HPPYSPDL P+++ +F +L L+G Sbjct 342 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 401 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ SQ F+ G+N R QKC++ +G+Y + Sbjct 402 RFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 448 >gb|ABC72089.1| SETMAR [Gorilla gorilla] Length=446 Score = 167 bits (424), Expect = 6e-40, Method: Composition-based stats. Identities = 110/347 (31%), Positives = 177/347 (51%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 110 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 169 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A +++ + L + K+ KL +WVP Sbjct 170 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLD-KWVPH 224 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + +P FL RIVT DE W+ YD ++ +S QWL + + Sbjct 225 ELTENQKNRRFEVSSSLILRNHNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLDQEEA 279 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 K KVM T++W A G++ FL TITS Y + ++ + L + Sbjct 280 PKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMHQKLQRLQLAL 339 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ HPPYSPDL P+++ +F +L L+G Sbjct 340 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 399 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ SQ F+ G+N R QKC++ +G+Y + Sbjct 400 RFHNQQDAENAFQEFVKSQSTDFYATGINQLISRWQKCVDCNGSYFD 446 >gb|ABC72093.1| SETMAR [Aotus trivirgatus] Length=446 Score = 167 bits (423), Expect = 8e-40, Method: Composition-based stats. Identities = 113/352 (32%), Positives = 179/352 (50%), Gaps = 13/352 (3%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M K + R F K+G K E T + +G + V W +F KG + +EDE Sbjct 106 MRLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDE 165 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRPS E + +RA+IE D T +A +++ + L + K+ KL + Sbjct 166 ERSGRPS----EVDNDHLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLD-K 220 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L +Q R E+S ++ + + +P FL RIVT DE W+ YD ++ +S QWL Sbjct 221 WVPHELTENQKNRRFEVSSSLILRNNNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLD 275 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 + + K + KVM T++W A G++ FL TITS Y + ++ + L ++ Sbjct 276 QEEAPKHFPKPILHQKKVMVTIWWSAAGLIHYSFLNPGETITSEKYVQEIDEMHQKL-QR 334 Query 241 RPGKLHQRV--LLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKK 298 P L R +L HDNA H T L E +E++ HPPYSPDL P+++ +F +L Sbjct 335 LPLALVNRKGPILLHDNARPHVVQPTLQKLNELGYEVLPHPPYSPDLLPTNYHIFKHLSN 394 Query 299 SLKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 L+G F + + + ++ S+ F+ G+N R QKC++ +G+Y + Sbjct 395 FLQGKRFHNQQDAENAFQEFIESRSRDFYTTGINQLISRWQKCVDCNGSYFD 446 >gb|ABC72092.1| SETMAR [Cercopithecus aethiops] Length=446 Score = 167 bits (422), Expect = 1e-39, Method: Composition-based stats. Identities = 108/347 (31%), Positives = 178/347 (51%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 110 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 169 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A +++ + L + K+ KL +WVP Sbjct 170 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLD-KWVPH 224 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + +P FL RIVT DE W+ YD ++ +S QWL + + Sbjct 225 ELTENQKNRRFEVSSSLILRNRNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLDQEEA 279 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 +K K+M T++W A G++ FL TITS Y + ++ + L + Sbjct 280 PKHFSKPILHPKKIMVTIWWSAAGVIHYSFLNPGETITSEKYAQEIDEMHQKLQHLQLAL 339 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ HPPYSPDL P+++ +F +L L+G Sbjct 340 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHIFKHLNNFLQGK 399 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ S+ F+ G+N R QKC++ +G+Y + Sbjct 400 RFHNQQDAENAFQEFVKSRSTDFYATGINQLISRWQKCVDCNGSYFD 446 >ref|XP_001120719.1| Gene info PREDICTED: similar to T12B5.6 [Apis mellifera] Length=335 Score = 167 bits (422), Expect = 1e-39, Method: Composition-based stats. Identities = 114/352 (32%), Positives = 180/352 (51%), Gaps = 18/352 (5%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M K R + F + G + L ++YG+ W ++F+ D++D Sbjct 1 MQDQKEHFRHILLFYYRKGKNAVQARKKLCEIYGEGILTVRQCQNWFSKFRSDNFDIKDA 60 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 R GRP E + ++ALIE +RR+T IA ++S + + + +SKL Sbjct 61 PRPGRP----VEADEDKIKALIEANRRITTREIAARLNLSNSTVHDHMKRLGFVSKLDI- 115 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 WVP L+ L R ++ +L + + DP FL RI+TGDE W+ YD + ++ Sbjct 116 WVPHALKEKDLLRRIDICDLLLKREENDP--FLERIITGDEKWIV-YDNIKRELNEP--- 169 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 P + K + + KV+ +V+WD +G++ + L TI S Y + L KL ++ +K Sbjct 170 -----PPRTKKNIHK-KVLLSVWWDFKGVIFFELLPDICTINSEVYCNQLDKLNNSIKQK 223 Query 241 RPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 RP ++++ V+ HHDN AH S TR L + WE++ HPPYSPDLAPSD+ LF +L+ S Sbjct 224 RPELINRKGVVFHHDNTKAHMSLMTRQKLLQLGWEVLPHPPYSPDLAPSDYHLFRSLQNS 283 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 L FSS +V + ++D +F+ G+ R Q LE +G YV K Sbjct 284 LDDRTFSSNEDVTNYLDQYFANKDQKFYEHGIMLLPKRWQYVLEHNGQYVIK 335 >gb|ABC72088.1| SETMAR [Pan troglodytes] Length=446 Score = 167 bits (422), Expect = 1e-39, Method: Composition-based stats. Identities = 110/347 (31%), Positives = 177/347 (51%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 110 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 169 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A +++ + L + K+ KL +WVP Sbjct 170 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLD-KWVPH 224 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + +P FL RIVT DE W+ YD ++ +S QWL + + Sbjct 225 ELTENQKNRRFEVSSFLILRNHNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLDQEEA 279 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 K KVM T++W A G++ FL TITS Y + ++ + L + Sbjct 280 PKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLAL 339 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ HPPYSPDL P+++ +F +L L+G Sbjct 340 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 399 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ SQ F+ G+N R QKC++ +G+Y + Sbjct 400 RFHNQQDAENAFREFVESQSTDFYTTGINQLISRWQKCVDCNGSYFD 446 >gb|AAC28261.1| transposase [Drosophila teissieri] Length=345 Score = 166 bits (421), Expect = 1e-39, Method: Composition-based stats. Identities = 108/348 (31%), Positives = 176/348 (50%), Gaps = 12/348 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + T + F L E L + +G+ P +W RFK G DV+D+ G Sbjct 8 KEQTPTVLMFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDK-EHG 66 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 +P + ++ +AL++ED T + +A ++S + L E K+ K+ RWVP Sbjct 67 KPPKRYEDAEL---QALLDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVG-RWVPH 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L Q++ R +L+++ + ++FL RIVTGDE W++ +P+ K K ++ G Sbjct 123 ELNERQMERRKNTCEILLSRYKR--KSFLHRIVTGDEKWIFFVNPKRK---KSYVDPGQP 177 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP-- 242 A+ + K M V+WD G++ + L+ T+ +A Y L L +AL KRP Sbjct 178 ATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGATVNTARYHQQLINLNRALQRKRPEY 237 Query 243 GKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKG 302 K +V+ HD AP+H++ R L W+++ H YSPDLAPSD+ LF ++ +L Sbjct 238 QKRQHKVIFLHDKAPSHTARAVRDTLETLNWKVLPHAAYSPDLAPSDYHLFASMGHALAE 297 Query 303 THFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F S +VKK W ++D +F+ G++ R +KC+ DG Y E Sbjct 298 QRFDSYESVKKWLDGWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE 345 >gb|AAC28262.1| transposase [Drosophila teissieri] Length=344 Score = 166 bits (420), Expect = 2e-39, Method: Composition-based stats. Identities = 108/348 (31%), Positives = 178/348 (51%), Gaps = 13/348 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + T + F L E L + +G+ P +W RFK G DV+D+ G Sbjct 8 KEQTPTVLMFCFHLKKTAAESHRMLVEAFGEQVPTVKMCERWFQRFKSGDFDVDDK-EHG 66 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 +P + ++ +AL++ED T + +A ++S + L E K+ K+ RWVP Sbjct 67 KPPKRYEDAEL---QALLDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVG-RWVPH 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L Q++ R +L+++ + ++FL RIVTGDE W++ DP+ K K ++ G Sbjct 123 ELNERQMERRKNTCEILLSRYKR--KSFLHRIVTGDEKWIFFVDPKRK---KSYVDPGQP 177 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP-- 242 A+ + K M V+WD G++ + L+ T+ +A Y+ ++ L +AL KRP Sbjct 178 ATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGATVNTARYQQLI-NLNRALQRKRPEY 236 Query 243 GKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKG 302 K +V+ HD AP+H++ R L WE++ H YSPDLAPSD+ LF ++ +L Sbjct 237 QKRQHKVIFLHDKAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAE 296 Query 303 THFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F S +VKK W ++D +F+ G++ R ++C+ DG Y E Sbjct 297 QRFDSYESVKKWLDGWFGAKDHEFYWRGIHKLPERWEECVASDGKYFE 344 >gb|ABC72090.1| SETMAR [Pongo pygmaeus] Length=446 Score = 166 bits (419), Expect = 2e-39, Method: Composition-based stats. Identities = 109/347 (31%), Positives = 177/347 (51%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 110 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 169 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A +++ + L + K+ KL +WVP Sbjct 170 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLD-KWVPH 224 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + +P FL RIVT DE W+ YD ++ +S QWL + + Sbjct 225 ELTENQKNHRFEVSSSLILRNHNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLDQEEA 279 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 K KVM T++W A G++ FL TITS Y + ++ + L + Sbjct 280 PKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMHQKLQRLQLAL 339 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ HPPYSPDL P+++ +F +L L+G Sbjct 340 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 399 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ S+ F+ G+N R QKC++ +G+Y + Sbjct 400 RFHNQQDAENAFQEFVKSRSTDFYATGINQLISRWQKCVDCNGSYFD 446 >gb|AAH08931.2| UniGene infoGene info SETMAR protein [Homo sapiens] Length=429 Score = 166 bits (419), Expect = 2e-39, Method: Composition-based stats. Identities = 110/347 (31%), Positives = 177/347 (51%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 93 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 152 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A +++ + L + K+ KL +WVP Sbjct 153 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLD-KWVPH 207 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + +P FL RIVT DE W+ YD ++ +S QWL + + Sbjct 208 ELTENQKNRRFEVSSSLILRNHNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLDQEEA 262 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 K KVM T++W A G++ FL TITS Y + ++ + L + Sbjct 263 PKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLAL 322 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ HPPYSPDL P+++ +F +L L+G Sbjct 323 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 382 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ SQ F+ G+N R QKC++ +G+Y + Sbjct 383 RFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 429 >gb|ABC72087.1| Gene info SETMAR [Homo sapiens] Length=344 Score = 165 bits (417), Expect = 4e-39, Method: Composition-based stats. Identities = 110/347 (31%), Positives = 177/347 (51%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 8 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 67 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A +++ + L + K+ KL +WVP Sbjct 68 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLD-KWVPH 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + +P FL RIVT DE W+ YD ++ +S QWL + + Sbjct 123 ELTENQKNRRFEVSSSLILRNHNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLDQEEA 177 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 K KVM T++W A G++ FL TITS Y + ++ + L + Sbjct 178 PKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLAL 237 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ HPPYSPDL P+++ +F +L L+G Sbjct 238 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 297 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ SQ F+ G+N R QKC++ +G+Y + Sbjct 298 RFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 344 >gb|AAL69970.1|AF465247_1 transposase [Mamestra brassicae] Length=345 Score = 164 bits (415), Expect = 8e-39, Method: Composition-based stats. Identities = 107/348 (30%), Positives = 175/348 (50%), Gaps = 12/348 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + RT + F L E L + +G+ P +W RFK G DV+D+ G Sbjct 8 KEQTRTVLIFCFHLKTTAAESHRPLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDK-EHG 66 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 +P + ++ +AL++ED T + +A ++S + L E K+ K+ RWVP Sbjct 67 KPPKRYEDAEL---QALLDEDDAQTQKQLAEQLEVSQQAVSNRLREGGKIQKVG-RWVPH 122 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L Q + R +L+++ + ++FL RIVTG+E W++ +P+ K K ++ G Sbjct 123 ELNERQRERRKNTCEILLSRYKR--KSFLHRIVTGEEKWIFFVNPKRK---KSYVDPGQP 177 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRP-- 242 A+ + K V+WD G++ + L+ T+ +A Y+ L L +AL KRP Sbjct 178 ATSTARPNRFGKKTRLCVWWDQSGVIYYELLKPGETVNTARYQQQLINLNRALQRKRPEY 237 Query 243 GKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKG 302 K RV+ HDNAP+H++ R L WE++ H YSPDLAPSD+ LF ++ +L Sbjct 238 QKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAE 297 Query 303 THFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F S +V++ W ++D +F+ G++ R C+ DG Y E Sbjct 298 QRFDSYESVEEWLDEWFAAKDDEFYWRGIHKLPERWDNCVASDGKYFE 345 >gb|ABC72091.1| SETMAR [Symphalangus syndactylus] Length=446 Score = 162 bits (411), Expect = 2e-38, Method: Composition-based stats. Identities = 107/347 (30%), Positives = 175/347 (50%), Gaps = 11/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE RSG Sbjct 110 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 169 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+IE D T +A +++ + L + K+ KL +WVP Sbjct 170 RPS----EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLD-KWVPH 224 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L +Q R E+S ++ + +P FL RIVT DE W+ YD ++ +S QWL + + Sbjct 225 ELTENQKNRRFEVSSSLILRNHNEP--FLDRIVTCDEKWIL-YD--NRRRSAQWLDQEEA 279 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 K K M T++W A G++ FL T+TS Y + ++ + L + Sbjct 280 PKHFPKPILHPKKAMITIWWSAAGLIHYSFLNPGETVTSEKYAQEIDEMHQKLQRLQLAL 339 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 + ++ +L HDNA H + T L E +E++ HPPYSPDL P+++ +F +L L+G Sbjct 340 VSRKGPVLLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGK 399 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ S+ F+ G+N R QKC++ +G+Y + Sbjct 400 RFHNQQDAENAFQEFIESRSTDFYATGINQLISRWQKCVDCNGSYFD 446 >ref|XP_972527.1| Gene info PREDICTED: similar to SET domain and mariner transposase fusion gene [Tribolium castaneum] Length=174 Score = 162 bits (411), Expect = 2e-38, Method: Composition-based stats. Identities = 80/171 (46%), Positives = 108/171 (63%), Gaps = 0/171 (0%) Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 +G P KAK S KVMA+VFWDA+GIL +D+LE +TI YY S+L +L + + EK Sbjct 4 KGEPVPKKAKTVRSAGKVMASVFWDAKGILFIDYLEKGKTINGPYYASLLDQLKQKIQEK 63 Query 241 RPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSL 300 RPG + +++L H DNAP H S + E +E++ H PYSPDLAPSDF LFPNLKK Sbjct 64 RPGLVKKKILFHQDNAPCHKSVIAMEKINELGFELVPHAPYSPDLAPSDFSLFPNLKKFH 123 Query 301 KGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 G + S + V + + D + +RDG+ G HR KC++L+G YVEK Sbjct 124 AGKKYGSDSEVIAATNAYFDELDEKDYRDGIKGLEHRWTKCIQLEGDYVEK 174 >dbj|BAA21826.1| transposase [Attacus atlas] dbj|BAB32436.1| transposase [Fungia sp. Kusabiraishi] Length=316 Score = 161 bits (407), Expect = 5e-38, Method: Composition-based stats. Identities = 105/310 (33%), Positives = 163/310 (52%), Gaps = 11/310 (3%) Query 19 GWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRPSTSICEEKINLV 78 G E + VYG K++ V W RF+ G D+ ++ R GRP T + E++ Sbjct 17 GTSAAETARRINDVYGGGVTKENTVRFWFQRFRSGNFDLRNKPR-GRPDTKVDNEEL--- 72 Query 79 RALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKPLRPDQLQTRAELS 138 +A++E D T +A +S L + K+ KL RWVP L QTR + Sbjct 73 KAIVEADPSQTTPELAAGCGVSDKIVLIHLKQTGKVKKLE-RWVPHELSETNRQTRVDCC 131 Query 139 MEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGPVKAKADWSRAKV 198 + +LN+ + E L RI+T DE W+ YD ++ +S QWL G K ++ K+ Sbjct 132 VTLLNR--HNNEGILNRIITCDEKWIL-YD--NRKRSSQWLNPGEPAKSCPKRKLTQKKL 186 Query 199 MATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGKLHQ-RVLLHHDNAP 257 + +V+W + G++ FL+ TIT+ Y L+ + + LA K+P +++ R LL HDNA Sbjct 187 LVSVWWTSAGVVHYSFLKSGLTITADVYCQQLQVMMEKLAAKQPRLINRSRPLLLHDNAR 246 Query 258 AHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTHFSSVNNVKKTALT 317 H++ QT L E + E +RHPPYSPDLAP+D+ F NL L+G F+S V+ Sbjct 247 PHTAQQTATKLGELQLECLRHPPYSPDLAPTDYHFFRNLDNFLQGKKFNSDGAVQTAFKD 306 Query 318 WLNSQDPQFF 327 +++S+ FF Sbjct 307 FIDSRPNSFF 316 >emb|CAA56856.1| planarian mariner-9 gene [Girardia tigrina] Length=339 Score = 160 bits (404), Expect = 1e-37, Method: Composition-based stats. Identities = 110/346 (31%), Positives = 180/346 (52%), Gaps = 13/346 (3%) Query 7 EARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRP 66 E R +K+ G + + VY A ++ V W R++ G D+ ++ R GRP Sbjct 5 EIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRYRSGDFDLSNQPR-GRP 63 Query 67 STSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKPL 126 + + + +A +E D +A +A+ ++ + L + K+ KL +WVP L Sbjct 64 EIKVDNDAL---KADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLD-KWVPHEL 119 Query 127 RPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGP 186 + + Q R + + +L++ DP FL RIVT DE W+ YD ++ +S QWL Sbjct 120 KDEHKQQRLDACLSLLSRNKADP--FLHRIVTCDEKWI-MYD--NRKRSSQWLDPDEPPK 174 Query 187 VKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGKLH 246 K + K+M TV+W + G++ DF+ +ITS Y S L + + LA K+P K+ Sbjct 175 HCPKRKVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQP-KMF 233 Query 247 QRV--LLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTH 304 R+ +L HDNA HS+ T A L++ E +RHPPYSPDLAP+D+ F +L L G + Sbjct 234 NRLTPILLHDNARPHSAKNTVAKLQQLGLETLRHPPYSPDLAPTDYHFFQSLDNFLSGKN 293 Query 305 FSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F+S VK +++S++ F+ GLN + Q+C++ G Y + Sbjct 294 FTSSGAVKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 339 >emb|CAA50801.1| mariner-1 protein [Girardia tigrina] Length=339 Score = 159 bits (402), Expect = 2e-37, Method: Composition-based stats. Identities = 111/346 (32%), Positives = 179/346 (51%), Gaps = 13/346 (3%) Query 7 EARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRP 66 E R +K+ G + + VY A ++ V W RF+ G D+ ++ RS RP Sbjct 5 EIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDMSNQPRS-RP 63 Query 67 STSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKPL 126 + + + +A +E D +A +A+ ++ L + K+ KL +WVP L Sbjct 64 EIKVDNDAL---KADVEADSSQSALELASKFGVAKSIILIHLKQINKVKKLD-KWVPHEL 119 Query 127 RPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGP 186 + + Q R + + +L++ DP FL RIVT DE W+ YD ++ +S QWL Sbjct 120 KDEHKQQRLDACLSLLSRNKADP--FLHRIVTCDEKWI-MYD--NRKRSSQWLDPDEPPK 174 Query 187 VKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGKLH 246 K + K+M TV+W + G++ DF+ +ITS Y S L + + LA K+P K+ Sbjct 175 HCPKRKVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQP-KMF 233 Query 247 QRV--LLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTH 304 R+ +L HDNA HS+ T A L++ E +RHPPYSPDLAP+D+ F +L L G + Sbjct 234 NRLTPILLHDNARPHSAKNTVAKLQQLGLETLRHPPYSPDLAPTDYHFFQSLDNFLSGKN 293 Query 305 FSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F+S VK +++S++ F+ GLN + Q+C++ G Y + Sbjct 294 FTSSGAVKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 339 >gb|AAZ67092.1| transposase [Adineta vaga] Length=345 Score = 158 bits (400), Expect = 4e-37, Method: Composition-based stats. Identities = 108/351 (30%), Positives = 166/351 (47%), Gaps = 15/351 (4%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 MN + E R + +LG K E + G +W FK G +++D Sbjct 9 MNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDDL 68 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E ++L++ LIEED RLT +A S + L E K K Sbjct 69 PRSGRP----MEVDVDLLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGV- 123 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 W+P L QLQ R + M+++ +L ++TGDE W+ + + +QWL Sbjct 124 WIPHELSAHQLQQRVDACMDLITS--HRNYQWLSNLITGDEKWVLYVN---YTRRRQWLS 178 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +G KAD K+M +V+W +G++ + L TIT+ Y L ++A+ L K Sbjct 179 AGQTGVATPKADLHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGK 238 Query 241 RPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSL 300 + RV HDNA H + TR L + W I HPPYSPDLAP+D+ LF +L L Sbjct 239 Q-----DRVYFLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDL 293 Query 301 KGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 + F ++VK + + + + F+ G+ R Q+ L+ +G Y+ + Sbjct 294 RDKKFDDESDVKTELVKFFDEKSQDFYERGIMSLPERWQQVLDSNGKYISE 344 >emb|CAA56858.1| planarian mariner-5 gene [Girardia tigrina] Length=339 Score = 158 bits (399), Expect = 5e-37, Method: Composition-based stats. Identities = 109/346 (31%), Positives = 178/346 (51%), Gaps = 13/346 (3%) Query 7 EARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRP 66 E R +K+ G + + VY A ++ V W RF+ G D+ ++ R GRP Sbjct 5 EIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDLSNQPR-GRP 63 Query 67 STSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKPL 126 + + + +A +E D +A +A+ ++ + L + K+ KL +WVP L Sbjct 64 EIKVDNDAL---KADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLD-KWVPHEL 119 Query 127 RPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGP 186 + + Q R + + +L++ DP FL RIVT E W+ YD ++ +S QWL Sbjct 120 KDEHKQQRLDACLSLLSRNKADP--FLHRIVTCGEKWI-MYD--NRKRSSQWLDPDEPPK 174 Query 187 VKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGKLH 246 K + K+M TV+W + G++ DF+ +ITS Y S L + + LA K+P K+ Sbjct 175 HCPKRKVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQP-KMF 233 Query 247 QRV--LLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTH 304 R+ +L HDNA HS+ T A L++ E +RHPPYSPDLAP+D+ F +L G + Sbjct 234 NRLTPILLHDNARPHSAKNTVAKLQQLGLETLRHPPYSPDLAPTDYHFFQSLDNFFSGKY 293 Query 305 FSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F+S VK +++S++ F+ GLN + Q+C++ G Y + Sbjct 294 FTSSGAVKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 339 >prf||1917335A mariner 1 element Length=338 Score = 158 bits (399), Expect = 5e-37, Method: Composition-based stats. Identities = 113/348 (32%), Positives = 181/348 (52%), Gaps = 18/348 (5%) Query 7 EARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRP 66 E R +K+ G + + VY A ++ V W RF+ G D+ ++ RS RP Sbjct 5 EIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDMSNQPRS-RP 63 Query 67 STSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKPL 126 + + + +A +E D +A +A+ ++ L + K+ KL +WVP L Sbjct 64 EIKVDNDAL---KADVEADSSQSALELASKFGVAKSIILIHLKQINKVKKLD-KWVPHEL 119 Query 127 RPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGP 186 + + Q R + + +L++ DP FL RIVT DE W+ YD ++ +S QWL P Sbjct 120 KDEHKQQRLDACLSLLSRNKADP--FLHRIVTCDEKWI-MYD--NRKRSSQWL---DDEP 171 Query 187 VK--AKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 K K + K+M TV+W + G++ DF+ +ITS Y S L + + LA K+P K Sbjct 172 PKHCPKRKVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQP-K 230 Query 245 LHQRV--LLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKG 302 + R+ +L HDNA HS+ T A L++ E +RHPPYSPDLAP+D+ F +L L G Sbjct 231 MFNRLTPILLHDNARPHSAKNTVAKLQQLGLETLRHPPYSPDLAPTDYHFFQSLDNFLSG 290 Query 303 THFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 +F+S VK +++S++ F+ GLN + Q+C++ G Y + Sbjct 291 KNFTSSGAVKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 338 >prf||2124399A transposase-like protein Length=340 Score = 157 bits (397), Expect = 8e-37, Method: Composition-based stats. Identities = 109/347 (31%), Positives = 173/347 (49%), Gaps = 12/347 (3%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G + V W +F KG + +EDE SG Sbjct 5 KKQIRAIFLFEFKMGHKAAETTRNISNAFGPGTANEHTVQWWFKKFCKGDESLEDEEYSG 64 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +RA+I+ D T +A ++ + L + K+ KL +WVP Sbjct 65 RPS----EVDNDQLRAIIKADPLTTRREVAEELEVDHSTVVQHLKQIGKVKKLD-KWVPH 119 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L + L R E+S IL + E FL +IVT DE W+ YD + + QWL R + Sbjct 120 ELSKNFLNCRFEVSSFILC---NNNEPFLDQIVTCDEKWIL-YD--NWRRPAQWLDREEA 173 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 K + + KVM TV+W A G++ FL TITS Y + ++ + L + Sbjct 174 PKHFPKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQLAL 233 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + T L E +E++ H PYSPDL+P+++ F +L L+G Sbjct 234 VNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHLPYSPDLSPTNYHFFKHLDNFLQGK 293 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ SQ F+ G+N R QKC++ +G+Y + Sbjct 294 RFHNQQDAENAFQEFVESQSTDFYATGINKLISRWQKCVDCNGSYFD 340 >gb|AAZ67091.1| transposase [Adineta vaga] Length=345 Score = 157 bits (396), Expect = 1e-36, Method: Composition-based stats. Identities = 106/351 (30%), Positives = 165/351 (47%), Gaps = 15/351 (4%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 MN + E R + +LG K E + G +W FK G +++D Sbjct 9 MNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDDL 68 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E ++ ++ LIEED RLT +A S + L E K K Sbjct 69 PRSGRP----MEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGV- 123 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 W+P L QLQ R + M+++ +L ++TGDE W+ + + +QWL Sbjct 124 WIPHELSAHQLQQRVDACMDLITS--HRNYQWLSNLITGDEKWVLYVN---YTRRRQWLS 178 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +G KAD K+M +V+W +G++ + L TIT+ Y L ++A+ L K Sbjct 179 AGQTGVATPKADLHSKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGK 238 Query 241 RPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSL 300 + RV HDNA H + TR L + W I HPPYSPDLAP+D+ LF +L L Sbjct 239 Q-----DRVYFLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDL 293 Query 301 KGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 + F ++VK + + + + F+ G+ R Q+ ++ +G Y+ + Sbjct 294 RDKKFDDESDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKYISE 344 >emb|CAA56859.1| planarian mariner-3 gene [Girardia tigrina] Length=339 Score = 156 bits (395), Expect = 2e-36, Method: Composition-based stats. Identities = 110/346 (31%), Positives = 178/346 (51%), Gaps = 13/346 (3%) Query 7 EARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRP 66 E R +K+ G + + VY A ++ V W RF+ G D+ ++ R GRP Sbjct 5 EIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDLSNQPR-GRP 63 Query 67 STSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKPL 126 + + + +A +E D +A +A+ ++ + L + K+ KL +WVP L Sbjct 64 EIKVDNDAL---KADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLD-KWVPHEL 119 Query 127 RPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGP 186 + + Q R + + +L++ DP FL RIVT DE W+ YD ++ +S QWL Sbjct 120 KDEHKQQRLDACLSLLSRNKADP--FLHRIVTCDEKWI-MYD--NRKRSSQWLDPDEPPK 174 Query 187 VKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGKLH 246 K + K+M TV+W + G++ DF+ +ITS Y S L + + LA K+P K+ Sbjct 175 HCPKRKVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQP-KMF 233 Query 247 QRV--LLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTH 304 R+ +L HDNA HS+ T A L++ E +RHP YSPDLAP+D F +L L G + Sbjct 234 NRLTPILLHDNARPHSAKNTVAKLQQLGLETLRHPTYSPDLAPTDCHFFQSLDNFLSGKN 293 Query 305 FSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F+S VK +++S++ F+ GLN + Q+C++ G Y + Sbjct 294 FTSSGAVKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 339 >emb|CAD26968.1| transposase [Meloidogyne chitwoodi] Length=340 Score = 154 bits (389), Expect = 8e-36, Method: Composition-based stats. Identities = 107/334 (32%), Positives = 170/334 (50%), Gaps = 14/334 (4%) Query 17 KLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRPSTSICEEKIN 76 +LG E ++K GDNA +S +W T+F+ G +D RSGRPST E Sbjct 16 QLGHTAAEAARNIKKALGDNALDESTARRWFTKFRTGDFSTDDGFRSGRPSTFETEP--- 72 Query 77 LVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKPLRPDQLQTRAE 136 +RA I E+ + +A S + + + E ++LS S R VP L + Q R E Sbjct 73 -LRAAINENPATSTRKLAEELGSSKDTVWRNMKE-MELSYRSGRTVPHDLNEQKRQKRVE 130 Query 137 LSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGPVKAKADWSRA 196 + +L + P FL +I+T DE+W+ YD ++A KQWL G K + Sbjct 131 ICRTLLQRQQTSP--FLDQILTCDESWIL-YD--NRASEKQWLAVGQDANATPKQLHPKK 185 Query 197 KVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGKLHQR--VLLHHD 254 +++ +V+W GI+ + L RTITS Y L ++ + L + P + R +L D Sbjct 186 QLL-SVWWCVHGIVYWELLPLNRTITSEVYCEQLHRVQQQL-RRPPYTVWARKGILFQQD 243 Query 255 NAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTHFSSVNNVKKT 314 A H S TR + + W+I+ H PYSPDLAPSD++LF LK L+G FS+ + Sbjct 244 GARPHVSAVTRKKIEDLGWDILEHSPYSPDLAPSDYYLFSPLKDFLRGKQFSNEEEICTA 303 Query 315 ALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAY 348 + +S+ P+++R G+ + ++C++ +G Y Sbjct 304 LKNFFDSKGPEWYRKGIEKLPNLWERCIQCNGNY 337 >gb|AAZ67093.1| transposase [Adineta vaga] Length=345 Score = 154 bits (389), Expect = 8e-36, Method: Composition-based stats. Identities = 105/351 (29%), Positives = 164/351 (46%), Gaps = 15/351 (4%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 MN + E R + +LG K E + G +W FK G +++D Sbjct 9 MNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDDL 68 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E ++ ++ LIEED RLT +A S + L E K K Sbjct 69 PRSGRP----MEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGV- 123 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 W+P L QLQ R + M+++ +L ++TGDE W+ + + +QWL Sbjct 124 WIPHELSAHQLQQRVDACMDLITS--HRNYQWLSNLITGDEKWVLYVN---YTRRRQWLS 178 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +G KAD K+M +V+W +G++ + L TIT+ Y L ++A+ L K Sbjct 179 AGQTGVATPKADLHSKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGK 238 Query 241 RPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSL 300 + RV HDNA H + TR L + W I HPPYSPDLAP+D+ LF +L L Sbjct 239 Q-----DRVYFLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDL 293 Query 301 KGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 + F ++VK + + + + F+ G+ R Q+ ++ + Y+ + Sbjct 294 RDKKFDDESDVKTELVKFFDEKSQDFYERGIMSLPERWQEVVDSNSKYISE 344 >gb|AAZ67098.1| transposase [Adineta vaga] Length=345 Score = 154 bits (388), Expect = 9e-36, Method: Composition-based stats. Identities = 105/349 (30%), Positives = 163/349 (46%), Gaps = 15/349 (4%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 MN + E R + +LG K E + G +W FK G +++D Sbjct 9 MNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDDL 68 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E ++ ++ LIEED RLT +A S + L E K K Sbjct 69 PRSGRP----MEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGV- 123 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 W+P L QLQ R + M+++ +L ++TGDE W+ + + +QWL Sbjct 124 WIPHELSAHQLQQRVDACMDLITS--HRNYQWLSNLITGDEKWVLYVN---YTRRRQWLS 178 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +G KAD K + +V+W +G++ + L TIT+ Y L ++A+ L K Sbjct 179 AGQTGVATPKADSHSKKFILSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGK 238 Query 241 RPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSL 300 + RV HDNA H + TR L + W I HPPYSPDLAP+D+ LF +L L Sbjct 239 Q-----DRVYFLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDL 293 Query 301 KGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 + F ++VK + + + + F+ G+ R Q+ ++ +G Y+ Sbjct 294 RDKKFDDESDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKYI 342 >gb|AAZ67094.1| transposase [Adineta vaga] Length=345 Score = 154 bits (388), Expect = 1e-35, Method: Composition-based stats. Identities = 105/351 (29%), Positives = 165/351 (47%), Gaps = 15/351 (4%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 MN + E R + +LG K E + G +W FK G +++D Sbjct 9 MNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDDL 68 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E ++ ++ LIEED RLT +A S + L E K K Sbjct 69 PRSGRP----MEVGVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVGKHLNELGKTWKYGV- 123 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 W+P L QLQ + M+++ + +L ++TGDE W+ + + +QWL Sbjct 124 WIPYELSAHQLQQGVDACMDLITFYRN--YQWLSNLITGDEKWVLYVN---YTRRRQWLS 178 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +G KAD K+M +V+W +G++ + L TIT+ Y L ++A+ L K Sbjct 179 AGQTGVATPKADLHSKKLMLSVWWGIKGVIRWEVLPNGYTITADLYCQQLDRVAEKLKGK 238 Query 241 RPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSL 300 + RV HDNA H + TR L + W I HPPYSPDLAP+D+ LF +L L Sbjct 239 Q-----DRVYFLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDL 293 Query 301 KGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 + F ++VK + + + + F+ G+ R Q+ ++ +G Y+ + Sbjct 294 RDKKFDDESDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKYISE 344 >gb|AAZ67096.1| transposase [Adineta vaga] Length=345 Score = 154 bits (388), Expect = 1e-35, Method: Composition-based stats. Identities = 105/349 (30%), Positives = 163/349 (46%), Gaps = 15/349 (4%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 MN + E R + +LG K E + G +W FK G +++D Sbjct 9 MNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDDL 68 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E ++ ++ LIEED RLT +A S + L E K K Sbjct 69 PRSGRP----MEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGV- 123 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 W+P L QLQ R + M+++ +L ++TGDE W+ + + +QWL Sbjct 124 WIPHELSAHQLQQRVDACMDLITS--HRNYQWLSNLITGDEKWVLYVN---YTRRRQWLS 178 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +G KAD K+M +V+W +G++ + L TIT+ Y L ++A+ L K Sbjct 179 AGQTGVATPKADLHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGK 238 Query 241 RPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSL 300 + RV HDNA H + T L + W I HPPYSPDLAP+D+ LF +L L Sbjct 239 Q-----DRVYFLHDNARPHVAKSTSEKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDL 293 Query 301 KGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 + F ++VK + + + + F+ G+ R Q+ ++ +G Y+ Sbjct 294 RDKKFDDESDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKYI 342 >emb|CAA56857.1| planarian mariner-8 gene [Girardia tigrina] Length=339 Score = 154 bits (388), Expect = 1e-35, Method: Composition-based stats. Identities = 108/346 (31%), Positives = 178/346 (51%), Gaps = 13/346 (3%) Query 7 EARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRP 66 E R +K+ G + + VY A ++ V W RF+ G D+ ++ R GRP Sbjct 5 EIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDLSNQPR-GRP 63 Query 67 STSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKPL 126 + + + +A +E D +A +A+ ++ + L + K+ KL +WVP L Sbjct 64 EIKVDNDAL---KADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLD-KWVPHEL 119 Query 127 RPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGP 186 + + Q R + + +L++ DP FL RIVT DE W+ YD ++ +S QWL Sbjct 120 KDEHKQQRLDACLSLLSRNKADP--FLHRIVTCDEKWI-MYD--NRKRSSQWLDPDEPPK 174 Query 187 VKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGKLH 246 K + K+M TV+W + G++ DF+ +ITS Y S L + + LA K+ K+ Sbjct 175 HCPKRKVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQ-AKMF 233 Query 247 QRV--LLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTH 304 R+ +L +DNA HS+ T A ++ E +RHPPYSPDLAP+D+ F +L L G + Sbjct 234 NRLTPILLYDNARPHSAKNTVAKRQQLGLETLRHPPYSPDLAPTDYHFFQSLDNFLSGKN 293 Query 305 FSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F+S VK +++S++ F+ GLN + Q+C++ G Y + Sbjct 294 FTSSGAVKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 339 >gb|AAZ67097.1| transposase [Adineta vaga] Length=345 Score = 153 bits (387), Expect = 1e-35, Method: Composition-based stats. Identities = 105/349 (30%), Positives = 163/349 (46%), Gaps = 15/349 (4%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 MN + E R + +LG K E + G +W FK G +++D Sbjct 9 MNLSHREVRVLLLHEFRLGRKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDDL 68 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E ++ ++ LIEED RLT +A S + L E K K Sbjct 69 PRSGRP----MEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGV- 123 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 W+P L QLQ R + M+++ +L ++TGDE W+ + + +QWL Sbjct 124 WIPHELSAHQLQQRVDACMDLITS--HRNYQWLSNLITGDEKWVLYVN---YTRRRQWLS 178 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +G KAD K+M +V+W +G++ + L TIT+ Y L ++A+ L K Sbjct 179 AGQTGVATPKADLHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGK 238 Query 241 RPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSL 300 + RV HDNA H + T L + W I HPPYSPDLAP+D+ LF +L L Sbjct 239 Q-----DRVYFLHDNARPHVAKSTSEKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDL 293 Query 301 KGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 + F ++VK + + + + F+ G+ R Q+ ++ +G Y+ Sbjct 294 RDKKFDDESDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKYI 342 >emb|CAA56763.1| manirer-2 [Girardia tigrina] Length=365 Score = 153 bits (386), Expect = 2e-35, Method: Composition-based stats. Identities = 107/339 (31%), Positives = 175/339 (51%), Gaps = 13/339 (3%) Query 7 EARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRP 66 E R +K+ G + + VY A ++ V W RF+ G D+ ++ R GRP Sbjct 5 EIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDLSNQPR-GRP 63 Query 67 STSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKPL 126 + + + +A +E D +A +A+ ++ + L + K+ KL +WVP L Sbjct 64 EIKVDNDAL---KADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLD-KWVPHEL 119 Query 127 RPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGP 186 + + Q R + + +L++ DP FL RI+T DE W+ YD ++ +S QWL Sbjct 120 KDEHKQQRLDACLSLLSRNKADP--FLHRIMTCDEKWI-MYD--NRKRSSQWLDPDEPPK 174 Query 187 VKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGKLH 246 K + K+M TV+W + G++ DF+ +ITS Y S L + + LA K+P K+ Sbjct 175 HCPKRKVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQP-KMF 233 Query 247 QRV--LLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTH 304 R+ +L HDNA HS+ T A L++ E +RHP YSPDLAP+D F +L L G + Sbjct 234 NRLTPILLHDNARPHSAKNTVAKLQQLGLETLRHPTYSPDLAPTDCHFFQSLDNFLSGKN 293 Query 305 FSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLE 343 F+S VK +++S++ F+ GLN + Q+C++ Sbjct 294 FTSSGAVKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVD 332 >gb|AAZ67095.1| transposase [Adineta vaga] Length=345 Score = 152 bits (385), Expect = 2e-35, Method: Composition-based stats. Identities = 107/352 (30%), Positives = 165/352 (46%), Gaps = 17/352 (4%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 +N + E R + +LG K E + G +W FK G +++D Sbjct 9 INLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDDL 68 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E ++ ++ LIEED RLT +A S + L E K K Sbjct 69 PRSGRP----MEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGV- 123 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETW-LYQYDPEDKAQSKQWL 179 W+P L QLQ R + M+++ +L ++TGDE W LY P + +QWL Sbjct 124 WIPHELSAHQLQQRVDACMDLITS--HRNYQWLSNLITGDEKWVLYVNYP----RRRQWL 177 Query 180 PRGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAE 239 G +G KAD K+M +V+W +G++ + L TIT+ Y L ++A+ L Sbjct 178 SAGQTGVATPKADLHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKG 237 Query 240 KRPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKS 299 K+ RV HDNA H + R L + W I HPPYSPDLAP+D+ LF +L Sbjct 238 KQ-----DRVYFLHDNARPHVAKSAREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSND 292 Query 300 LKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 L+ F ++VK + + + + F+ G+ R Q+ ++ +G Y+ + Sbjct 293 LRDKKFDDESDVKTELVKFFDEKSQDFYERGIMPLPERWQQVVDSNGKYISE 344 >gb|AAZ67101.1| transposase [Adineta vaga] Length=345 Score = 152 bits (383), Expect = 3e-35, Method: Composition-based stats. Identities = 104/351 (29%), Positives = 165/351 (47%), Gaps = 15/351 (4%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 MN + E R + +LG K E + + + G +W FK G +++D Sbjct 9 MNLSYREVRVLLLHEFRLGNKATEAANNICGMMGQGLVSTRTAQRWFNHFKNGDLELDDL 68 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGR E ++ ++ LIEED RLT +A S + L E K K Sbjct 69 PRSGRS----MEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGV- 123 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 W+P L QLQ R + M+++ +L ++TGDE W+ + + +QWL Sbjct 124 WIPHELSAHQLQQRVDACMDLITS--HRNYQWLSNLITGDEKWVLYVN---YTRRRQWLS 178 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +G KAD K M +++W +G++ + L TIT+ Y L ++A+ L K Sbjct 179 AGQTGVATPKADLHPKKSMLSIWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGK 238 Query 241 RPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSL 300 + RV HDNA H + TR L + W I HPPYSPDLAP+D+ LF +L L Sbjct 239 Q-----DRVYFLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDL 293 Query 301 KGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351 + F ++VK + + + + F+ G+ R Q+ ++ +G Y+ + Sbjct 294 RNKKFDDESDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKYISE 344 >gb|AAZ67099.1| transposase [Adineta vaga] Length=345 Score = 151 bits (381), Expect = 7e-35, Method: Composition-based stats. Identities = 103/349 (29%), Positives = 161/349 (46%), Gaps = 15/349 (4%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 MN E R + +LG K E + G +W FK G +++D Sbjct 9 MNLPHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDDS 68 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E ++ ++ LIEED RLT +A S + L E K K Sbjct 69 PRSGRP----MEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGV- 123 Query 121 WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLP 180 W+P L QLQ R + M+++ +L ++TGDE W+ + + +QWL Sbjct 124 WIPHELSAHQLQQRVDACMDLITS--HRNYQWLSNLITGDEKWVLYVN---YTRRRQWLS 178 Query 181 RGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEK 240 G +G KAD+ K + +V+W +G++ + L IT+ Y L ++ + L K Sbjct 179 AGQTGVATPKADFHSKKFILSVWWGFKGVIHWEVLPNGYPITADLYCQQLDRVPEKLKGK 238 Query 241 RPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSL 300 + RV HDNA H + TR L + W I HPPYSPDLAP+D+ LF +L L Sbjct 239 Q-----DRVYFLHDNARPHVAKSTREELLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDL 293 Query 301 KGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 + F ++VK + + + + F+ G+ R Q+ ++ +G Y+ Sbjct 294 RDKKFDDESDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKYI 342 >dbj|BAA23532.1| transposase [Bombyx mori] Length=338 Score = 150 bits (379), Expect = 1e-34, Method: Composition-based stats. Identities = 110/334 (32%), Positives = 173/334 (51%), Gaps = 14/334 (4%) Query 19 GWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRPSTSICEEKINLV 78 G E T + VYG K+S V W RF+ G D++++ R GRP T + E++ Sbjct 17 GTSAAETTQRINDVYGAGVAKESTVRFWFQRFRSGNFDLQNQPR-GRPETKVKNEEL--- 72 Query 79 RALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKPLRPDQLQTRAELS 138 +A++E D+ + I +S + L + K+ KL RWVP L LQTR + Sbjct 73 KAIVEADQSQSTSEIVAGFGVSDKTVLIHLKQIGKVKKLE-RWVPHELSESNLQTRIDCC 131 Query 139 MEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGSGPVKAKADWSRAKV 198 + +LN+ E L RI T DE + YD ++ + QWL G K ++ K+ Sbjct 132 VTLLNR--HYNEGILNRINTCDEKGVL-YD--NRKRLSQWLNPGDPAKSYPKRKLTQKKL 186 Query 199 MATVFWDA-QGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGKLHQ-RVLLHHDNA 256 + +V+W + ++ FL+ +TIT+ Y L+ + + LA K+P +++ R LL HDNA Sbjct 187 LVSVWWTSIASVVHYSFLKSGQTITADIYCQQLQTMKEELAAKQPRLVNRSRPLLLHDNA 246 Query 257 PAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTHFSSVNNVKKTAL 316 H++ QT L E + +RHPPYS DLAP D+ F NL L+ +S V+ Sbjct 247 RPHTAQQTTTKLDELQLACLRHPPYS-DLAPIDYHFFLNLDNFLQ-KKINSDAAVQTAFK 304 Query 317 TWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 +++S+ FF G+N RLQKC++ +GAY + Sbjct 305 EFIDSRYHGFFSKGINELPKRLQKCIDNNGAYFD 338 >ref|NP_001077195.1| Gene info hypothetical protein LOC534913 [Bos taurus] gb|AAI34646.1| Gene info Unknown (protein for MGC:151518) [Bos taurus] Length=343 Score = 150 bits (378), Expect = 2e-34, Method: Composition-based stats. Identities = 103/347 (29%), Positives = 171/347 (49%), Gaps = 17/347 (4%) Query 5 KIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSG 64 K + R F K+G K E T + +G K+ V W +F+KG + +ED+ RS Sbjct 13 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTAKERTVQWWFKKFRKGDESLEDDERSA 72 Query 65 RPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPK 124 RPS E + +R +I+ D T IA ++ + L + K+ KL+ +WVP Sbjct 73 RPS----EVDNDQLREIIDADPLKTTRKIAEELKVNHSTVVRHLKQIGKVKKLN-KWVPH 127 Query 125 PLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGGS 184 L Q R E+S ++ + +P FL RIVT E W+ +++ Q Q L RG + Sbjct 128 ELTEIQKNRRFEVSSSLILRNKNEP--FLDRIVTCHEKWILS---DNQRQPAQRLDRGKT 182 Query 185 GPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPGK 244 + K K+M TV+W A G++ FL TITS Y + ++ + L +P Sbjct 183 LNLYQK------KIMVTVWWSAAGLIHYSFLNPGETITSEKYAQQINEMHQKLQHLQPAL 236 Query 245 LHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 ++++ +L HDNA H + E +E++ HPP+SPDL P+ + F +L L+G Sbjct 237 VNRKGPVLLHDNARPHVAQPALQKFNELGYEVLPHPPHSPDLLPTHYHFFKHLDNFLQGK 296 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVE 350 F + + + ++ S+ F+ G+N R QKC++ +G+Y + Sbjct 297 RFHNQQDAENAFQEFVESRSTGFYATGINELTSRWQKCVDCNGSYFD 343 >gb|AAZ67106.1| transposase [Adineta vaga] Length=345 Score = 147 bits (371), Expect = 9e-34, Method: Composition-based stats. Identities = 105/352 (29%), Positives = 165/352 (46%), Gaps = 21/352 (5%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 MN ++ E + +LG K E + + G++ W RFK G ++ D Sbjct 9 MNLSRREILVLLLHEFRLGHKATEAANNICSTMGEDVLSTRTAQHWFNRFKNGNLELNDL 68 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTR 120 RSGRP E ++L++ LIE+D RLT +A +G +Y + + LK + + Sbjct 69 LRSGRP----LEVDVDLLQQLIEQDPRLTLRCLAE----HLGCSYVAVEKHLKELGKTWK 120 Query 121 ---WVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQ 177 W+P L QLQ R + M+++ +LR ++TGDE W+ + +Q Sbjct 121 YGVWIPHELSSHQLQHRVDACMDLMTS--HRNYEWLRNLITGDEKWVLYVN---YTHRRQ 175 Query 178 WLPRGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKAL 237 WL G +G K D KVM +V+W GI+ +FL TIT+ Y L ++A+ L Sbjct 176 WLSPGQTGVATPKPDLHPKKVMLSVWWGVNGIIHWEFLPNGCTITADLYCQQLDRVAQKL 235 Query 238 AEKRPGKLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLK 297 K+ RV HDNA + T L + W + HPPYSPDLAP+D+ LF +L Sbjct 236 NGKQ-----DRVYYLHDNARPRVAKLTCEKLLKLGWINVPHPPYSPDLAPTDYHLFRSLS 290 Query 298 KSLKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYV 349 L+ F N++K + + F G+ R ++ ++ GAY+ Sbjct 291 HHLREKKFDDDNDMKMDISNFFGRKSKDFHERGILSLPERWRQVIDSGGAYI 342 >pir||T32726 hypothetical protein C45H4.5 - Caenorhabditis elegans Length=573 Score = 147 bits (370), Expect = 1e-33, Method: Composition-based stats. Identities = 104/328 (31%), Positives = 160/328 (48%), Gaps = 21/328 (6%) Query 7 EARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDEARSGRP 66 + R + + +LG E + G+ A + W +FK G +E+ RSGRP Sbjct 115 DVRLLLLYEFRLGQSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIERSGRP 174 Query 67 STSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLSTRWVPKPL 126 + EE +LV+ L+EE+ RL+ + + + L SKL WVP L Sbjct 175 -VELNEE--DLVK-LVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGI-WVPHEL 229 Query 127 RPDQLQTRAELSMEILN---KWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQWLPRGG 183 Q TR + ++L K+D +L +VTGDE W+ + ++ +QWLP G Sbjct 230 SASQKLTRVNVCTQLLTFRRKFD-----WLNNLVTGDEKWVLYVN---HSRKRQWLPIGE 281 Query 184 SGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALAEKRPG 243 G K D K+M V+W QG + + L +TIT+ YY + L ++A EK G Sbjct 282 KGIPTPKPDLHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVA----EKTNG 337 Query 244 KLHQRVLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGT 303 K Q LH DNA H + +T L++ W ++ HPPYSPDLAP+D+ LF +L ++ Sbjct 338 KYEQLYFLH-DNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDK 396 Query 304 HFSSVNNVKKTALTWLNSQDPQFFRDGL 331 F ++K T+ +S+ P FF G+ Sbjct 397 QFDDEEHLKTELSTFFSSRSPDFFSRGI 424 >ref|XP_001121351.1| Gene info PREDICTED: similar to SET domain and mariner transposase fusion [Apis mellifera] Length=342 Score = 147 bits (370), Expect = 1e-33, Method: Composition-based stats. Identities = 103/345 (29%), Positives = 172/345 (49%), Gaps = 19/345 (5%) Query 1 MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVEDE 60 M + K+ R I + + G E L K++ ++ +W +F+ D D+ Sbjct 1 MATDKVHLRHCILYEFQQGRNATEACRNLLKMFEGTVSDRTC-RRWYEKFETSDFDFSDK 59 Query 61 ARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTE---KLKLSKL 117 RSGRPS N+V+A++E+D LT IA + SA I+++ K+ L Sbjct 60 LRSGRPSLI----DDNVVKAMLEQDPFLTTSEIAE----RLNSAQQIISDHIRKIGLGWK 111 Query 118 STRWVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQ 177 +RWVP L L R + +L + +P FL R++TGDE W+ + + + Sbjct 112 YSRWVPHELSQKNLDDRVVICTFLLARNKIEP--FLNRMITGDEKWIIY---NNIVRKRT 166 Query 178 WLPRGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITS-AYYESVLRKLAKA 236 + G P +K + + K M ++WD +G + + L+ + S +Y L L A Sbjct 167 YCELGKPSPSTSKPNLTLNKRMLCIWWDIRGPIHYELLKPNEKLNSEKFYCQQLDNLKTA 226 Query 237 LAEKRPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPN 295 + +KRP +++ ++LHHDNA H++ R + E WEI+ HPPYSPD+A SD+ LF + Sbjct 227 VQKKRPAMFNRKDIILHHDNARPHAALGARQKIAEVGWEILSHPPYSPDIALSDYHLFLS 286 Query 296 LKKSLKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQK 340 L+ L F + +VK+ + + S+D FF++G+ R QK Sbjct 287 LQNFLTSKKFKNKEDVKQALVQFFASKDETFFKNGIYKLPSRWQK 331
  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding 
environmental samples from WGS projects
    Posted date:  May 20, 2007  4:45 PM
  Number of letters in database: 1,719,627,930
  Number of sequences in database:  4,970,641
Lambda     K      H
   0.317    0.133    0.405 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4970641
Number of Hits to DB: 59891117
Number of extensions: 2453462
Number of successful extensions: 6712
Number of sequences better than 10: 8
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 6779
Number of HSP's successfully gapped: 8
Length of query: 351
Length of database: 1719627930
Length adjustment: 133
Effective length of query: 218
Effective length of database: 1058532677
Effective search space: 230760123586
Effective search space used: 230760123586
T: 11
A: 40
X1: 16 (7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 78 (34.7 bits)