Job Title: Protein sequence(343 letters)

Show Conserved Domains

RID=5NWNBJJM012, BLASTP 2.2.16 (Mar-25-2007)
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 5NWNBJJM012


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           4,984,388 sequences; 1,723,618,044 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports

Query=  
Length=343


Distance tree of resultsNew  
Score E Sequences producing significant alignments: (Bits) Value gb|AAC52010.1| mariner transposase [Homo sapiens] 689 0.0 Gene info gb|EAW63905.1| SET domain and mariner transposase fusion gene... 683 0.0 Gene info sp|Q53H47|SETMR_HUMAN Histone-lysine N-methyltransferase SETM... 682 0.0 Gene info gb|AAC09350.1| unknown [Homo sapiens] 680 0.0 UniGene infoGene info ref|XP_526121.2| PREDICTED: SET domain and mariner transposas... 680 0.0 Gene info ref|NP_006506.1| SET domain and mariner transposase fusion [H... 679 0.0 UniGene infoGene info ref|XP_001099426.1| PREDICTED: similar to SET domain and mari... 678 0.0 Gene info gb|ABC72090.1| SETMAR [Pongo pygmaeus] 669 0.0 gb|ABC72091.1| SETMAR [Symphalangus syndactylus] 668 0.0 dbj|BAE87709.1| unnamed protein product [Macaca fascicularis] 665 0.0 UniGene info gb|ABC72089.1| SETMAR [Gorilla gorilla] 665 0.0 gb|EAW63904.1| SET domain and mariner transposase fusion gene... 665 0.0 Gene info gb|ABC72092.1| SETMAR [Cercopithecus aethiops] 665 0.0 gb|ABC72088.1| SETMAR [Pan troglodytes] 662 0.0 gb|ABC72093.1| SETMAR [Aotus trivirgatus] 661 0.0 gb|AAH08931.2| SETMAR protein [Homo sapiens] 661 0.0 UniGene infoGene info gb|ABC72087.1| SETMAR [Homo sapiens] 654 0.0 Gene info prf||2124399A transposase-like protein 639 0.0 ref|NP_001077195.1| hypothetical protein LOC534913 [Bos tauru... 589 6e-167 Gene info emb|CAA56856.1| planarian mariner-9 gene [Girardia tigrina] 369 2e-100 emb|CAA50801.1| mariner-1 protein [Girardia tigrina] 367 5e-100 emb|CAA56858.1| planarian mariner-5 gene [Girardia tigrina] 367 7e-100 emb|CAA56859.1| planarian mariner-3 gene [Girardia tigrina] 364 4e-99 prf||1917335A mariner 1 element 364 5e-99 emb|CAA56857.1| planarian mariner-8 gene [Girardia tigrina] 363 1e-98 emb|CAA56763.1| manirer-2 [Girardia tigrina] 354 4e-96 dbj|BAA21826.1| transposase [Attacus atlas] >dbj|BAB32436.1| ... 345 2e-93 dbj|BAA23532.1| transposase [Bombyx mori] 335 2e-90 gb|AAP51085.1| transposase [Forficula auricularia] 312 2e-83 gb|AAP51087.1| transposase [Forficula auricularia] 311 4e-83 gb|AAP51098.1| transposase [Forficula auricularia] >gb|AAP510... 310 8e-83 gb|AAP51096.1| transposase [Forficula auricularia] 309 2e-82 gb|AAP51090.1| transposase [Forficula auricularia] >gb|AAP510... 309 2e-82 gb|AAP51086.1| transposase [Forficula auricularia] 308 2e-82 gb|AAP51093.1| transposase [Forficula auricularia] 308 3e-82 gb|AAP51092.1| transposase [Forficula auricularia] 308 4e-82 gb|AAP51091.1| transposase [Forficula auricularia] 308 4e-82 gb|AAO12863.1| Famar1 transposase [Forficula auricularia] 307 5e-82 gb|AAP51097.1| transposase [Forficula auricularia] 306 8e-82 gb|AAO12864.1| Ccmar2 transposase [Ceratitis capitata] 306 8e-82 gb|AAP51095.1| transposase [Forficula auricularia] 306 9e-82 gb|AAP51083.1| transposase [Forficula auricularia] 306 9e-82 ref|NP_001073580.1| Ammar1 transposase [Apis mellifera] >gb|A... 305 2e-81 UniGene infoGene info gb|AAB17945.1| mariner transposase [Ceratitis capitata] 305 3e-81 gb|AAP51089.1| transposase [Forficula auricularia] 304 4e-81 gb|AAO12862.1| Camar1 transposase [Chymomyza amoena] 303 9e-81 gb|AAZ67097.1| transposase [Adineta vaga] 302 2e-80 gb|AAP51082.1| transposase [Forficula auricularia] 302 2e-80 gb|AAP51084.1| transposase [Forficula auricularia] 302 2e-80 gb|AAP51088.1| transposase [Forficula auricularia] 301 5e-80 gb|AAZ67091.1| transposase [Adineta vaga] 300 7e-80 gb|AAZ67096.1| transposase [Adineta vaga] 300 8e-80 gb|AAZ67092.1| transposase [Adineta vaga] 298 2e-79 pir||T25365 hypothetical protein T27E7.7 - Caenorhabditis elegan 298 2e-79 pir||T19261 hypothetical protein C14A6.4 - Caenorhabditis elegan 298 2e-79 pir||T19660 hypothetical protein C33A12.5 - Caenorhabditis elega 298 3e-79 pir||T23086 hypothetical protein H12I19.6 - Caenorhabditis elega 298 3e-79 pir||T19600 probable transposition protein C31A11.2 - Caenorh... 298 4e-79 pir||T32726 hypothetical protein C45H4.5 - Caenorhabditis elegan 298 4e-79 pir||T19555 hypothetical protein C29E6.6 - Caenorhabditis elegan 298 4e-79 pir||T27435 hypothetical protein Y7A5A.4 - Caenorhabditis elegan 297 5e-79 pir||T18783 hypothetical protein B0564.5 - Caenorhabditis elegan 297 5e-79 pir||T22780 hypothetical protein F56D5.7 - Caenorhabditis elegan 297 5e-79 pir||T20782 hypothetical protein F11D11.9 - Caenorhabditis elega 297 5e-79 gb|AAZ67093.1| transposase [Adineta vaga] 297 6e-79 gb|AAF60591.1| Hypothetical protein Y45G12C.13 [Caenorhabditis e 297 6e-79 pir||T26396 hypothetical protein Y105C5B.t - Caenorhabditis eleg 297 7e-79 gb|AAB00629.1| Hypothetical protein R05G6.2 [Caenorhabditis eleg 296 1e-78 pir||T25335 hypothetical protein T26H8.1 - Caenorhabditis elegan 296 1e-78 pir||T20442 hypothetical protein E03H4.1 - Caenorhabditis elegan 296 1e-78 gb|AAZ67098.1| transposase [Adineta vaga] 295 2e-78 pir||T18779 transposase containing protein - Caenorhabditis eleg 295 2e-78 gb|AAZ67101.1| transposase [Adineta vaga] 295 2e-78 gb|AAZ67095.1| transposase [Adineta vaga] 295 3e-78 pir||T32676 hypothetical protein K07C6.12 - Caenorhabditis elega 295 3e-78 pir||T24136 hypothetical protein R10E4.8 - Caenorhabditis elegan 293 1e-77 gb|AAZ67099.1| transposase [Adineta vaga] 291 3e-77 emb|CAA56855.1| planarian mariner-0 gene [Girardia tigrina] 290 6e-77 gb|AAZ67094.1| transposase [Adineta vaga] 290 1e-76 pir||T27281 hypothetical protein Y64G10A.d - Caenorhabditis eleg 289 1e-76 gb|AAZ67103.1| transposase [Adineta vaga] 289 1e-76 ref|XP_001121351.1| PREDICTED: similar to SET domain and mari... 289 2e-76 Gene info pir||T27715 hypothetical protein ZK1225.3 - Caenorhabditis elega 288 3e-76 emb|CAD26968.1| transposase [Meloidogyne chitwoodi] 287 6e-76 gb|AAZ67102.1| transposase [Adineta vaga] 283 9e-75 gb|AAZ67105.1| transposase [Adineta vaga] 282 2e-74 dbj|BAB86288.1| mariner transposase [Apis cerana] 282 2e-74 gb|AAZ67100.1| transposase [Adineta vaga] 279 1e-73 dbj|BAE88734.1| unnamed protein product [Macaca fascicularis] 278 2e-73 UniGene info pir||T18991 hypothetical protein C06B8.5 - Caenorhabditis elegan 278 4e-73 gb|AAZ67106.1| transposase [Adineta vaga] 276 1e-72 gb|AAF60722.1| Hypothetical protein Y49F6A.4 [Caenorhabditis ele 273 1e-71 ref|XP_001120719.1| PREDICTED: similar to T12B5.6 [Apis mellifer 272 2e-71 Gene info gb|AAN86602.1| transposase [Carpelimus sp. HMR-1993] 268 4e-70 gb|AAB61385.1| transposase [Hydra littoralis] 263 8e-69 gb|AAA66077.1| transposase [Mayetiola destructor] 261 3e-68 gb|AAC16613.1| transposase [Drosophila simulans] 257 8e-67 gb|AAC28162.1| mariner transposase [Glossina palpalis] 256 1e-66 emb|CAH03740.1| transposase [Messor bouvieri] 256 2e-66 pir||T29572 hypothetical protein F30B5.5 - Caenorhabditis elegan 255 3e-66
Alignments
>gb|AAC52010.1| Gene info mariner transposase [Homo sapiens] Length=343 Score = 689 bits (1777), Expect = 0.0, Method: Composition-based stats. Identities = 343/343 (100%), Positives = 343/343 (100%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP Sbjct 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF Sbjct 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK Sbjct 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN Sbjct 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD Sbjct 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 >gb|EAW63905.1| Gene info SET domain and mariner transposase fusion gene, isoform CRA_c [Homo sapiens] Length=684 Score = 683 bits (1763), Expect = 0.0, Method: Composition-based stats. Identities = 324/343 (94%), Positives = 337/343 (98%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 M+MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 342 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 401 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQIGKVKKLDKWVP Sbjct 402 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVP 461 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+ENQKNRRFEVSSSLILRN+NEPFLDRIVTCDEKWILYDNRRR AQWLD+EEAPKHF Sbjct 462 HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF 521 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 PKP LH KKVMVT+WWSAAGLIHYSFLNPGETITSEKYAQ+IDEM++KLQRLQ ALVNRK Sbjct 522 PKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRK 581 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHN Sbjct 582 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHN 641 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAFQEFVES+STDFYATGIN+LISRWQKCVDCNGSYFD Sbjct 642 QQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 684 >sp|Q53H47|SETMR_HUMAN Gene info Histone-lysine N-methyltransferase SETMAR (SET domain and mariner transposase fusion gene-containing protein) (Metnase) (Hsmar1) [Includes: Histone-lysine N-methyltransferase; Mariner transposase Hsmar1] dbj|BAD96454.1| UniGene infoGene info SET domain and mariner transposase fusion gene variant [Homo sapiens] gb|AAY29570.1| UniGene infoGene info metnase [Homo sapiens] Length=671 Score = 682 bits (1761), Expect = 0.0, Method: Composition-based stats. Identities = 324/343 (94%), Positives = 337/343 (98%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 M+MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 329 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 388 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQIGKVKKLDKWVP Sbjct 389 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVP 448 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+ENQKNRRFEVSSSLILRN+NEPFLDRIVTCDEKWILYDNRRR AQWLD+EEAPKHF Sbjct 449 HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF 508 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 PKP LH KKVMVT+WWSAAGLIHYSFLNPGETITSEKYAQ+IDEM++KLQRLQ ALVNRK Sbjct 509 PKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRK 568 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHN Sbjct 569 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHN 628 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAFQEFVES+STDFYATGIN+LISRWQKCVDCNGSYFD Sbjct 629 QQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 >gb|AAC09350.1| UniGene infoGene info unknown [Homo sapiens] Length=671 Score = 680 bits (1754), Expect = 0.0, Method: Composition-based stats. Identities = 323/343 (94%), Positives = 336/343 (97%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 M+MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 329 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 388 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQIGKVKKLDKWVP Sbjct 389 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVP 448 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+ENQKNRRFEVSSSLILRN+NEPFLDRIVTCDEKWILYDNRRR AQWLD+EEAPKHF Sbjct 449 HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF 508 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 PKP LH KKVMVT+WWSAAGLIHYSFLNPGETITSEKYAQ+IDEM++KLQRLQ ALVNRK Sbjct 509 PKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRK 568 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHN Sbjct 569 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHN 628 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAFQEFVES+STDFYATGIN+LI RWQKCVDCNGSYFD Sbjct 629 QQDAENAFQEFVESQSTDFYATGINQLIFRWQKCVDCNGSYFD 671 >ref|XP_526121.2| Gene info PREDICTED: SET domain and mariner transposase fusion [Pan troglodytes] Length=684 Score = 680 bits (1754), Expect = 0.0, Method: Composition-based stats. Identities = 322/343 (93%), Positives = 336/343 (97%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 M+MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 342 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 401 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQIGKVKKLDKWVP Sbjct 402 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVP 461 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+ENQKNRRFEVSSSLILRN+NEPFLDRIVTCDEKWILYDNRRR AQWLD+EEAPKHF Sbjct 462 HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF 521 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 PKP LH KKVMVT+WWSAAGLIHYSFLNPGETITSEKYAQ+IDEM++KLQRLQ ALVNRK Sbjct 522 PKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRK 581 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHN Sbjct 582 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHN 641 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAF+EFVES+STDFY TGIN+LISRWQKCVDCNGSYFD Sbjct 642 QQDAENAFREFVESQSTDFYTTGINQLISRWQKCVDCNGSYFD 684 >ref|NP_006506.1| UniGene infoGene info SET domain and mariner transposase fusion [Homo sapiens] gb|AAC52012.1| UniGene infoGene info unknown [Homo sapiens] Length=671 Score = 679 bits (1753), Expect = 0.0, Method: Composition-based stats. Identities = 323/343 (94%), Positives = 336/343 (97%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 M+MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 329 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 388 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQI KVKKLDKWVP Sbjct 389 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVP 448 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+ENQKNRRFEVSSSLILRN+NEPFLDRIVTCDEKWILYDNRRR AQWLD+EEAPKHF Sbjct 449 HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF 508 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 PKP LH KKVMVT+WWSAAGLIHYSFLNPGETITSEKYAQ+IDEM++KLQRLQ ALVNRK Sbjct 509 PKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRK 568 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHN Sbjct 569 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHN 628 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAFQEFVES+STDFYATGIN+LISRWQKCVDCNGSYFD Sbjct 629 QQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 >ref|XP_001099426.1| Gene info PREDICTED: similar to SET domain and mariner transposase fusion gene [Macaca mulatta] Length=671 Score = 678 bits (1749), Expect = 0.0, Method: Composition-based stats. Identities = 319/343 (93%), Positives = 334/343 (97%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 M+MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 329 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 388 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQIGKVKKLDKWVP Sbjct 389 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVP 448 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+ENQKNRRFEVSSSLILRN+NEPFLDRIVTCDEKWILYDNRRR AQWLD+E APKHF Sbjct 449 HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEAAPKHF 508 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 KP LH KK+MVT+WWSAAG+IHYSFLNPGETITSEKYAQ+IDEMH+KLQ LQ ALVNRK Sbjct 509 SKPILHPKKIMVTIWWSAAGVIHYSFLNPGETITSEKYAQEIDEMHQKLQHLQLALVNRK 568 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHN Sbjct 569 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHIFKHLNNFLQGKRFHN 628 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAFQEFV+SRSTDFYATGIN+LISRWQKCVDCNG+YFD Sbjct 629 QQDAENAFQEFVKSRSTDFYATGINQLISRWQKCVDCNGAYFD 671 >gb|ABC72090.1| SETMAR [Pongo pygmaeus] Length=446 Score = 669 bits (1725), Expect = 0.0, Method: Composition-based stats. Identities = 324/343 (94%), Positives = 336/343 (97%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 M+MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 104 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 163 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQIGKVKKLDKWVP Sbjct 164 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVP 223 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+ENQKN RFEVSSSLILRN+NEPFLDRIVTCDEKWILYDNRRR AQWLD+EEAPKHF Sbjct 224 HELTENQKNHRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF 283 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 PKP LH KKVMVT+WWSAAGLIHYSFLNPGETITSEKYAQ+IDEMH+KLQRLQ ALVNRK Sbjct 284 PKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMHQKLQRLQLALVNRK 343 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHN Sbjct 344 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHN 403 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAFQEFV+SRSTDFYATGIN+LISRWQKCVDCNGSYFD Sbjct 404 QQDAENAFQEFVKSRSTDFYATGINQLISRWQKCVDCNGSYFD 446 >gb|ABC72091.1| SETMAR [Symphalangus syndactylus] Length=446 Score = 668 bits (1723), Expect = 0.0, Method: Composition-based stats. Identities = 320/343 (93%), Positives = 336/343 (97%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 M+MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 104 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 163 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQIGKVKKLDKWVP Sbjct 164 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVP 223 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+ENQKNRRFEVSSSLILRN+NEPFLDRIVTCDEKWILYDNRRR AQWLD+EEAPKHF Sbjct 224 HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF 283 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 PKP LH KK M+T+WWSAAGLIHYSFLNPGET+TSEKYAQ+IDEMH+KLQRLQ ALV+RK Sbjct 284 PKPILHPKKAMITIWWSAAGLIHYSFLNPGETVTSEKYAQEIDEMHQKLQRLQLALVSRK 343 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GP+LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHN Sbjct 344 GPVLLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHN 403 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAFQEF+ESRSTDFYATGIN+LISRWQKCVDCNGSYFD Sbjct 404 QQDAENAFQEFIESRSTDFYATGINQLISRWQKCVDCNGSYFD 446 >dbj|BAE87709.1| UniGene info unnamed protein product [Macaca fascicularis] Length=479 Score = 665 bits (1716), Expect = 0.0, Method: Composition-based stats. Identities = 319/343 (93%), Positives = 334/343 (97%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 M+MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 137 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 196 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQIGKVKKLDKWVP Sbjct 197 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVP 256 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+ENQKNRRFEVSSSLILRN+NEPFLDRIVTCDEKWILYDNRRR AQWLD+E APKHF Sbjct 257 HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEAAPKHF 316 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 KP LH KK+MVT+WWSAAG+IHYSFLNPGETITSEKYAQ+IDEMH+KLQ LQ ALVNRK Sbjct 317 SKPILHPKKIMVTIWWSAAGVIHYSFLNPGETITSEKYAQEIDEMHQKLQHLQLALVNRK 376 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHN Sbjct 377 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHIFKHLNNFLQGKRFHN 436 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAFQEFV+SRSTDFYATGIN+LISRWQKCVDCNG+YFD Sbjct 437 QQDAENAFQEFVKSRSTDFYATGINQLISRWQKCVDCNGAYFD 479 >gb|ABC72089.1| SETMAR [Gorilla gorilla] Length=446 Score = 665 bits (1716), Expect = 0.0, Method: Composition-based stats. Identities = 323/342 (94%), Positives = 336/342 (98%), Gaps = 0/342 (0%) Query 2 EMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 61 +MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED Sbjct 105 KMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 164 Query 62 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPH 121 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQIGKVKKLDKWVPH Sbjct 165 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPH 224 Query 122 ELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFP 181 EL+ENQKNRRFEVSSSLILRN+NEPFLDRIVTCDEKWILYDNRRR AQWLD+EEAPKHFP Sbjct 225 ELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFP 284 Query 182 KPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKG 241 KP LH KKVMVT+WWSAAGLIHYSFLNPGETITSEKYAQ+IDEMH+KLQRLQ ALVNRKG Sbjct 285 KPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMHQKLQRLQLALVNRKG 344 Query 242 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQ 301 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHNQ Sbjct 345 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 404 Query 302 QDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QDAENAFQEFV+S+STDFYATGIN+LISRWQKCVDCNGSYFD Sbjct 405 QDAENAFQEFVKSQSTDFYATGINQLISRWQKCVDCNGSYFD 446 >gb|EAW63904.1| Gene info SET domain and mariner transposase fusion gene, isoform CRA_b [Homo sapiens] Length=448 Score = 665 bits (1715), Expect = 0.0, Method: Composition-based stats. Identities = 324/343 (94%), Positives = 337/343 (98%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 M+MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 106 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 165 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQIGKVKKLDKWVP Sbjct 166 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVP 225 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+ENQKNRRFEVSSSLILRN+NEPFLDRIVTCDEKWILYDNRRR AQWLD+EEAPKHF Sbjct 226 HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF 285 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 PKP LH KKVMVT+WWSAAGLIHYSFLNPGETITSEKYAQ+IDEM++KLQRLQ ALVNRK Sbjct 286 PKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRK 345 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHN Sbjct 346 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHN 405 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAFQEFVES+STDFYATGIN+LISRWQKCVDCNGSYFD Sbjct 406 QQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 448 >gb|ABC72092.1| SETMAR [Cercopithecus aethiops] Length=446 Score = 665 bits (1715), Expect = 0.0, Method: Composition-based stats. Identities = 321/343 (93%), Positives = 334/343 (97%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 M+MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 104 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 163 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQIGKVKKLDKWVP Sbjct 164 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVP 223 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+ENQKNRRFEVSSSLILRN NEPFLDRIVTCDEKWILYDNRRR AQWLD+EEAPKHF Sbjct 224 HELTENQKNRRFEVSSSLILRNRNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF 283 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 KP LH KK+MVT+WWSAAG+IHYSFLNPGETITSEKYAQ+IDEMH+KLQ LQ ALVNRK Sbjct 284 SKPILHPKKIMVTIWWSAAGVIHYSFLNPGETITSEKYAQEIDEMHQKLQHLQLALVNRK 343 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHN Sbjct 344 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHIFKHLNNFLQGKRFHN 403 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAFQEFV+SRSTDFYATGIN+LISRWQKCVDCNGSYFD Sbjct 404 QQDAENAFQEFVKSRSTDFYATGINQLISRWQKCVDCNGSYFD 446 >gb|ABC72088.1| SETMAR [Pan troglodytes] Length=446 Score = 662 bits (1708), Expect = 0.0, Method: Composition-based stats. Identities = 321/343 (93%), Positives = 335/343 (97%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 M+MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 104 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 163 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQIGKVKKLDKWVP Sbjct 164 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVP 223 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+ENQKNRRFEVSS LILRN+NEPFLDRIVTCDEKWILYDNRRR AQWLD+EEAPKHF Sbjct 224 HELTENQKNRRFEVSSFLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF 283 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 PKP LH KKVMVT+WWSAAGLIHYSFLNPGETITSEKYAQ+IDEM++KLQRLQ ALVNRK Sbjct 284 PKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRK 343 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHN Sbjct 344 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHN 403 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAF+EFVES+STDFY TGIN+LISRWQKCVDCNGSYFD Sbjct 404 QQDAENAFREFVESQSTDFYTTGINQLISRWQKCVDCNGSYFD 446 >gb|ABC72093.1| SETMAR [Aotus trivirgatus] Length=446 Score = 661 bits (1705), Expect = 0.0, Method: Composition-based stats. Identities = 320/343 (93%), Positives = 330/343 (96%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 M+M LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 104 MKMRLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 163 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDND LRAIIEADPLTTTREVAEELNV+HSTVVRHLKQIGKVKKLDKWVP Sbjct 164 DEERSGRPSEVDNDHLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVP 223 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRR AQWLD+EEAPKHF Sbjct 224 HELTENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF 283 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 PKP LHQKKVMVT+WWSAAGLIHYSFLNPGETITSEKY Q+IDEMH+KLQRL ALVNRK Sbjct 284 PKPILHQKKVMVTIWWSAAGLIHYSFLNPGETITSEKYVQEIDEMHQKLQRLPLALVNRK 343 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GPILLHDNARPHV QPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL NFLQGKRFHN Sbjct 344 GPILLHDNARPHVVQPTLQKLNELGYEVLPHPPYSPDLLPTNYHIFKHLSNFLQGKRFHN 403 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAFQEF+ESRS DFY TGIN+LISRWQKCVDCNGSYFD Sbjct 404 QQDAENAFQEFIESRSRDFYTTGINQLISRWQKCVDCNGSYFD 446 >gb|AAH08931.2| UniGene infoGene info SETMAR protein [Homo sapiens] Length=429 Score = 661 bits (1705), Expect = 0.0, Method: Composition-based stats. Identities = 324/343 (94%), Positives = 337/343 (98%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 M+MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 87 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 146 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQIGKVKKLDKWVP Sbjct 147 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVP 206 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+ENQKNRRFEVSSSLILRN+NEPFLDRIVTCDEKWILYDNRRR AQWLD+EEAPKHF Sbjct 207 HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF 266 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 PKP LH KKVMVT+WWSAAGLIHYSFLNPGETITSEKYAQ+IDEM++KLQRLQ ALVNRK Sbjct 267 PKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRK 326 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHN Sbjct 327 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHN 386 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAFQEFVES+STDFYATGIN+LISRWQKCVDCNGSYFD Sbjct 387 QQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 429 >gb|ABC72087.1| Gene info SETMAR [Homo sapiens] Length=344 Score = 654 bits (1687), Expect = 0.0, Method: Composition-based stats. Identities = 324/343 (94%), Positives = 337/343 (98%), Gaps = 0/343 (0%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 M+MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 2 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 61 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQIGKVKKLDKWVP Sbjct 62 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVP 121 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+ENQKNRRFEVSSSLILRN+NEPFLDRIVTCDEKWILYDNRRR AQWLD+EEAPKHF Sbjct 122 HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF 181 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 PKP LH KKVMVT+WWSAAGLIHYSFLNPGETITSEKYAQ+IDEM++KLQRLQ ALVNRK Sbjct 182 PKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRK 241 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHN Sbjct 242 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHN 301 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAFQEFVES+STDFYATGIN+LISRWQKCVDCNGSYFD Sbjct 302 QQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 344 >prf||2124399A transposase-like protein Length=340 Score = 639 bits (1648), Expect = 0.0, Method: Composition-based stats. Identities = 320/341 (93%), Positives = 327/341 (95%), Gaps = 1/341 (0%) Query 3 MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDE 62 MMLDKKQIRAIFLFEFKMG KAAETTRNI+NAFGPGTANE TVQWWFKKFCKGDESLEDE Sbjct 1 MMLDKKQIRAIFLFEFKMGHKAAETTRNISNAFGPGTANEHTVQWWFKKFCKGDESLEDE 60 Query 63 ERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHE 122 E SGRPSEVDNDQLRAII+ADPLTT REVAEEL VDHSTVV+HLKQIGKVKKLDKWVPHE Sbjct 61 EYSGRPSEVDNDQLRAIIKADPLTTRREVAEELEVDHSTVVQHLKQIGKVKKLDKWVPHE 120 Query 123 LSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPK 182 LS+N N RFEVSS IL NNNEPFLD+IVTCDEKWILYDN RRPAQWLDREEAPKHFPK Sbjct 121 LSKNFLNCRFEVSS-FILCNNNEPFLDQIVTCDEKWILYDNWRRPAQWLDREEAPKHFPK 179 Query 183 PNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGP 242 PNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQ ALVNRKGP Sbjct 180 PNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQLALVNRKGP 239 Query 243 ILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQ 302 ILLHDNARPHVAQPTLQKLNELGYEVLPH PYSPDLSPT+YHFFKHLDNFLQGKRFHNQQ Sbjct 240 ILLHDNARPHVAQPTLQKLNELGYEVLPHLPYSPDLSPTNYHFFKHLDNFLQGKRFHNQQ 299 Query 303 DAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 DAENAFQEFVES+STDFYATGINKLISRWQKCVDCNGSYFD Sbjct 300 DAENAFQEFVESQSTDFYATGINKLISRWQKCVDCNGSYFD 340 >ref|NP_001077195.1| Gene info hypothetical protein LOC534913 [Bos taurus] gb|AAI34646.1| Gene info Unknown (protein for MGC:151518) [Bos taurus] Length=343 Score = 589 bits (1519), Expect = 6e-167, Method: Composition-based stats. Identities = 298/343 (86%), Positives = 316/343 (92%), Gaps = 6/343 (1%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 MEMML+KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTA ERTVQWWFKKF KGDESLE Sbjct 7 MEMMLEKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTAKERTVQWWFKKFRKGDESLE 66 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 D+ERS RPSEVDNDQLR II+ADPL TTR++AEEL V+HSTVVRHLKQIGKVKKL+KWVP Sbjct 67 DDERSARPSEVDNDQLREIIDADPLKTTRKIAEELKVNHSTVVRHLKQIGKVKKLNKWVP 126 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HEL+E QKNRRFEVSSSLILRN NEPFLDRIVTC EKWIL DN+R+PAQ LDR + Sbjct 127 HELTEIQKNRRFEVSSSLILRNKNEPFLDRIVTCHEKWILSDNQRQPAQRLDRGKTL--- 183 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 NL+QKK+MVTVWWSAAGLIHYSFLNPGETITSEKYAQQI+EMH+KLQ LQPALVNRK Sbjct 184 ---NLYQKKIMVTVWWSAAGLIHYSFLNPGETITSEKYAQQINEMHQKLQHLQPALVNRK 240 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 GP+LLHDNARPHVAQP LQK NELGYEVLPHPP+SPDL PT YHFFKHLDNFLQGKRFHN Sbjct 241 GPVLLHDNARPHVAQPALQKFNELGYEVLPHPPHSPDLLPTHYHFFKHLDNFLQGKRFHN 300 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 QQDAENAFQEFVESRST FYATGIN+L SRWQKCVDCNGSYFD Sbjct 301 QQDAENAFQEFVESRSTGFYATGINELTSRWQKCVDCNGSYFD 343 >emb|CAA56856.1| planarian mariner-9 gene [Girardia tigrina] Length=339 Score = 369 bits (946), Expect = 2e-100, Method: Composition-based stats. Identities = 180/340 (52%), Positives = 233/340 (68%), Gaps = 2/340 (0%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 ++ +IR + +EF G + NIN+ + + TV WFK++ GD L ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRYRSGDFDLSNQPR 60 Query 65 SGRPS-EVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHEL 123 GRP +VDND L+A +EAD + E+A + V ST++ HLKQI KVKKLDKWVPHEL Sbjct 61 -GRPEIKVDNDALKADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLDKWVPHEL 119 Query 124 SENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKP 183 + K +R + SL+ RN +PFL RIVTCDEKWI+YDNR+R +QWLD +E PKH PK Sbjct 120 KDEHKQQRLDACLSLLSRNKADPFLHRIVTCDEKWIMYDNRKRSSQWLDPDEPPKHCPKR 179 Query 184 NLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPI 243 +HQKK+MVTVWWS+ G+IHY F+ PG +ITS+ Y Q+D+M KL QP + NR PI Sbjct 180 KVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQPKMFNRLTPI 239 Query 244 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQD 303 LLHDNARPH A+ T+ KL +LG E L HPPYSPDL+PTDYHFF+ LDNFL GK F + Sbjct 240 LLHDNARPHSAKNTVAKLQQLGLETLRHPPYSPDLAPTDYHFFQSLDNFLSGKNFTSSGA 299 Query 304 AENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 + AFQEF++SR + FY G+N L +WQ+CVD G YFD Sbjct 300 VKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 339 >emb|CAA50801.1| mariner-1 protein [Girardia tigrina] Length=339 Score = 367 bits (942), Expect = 5e-100, Method: Composition-based stats. Identities = 177/339 (52%), Positives = 230/339 (67%), Gaps = 0/339 (0%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 ++ +IR + +EF G + NIN+ + + TV WFK+F GD + ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDMSNQPR 60 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 S +VDND L+A +EAD + E+A + V S ++ HLKQI KVKKLDKWVPHEL Sbjct 61 SRPEIKVDNDALKADVEADSSQSALELASKFGVAKSIILIHLKQINKVKKLDKWVPHELK 120 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 + K +R + SL+ RN +PFL RIVTCDEKWI+YDNR+R +QWLD +E PKH PK Sbjct 121 DEHKQQRLDACLSLLSRNKADPFLHRIVTCDEKWIMYDNRKRSSQWLDPDEPPKHCPKRK 180 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 +HQKK+MVTVWWS+ G+IHY F+ PG +ITS+ Y Q+D+M KL QP + NR PIL Sbjct 181 VHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQPKMFNRLTPIL 240 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPH A+ T+ KL +LG E L HPPYSPDL+PTDYHFF+ LDNFL GK F + Sbjct 241 LHDNARPHSAKNTVAKLQQLGLETLRHPPYSPDLAPTDYHFFQSLDNFLSGKNFTSSGAV 300 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 + AFQEF++SR + FY G+N L +WQ+CVD G YFD Sbjct 301 KTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 339 >emb|CAA56858.1| planarian mariner-5 gene [Girardia tigrina] Length=339 Score = 367 bits (941), Expect = 7e-100, Method: Composition-based stats. Identities = 179/340 (52%), Positives = 231/340 (67%), Gaps = 2/340 (0%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 ++ +IR + +EF G + NIN+ + + TV WFK+F GD L ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDLSNQPR 60 Query 65 SGRPS-EVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHEL 123 GRP +VDND L+A +EAD + E+A + V ST++ HLKQI KVKKLDKWVPHEL Sbjct 61 -GRPEIKVDNDALKADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLDKWVPHEL 119 Query 124 SENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKP 183 + K +R + SL+ RN +PFL RIVTC EKWI+YDNR+R +QWLD +E PKH PK Sbjct 120 KDEHKQQRLDACLSLLSRNKADPFLHRIVTCGEKWIMYDNRKRSSQWLDPDEPPKHCPKR 179 Query 184 NLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPI 243 +HQKK+MVTVWWS+ G+IHY F+ PG +ITS+ Y Q+D+M KL QP + NR PI Sbjct 180 KVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQPKMFNRLTPI 239 Query 244 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQD 303 LLHDNARPH A+ T+ KL +LG E L HPPYSPDL+PTDYHFF+ LDNF GK F + Sbjct 240 LLHDNARPHSAKNTVAKLQQLGLETLRHPPYSPDLAPTDYHFFQSLDNFFSGKYFTSSGA 299 Query 304 AENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 + AFQEF++SR + FY G+N L +WQ+CVD G YFD Sbjct 300 VKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 339 >emb|CAA56859.1| planarian mariner-3 gene [Girardia tigrina] Length=339 Score = 364 bits (935), Expect = 4e-99, Method: Composition-based stats. Identities = 179/340 (52%), Positives = 231/340 (67%), Gaps = 2/340 (0%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 ++ +IR + +EF G + NIN+ + + TV WFK+F GD L ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDLSNQPR 60 Query 65 SGRPS-EVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHEL 123 GRP +VDND L+A +EAD + E+A + V ST++ HLKQI KVKKLDKWVPHEL Sbjct 61 -GRPEIKVDNDALKADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLDKWVPHEL 119 Query 124 SENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKP 183 + K +R + SL+ RN +PFL RIVTCDEKWI+YDNR+R +QWLD +E PKH PK Sbjct 120 KDEHKQQRLDACLSLLSRNKADPFLHRIVTCDEKWIMYDNRKRSSQWLDPDEPPKHCPKR 179 Query 184 NLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPI 243 +HQKK+MVTVWWS+ G+IHY F+ PG +ITS+ Y Q+D+M KL QP + NR PI Sbjct 180 KVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQPKMFNRLTPI 239 Query 244 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQD 303 LLHDNARPH A+ T+ KL +LG E L HP YSPDL+PTD HFF+ LDNFL GK F + Sbjct 240 LLHDNARPHSAKNTVAKLQQLGLETLRHPTYSPDLAPTDCHFFQSLDNFLSGKNFTSSGA 299 Query 304 AENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 + AFQEF++SR + FY G+N L +WQ+CVD G YFD Sbjct 300 VKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 339 >prf||1917335A mariner 1 element Length=338 Score = 364 bits (934), Expect = 5e-99, Method: Composition-based stats. Identities = 177/339 (52%), Positives = 230/339 (67%), Gaps = 1/339 (0%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 ++ +IR + +EF G + NIN+ + + TV WFK+F GD + ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDMSNQPR 60 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 S +VDND L+A +EAD + E+A + V S ++ HLKQI KVKKLDKWVPHEL Sbjct 61 SRPEIKVDNDALKADVEADSSQSALELASKFGVAKSIILIHLKQINKVKKLDKWVPHELK 120 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 + K +R + SL+ RN +PFL RIVTCDEKWI+YDNR+R +QWLD +E PKH PK Sbjct 121 DEHKQQRLDACLSLLSRNKADPFLHRIVTCDEKWIMYDNRKRSSQWLD-DEPPKHCPKRK 179 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 +HQKK+MVTVWWS+ G+IHY F+ PG +ITS+ Y Q+D+M KL QP + NR PIL Sbjct 180 VHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQPKMFNRLTPIL 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPH A+ T+ KL +LG E L HPPYSPDL+PTDYHFF+ LDNFL GK F + Sbjct 240 LHDNARPHSAKNTVAKLQQLGLETLRHPPYSPDLAPTDYHFFQSLDNFLSGKNFTSSGAV 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 + AFQEF++SR + FY G+N L +WQ+CVD G YFD Sbjct 300 KTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 338 >emb|CAA56857.1| planarian mariner-8 gene [Girardia tigrina] Length=339 Score = 363 bits (931), Expect = 1e-98, Method: Composition-based stats. Identities = 178/340 (52%), Positives = 231/340 (67%), Gaps = 2/340 (0%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 ++ +IR + +EF G + NIN+ + + TV WFK+F GD L ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDLSNQPR 60 Query 65 SGRPS-EVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHEL 123 GRP +VDND L+A +EAD + E+A + V ST++ HLKQI KVKKLDKWVPHEL Sbjct 61 -GRPEIKVDNDALKADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLDKWVPHEL 119 Query 124 SENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKP 183 + K +R + SL+ RN +PFL RIVTCDEKWI+YDNR+R +QWLD +E PKH PK Sbjct 120 KDEHKQQRLDACLSLLSRNKADPFLHRIVTCDEKWIMYDNRKRSSQWLDPDEPPKHCPKR 179 Query 184 NLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPI 243 +HQKK+MVTVWWS+ G+IHY F+ PG +ITS+ Y Q+D+M KL Q + NR PI Sbjct 180 KVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQAKMFNRLTPI 239 Query 244 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQD 303 LL+DNARPH A+ T+ K +LG E L HPPYSPDL+PTDYHFF+ LDNFL GK F + Sbjct 240 LLYDNARPHSAKNTVAKRQQLGLETLRHPPYSPDLAPTDYHFFQSLDNFLSGKNFTSSGA 299 Query 304 AENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 + AFQEF++SR + FY G+N L +WQ+CVD G YFD Sbjct 300 VKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 339 >emb|CAA56763.1| manirer-2 [Girardia tigrina] Length=365 Score = 354 bits (909), Expect = 4e-96, Method: Composition-based stats. Identities = 175/336 (52%), Positives = 228/336 (67%), Gaps = 2/336 (0%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 ++ +IR + +EF G + NIN+ + + TV WFK+F GD L ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDLSNQPR 60 Query 65 SGRPS-EVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHEL 123 GRP +VDND L+A +EAD + E+A + V ST++ HLKQI KVKKLDKWVPHEL Sbjct 61 -GRPEIKVDNDALKADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLDKWVPHEL 119 Query 124 SENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKP 183 + K +R + SL+ RN +PFL RI+TCDEKWI+YDNR+R +QWLD +E PKH PK Sbjct 120 KDEHKQQRLDACLSLLSRNKADPFLHRIMTCDEKWIMYDNRKRSSQWLDPDEPPKHCPKR 179 Query 184 NLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPI 243 +HQKK+MVTVWWS+ G+IHY F+ PG +ITS+ Y Q+D+M KL QP + NR PI Sbjct 180 KVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQPKMFNRLTPI 239 Query 244 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQD 303 LLHDNARPH A+ T+ KL +LG E L HP YSPDL+PTD HFF+ LDNFL GK F + Sbjct 240 LLHDNARPHSAKNTVAKLQQLGLETLRHPTYSPDLAPTDCHFFQSLDNFLSGKNFTSSGA 299 Query 304 AENAFQEFVESRSTDFYATGINKLISRWQKCVDCNG 339 + AFQEF++SR + FY G+N L +WQ+CVD G Sbjct 300 VKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMG 335 >dbj|BAA21826.1| transposase [Attacus atlas] dbj|BAB32436.1| transposase [Fungia sp. Kusabiraishi] Length=316 Score = 345 bits (886), Expect = 2e-93, Method: Composition-based stats. Identities = 168/317 (52%), Positives = 226/317 (71%), Gaps = 2/317 (0%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 ++ + R I+ +EF G AAET R IN+ +G G E TV++WF++F G+ L ++ R Sbjct 1 MENLKYRVIYEYEFHRGTSAAETARRINDVYGGGVTKENTVRFWFQRFRSGNFDLRNKPR 60 Query 65 SGRP-SEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHEL 123 GRP ++VDN++L+AI+EADP TT E+A V V+ HLKQ GKVKKL++WVPHEL Sbjct 61 -GRPDTKVDNEELKAIVEADPSQTTPELAAGCGVSDKIVLIHLKQTGKVKKLERWVPHEL 119 Query 124 SENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKP 183 SE + R + +L+ R+NNE L+RI+TCDEKWILYDNR+R +QWL+ E K PK Sbjct 120 SETNRQTRVDCCVTLLNRHNNEGILNRIITCDEKWILYDNRKRSSQWLNPGEPAKSCPKR 179 Query 184 NLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPI 243 L QKK++V+VWW++AG++HYSFL G TIT++ Y QQ+ M KL QP L+NR P+ Sbjct 180 KLTQKKLLVSVWWTSAGVVHYSFLKSGLTITADVYCQQLQVMMEKLAAKQPRLINRSRPL 239 Query 244 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQD 303 LLHDNARPH AQ T KL EL E L HPPYSPDL+PTDYHFF++LDNFLQGK+F++ Sbjct 240 LLHDNARPHTAQQTATKLGELQLECLRHPPYSPDLAPTDYHFFRNLDNFLQGKKFNSDGA 299 Query 304 AENAFQEFVESRSTDFY 320 + AF++F++SR F+ Sbjct 300 VQTAFKDFIDSRPNSFF 316 >dbj|BAA23532.1| transposase [Bombyx mori] Length=338 Score = 335 bits (860), Expect = 2e-90, Method: Composition-based stats. Identities = 172/341 (50%), Positives = 238/341 (69%), Gaps = 5/341 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 ++ + R I+ ++F G AAETT+ IN+ +G G A E TV++WF++F G+ L+++ R Sbjct 1 MENMKYRYIYEYQFYRGTSAAETTQRINDVYGAGVAKESTVRFWFQRFRSGNFDLQNQPR 60 Query 65 SGRP-SEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHEL 123 GRP ++V N++L+AI+EAD +T E+ V TV+ HLKQIGKVKKL++WVPHEL Sbjct 61 -GRPETKVKNEELKAIVEADQSQSTSEIVAGFGVSDKTVLIHLKQIGKVKKLERWVPHEL 119 Query 124 SENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKP 183 SE+ R + +L+ R+ NE L+RI TCDEK +LYDNR+R +QWL+ + K +PK Sbjct 120 SESNLQTRIDCCVTLLNRHYNEGILNRINTCDEKGVLYDNRKRLSQWLNPGDPAKSYPKR 179 Query 184 NLHQKKVMVTVWW-SAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGP 242 L QKK++V+VWW S A ++HYSFL G+TIT++ Y QQ+ M +L QP LVNR P Sbjct 180 KLTQKKLLVSVWWTSIASVVHYSFLKSGQTITADIYCQQLQTMKEELAAKQPRLVNRSRP 239 Query 243 ILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQ 302 +LLHDNARPH AQ T KL+EL L HPPYS DL+P DYHFF +LDNFLQ K+ ++ Sbjct 240 LLLHDNARPHTAQQTTTKLDELQLACLRHPPYS-DLAPIDYHFFLNLDNFLQ-KKINSDA 297 Query 303 DAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 + AF+EF++SR F++ GIN+L R QKC+D NG+YFD Sbjct 298 AVQTAFKEFIDSRYHGFFSKGINELPKRLQKCIDNNGAYFD 338 >gb|AAP51085.1| transposase [Forficula auricularia] Length=342 Score = 312 bits (799), Expect = 2e-83, Method: Composition-based stats. Identities = 152/335 (45%), Positives = 216/335 (64%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ G+ A++ + + +G ER Q WF KFC GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCALYGNEALKERQCQNWFAKFCSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+AE+L+V H+ + HLKQ+G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPTQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T +KL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D + Sbjct 245 DNARPHTSLVTRKKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKL 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLVQFFANKNQKFYERGIMMLPERWQKVIDQNGQY 339 >gb|AAP51087.1| transposase [Forficula auricularia] Length=342 Score = 311 bits (796), Expect = 4e-83, Method: Composition-based stats. Identities = 152/335 (45%), Positives = 216/335 (64%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFLKGKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+AE+L+V H+ + HLKQ+G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F +++ FY GI L+ RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLLERWQKVIDQNGQY 339 >gb|AAP51098.1| transposase [Forficula auricularia] gb|AAP51099.1| transposase [Forficula auricularia] gb|AAP51100.1| transposase [Forficula auricularia] Length=342 Score = 310 bits (794), Expect = 8e-83, Method: Composition-based stats. Identities = 152/335 (45%), Positives = 217/335 (64%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ G+ A+++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQSHKRLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+AE+L+V H+ + HLKQ+G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWGRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQY 339 >gb|AAP51096.1| transposase [Forficula auricularia] Length=345 Score = 309 bits (791), Expect = 2e-82, Method: Composition-based stats. Identities = 153/335 (45%), Positives = 214/335 (63%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ G+ A + + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNALQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+AE+L+V H+ + HLKQ+G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F ++S FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKSQKFYERGIMMLPERWQKVIDQNGKY 339 >gb|AAP51090.1| transposase [Forficula auricularia] gb|AAP51094.1| transposase [Forficula auricularia] Length=342 Score = 309 bits (791), Expect = 2e-82, Method: Composition-based stats. Identities = 153/335 (45%), Positives = 215/335 (64%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCAVYGDEAFKERQCQNWFAKFRFGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+AE+L+V H+ + HLKQ+G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 RR + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTRRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D + Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKL 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQY 339 >gb|AAP51086.1| transposase [Forficula auricularia] Length=341 Score = 308 bits (790), Expect = 2e-82, Method: Composition-based stats. Identities = 153/335 (45%), Positives = 214/335 (63%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ G+ A + + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNALQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+AE+L+V H+ + HLKQ+G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F ++S FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKSQKFYERGIMMLPERWQKVIDQNGKY 339 >gb|AAP51093.1| transposase [Forficula auricularia] Length=342 Score = 308 bits (789), Expect = 3e-82, Method: Composition-based stats. Identities = 152/335 (45%), Positives = 215/335 (64%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCAVYGDEAFKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+AE+L+V H+ + HLKQ+G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D + Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKL 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDHNGQY 339 >gb|AAP51092.1| transposase [Forficula auricularia] Length=342 Score = 308 bits (788), Expect = 4e-82, Method: Composition-based stats. Identities = 150/335 (44%), Positives = 215/335 (64%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+AE+L+V H+ + H+K +G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHIKHLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRFLQNSLNGKNFNNDDDVKS 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLSERWQKVIDQNGQY 339 >gb|AAP51091.1| transposase [Forficula auricularia] Length=342 Score = 308 bits (788), Expect = 4e-82, Method: Composition-based stats. Identities = 151/335 (45%), Positives = 215/335 (64%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ G+ A++ + + +G ER Q WF KF G SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCAIYGDEAFKERQCQNWFAKFRSGGFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+AE+L+V H+ + HLKQ+G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDHNGQY 339 >gb|AAO12863.1| Famar1 transposase [Forficula auricularia] Length=342 Score = 307 bits (787), Expect = 5e-82, Method: Composition-based stats. Identities = 152/335 (45%), Positives = 215/335 (64%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCAVYGDEAFKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+AE+L+V H+ + HLKQ+G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQY 339 >gb|AAP51097.1| transposase [Forficula auricularia] Length=342 Score = 306 bits (785), Expect = 8e-82, Method: Composition-based stats. Identities = 151/335 (45%), Positives = 214/335 (63%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII +D +TTRE+AE+L+V H+ + HLK +G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIINSDCHSTTREIAEKLHVSHTCIENHLKHLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ +++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNEVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D + Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKL 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQY 339 >gb|AAO12864.1| Ccmar2 transposase [Ceratitis capitata] Length=342 Score = 306 bits (785), Expect = 8e-82, Method: Composition-based stats. Identities = 151/335 (45%), Positives = 216/335 (64%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKTASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+ ++AII++D +TTRE+AE+L+V H+ + HLKQ+G V+KLD WVPHEL E Sbjct 65 RPVEVDDALIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R L RN N+PFL R++T DEKW++Y+N +R W E + K ++H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPTQTTSKADIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S+ Y +Q+ +++ ++ +P L NRK + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSDVYIEQLTKLNNAVEEKRPELTNRKSIVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLATRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKIIDQNGQY 339 >gb|AAP51095.1| transposase [Forficula auricularia] Length=341 Score = 306 bits (785), Expect = 9e-82, Method: Composition-based stats. Identities = 152/335 (45%), Positives = 213/335 (63%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ G+ A + + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNALQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+A +L+V H+ + HLKQ+G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAHKLHVSHTCIENHLKQLGFVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F ++S FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKSQKFYERGIMMLPERWQKVIDQNGKY 339 >gb|AAP51083.1| transposase [Forficula auricularia] Length=342 Score = 306 bits (785), Expect = 9e-82, Method: Composition-based stats. Identities = 151/335 (45%), Positives = 214/335 (63%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ G A + + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGTNALQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EV++D ++AII++D +TTRE+AE+L+V H+ + HLKQ+G V+KLD WVPHEL E Sbjct 65 RPVEVNDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVDYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQY 339 >ref|NP_001073580.1| UniGene infoGene info Ammar1 transposase [Apis mellifera] gb|AAO12861.1| Gene info Ammar1 transposase [Apis mellifera] Length=342 Score = 305 bits (782), Expect = 2e-81, Method: Composition-based stats. Identities = 151/335 (45%), Positives = 216/335 (64%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHYRHILLFYFRKGKNASQAHKKLCAVYGDEALKERQCQNWFDKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+AE+L+V H+ + HLKQ+G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKEK 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPREPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 +KKV+++VWW G++++ L P TI S Y +Q+ +++ ++ +P L NRKG + H Sbjct 185 RKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRPELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDIKS 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F +++ FY GI L RWQK +D NG + Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQH 339 >gb|AAB17945.1| mariner transposase [Ceratitis capitata] Length=338 Score = 305 bits (780), Expect = 3e-81, Method: Composition-based stats. Identities = 148/327 (45%), Positives = 205/327 (62%), Gaps = 0/327 (0%) Query 15 LFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDND 74 L+EF+ G+ T++I + RTV+ WF KF GD +LED RSGRP E+DND Sbjct 9 LYEFRKGKTVGAATKDIREVYSDRAPALRTVKKWFAKFRSGDFNLEDRPRSGRPCELDND 68 Query 75 QLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSENQKNRRFEV 134 LR + + +T+EVA ELNV+ T R LK++G KLDKWVPH+LSE K R Sbjct 69 VLRISVANNSRISTKEVASELNVNKPTAFRRLKKVGYTLKLDKWVPHQLSEKNKVDRMST 128 Query 135 SSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLHQKKVMVTV 194 + SL+ R NEPFLDR++T DEKWILY+N +R W E + K LH V++ + Sbjct 129 AISLLRRVKNEPFLDRLLTGDEKWILYNNVQRKRTWKQAHEGAEPMSKGGLHPMMVLLCI 188 Query 195 WWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLHDNARPHVA 254 WW G+I++ L GETIT+ KY QQ+ E+ + + +P NRKG + +DNARPHVA Sbjct 189 WWDIRGVIYFELLPAGETITANKYCQQLVELKKAIDEKRPIFANRKGVLFHYDNARPHVA 248 Query 255 QPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAENAFQEFVES 314 +PTL KL E+ +E++PH PYSPD++P+DYH F+ L N L GK+F N +D ++ F Sbjct 249 KPTLAKLKEMNWEIMPHSPYSPDIAPSDYHLFRSLQNNLNGKKFKNVEDVKSHLDNFFNE 308 Query 315 RSTDFYATGINKLISRWQKCVDCNGSY 341 + DFY +GI KL+ RW+ + +G Y Sbjct 309 KPRDFYESGIRKLVERWEWIAEHDGEY 335 >gb|AAP51089.1| transposase [Forficula auricularia] Length=342 Score = 304 bits (779), Expect = 4e-81, Method: Composition-based stats. Identities = 151/335 (45%), Positives = 214/335 (63%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCAVYGNEAFKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+AE+ +V H+ + HLKQ+G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKPHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYKRGIMMLPERWQKVIDQNGQY 339 >gb|AAO12862.1| Camar1 transposase [Chymomyza amoena] Length=342 Score = 303 bits (776), Expect = 9e-81, Method: Composition-based stats. Identities = 152/335 (45%), Positives = 209/335 (62%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I + F+ G+ A + + + + +G ER Q WF+KF GD SL+DE RSG Sbjct 5 KEHFRHILYYYFRKGKNAEQVAKKLRDVYGDKALKERQCQNWFRKFRSGDFSLKDEPRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP+EVD+DQ++A+IE D T RE+ E+LN+ STV H+K +G VKKLD WVPHEL E Sbjct 65 RPNEVDDDQIKALIELDRHVTEREIGEKLNIPKSTVHYHIKSLGLVKKLDIWVPHELKEI 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 R + RN +PFL RI+T DEKWI+Y+N R W E + K ++H Sbjct 125 HLTNRINACDMHLKRNEFDPFLKRIITGDEKWIVYNNVNRKRSWSKHGEPAQTTSKADIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKVM++VWW G++++ L +TI S+ Y QQ+D+++ + +P L+NRKG I Sbjct 185 QKKVMLSVWWDWKGVVYFELLPRNQTINSDVYCQQLDKLNAAINEKRPELINRKGVIFHQ 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG+EVL HPPYSPDL+P+DYH F+ L N L GK F N + ++ Sbjct 245 DNARPHTSLMTRQKLRELGWEVLMHPPYSPDLAPSDYHLFRSLQNSLNGKTFGNDEAIKS 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F + FY GI L RWQK ++ NG+Y Sbjct 305 HLVQFFADKGQKFYERGIQNLPGRWQKVIEQNGNY 339 >gb|AAZ67097.1| transposase [Adineta vaga] Length=345 Score = 302 bits (774), Expect = 2e-80, Method: Composition-based stats. Identities = 153/340 (45%), Positives = 208/340 (61%), Gaps = 6/340 (1%) Query 2 EMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 61 +M L +++R + L EF++GRKA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGRKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 62 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPH 121 RSGRP EVD D L+ +IE DP T R +AE+L H+TV +HL ++GK K W+PH Sbjct 68 LPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 122 ELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFP 181 ELS +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 182 KPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKG 241 K +LH KK+M++VWW G+IH+ L G TIT++ Y QQ+D + KL+ Q + Sbjct 188 KADLHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 242 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQ 301 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL+PTDYH F+ L N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTSEKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 302 QDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >gb|AAP51082.1| transposase [Forficula auricularia] Length=342 Score = 302 bits (773), Expect = 2e-80, Method: Composition-based stats. Identities = 149/335 (44%), Positives = 213/335 (63%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFLKGKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+AE+L+V H+ + H+K +G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHIKHLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLAQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSAVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL EL ++VLPHPPYSPDL+P+DY F+ L N L GK F+N D + Sbjct 245 DNARPHTSLVTRQKLLELDWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKL 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F ++++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFDNKNQKFYERGIMMLPERWQKVIDQNGQY 339 >gb|AAP51084.1| transposase [Forficula auricularia] Length=342 Score = 302 bits (773), Expect = 2e-80, Method: Composition-based stats. Identities = 149/335 (44%), Positives = 213/335 (63%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFLKGKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+AE+L+V H+ + H+K +G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHIKHLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL EL ++VLPHPPYSPDL+P+DY F+ L N L GK F+N D + Sbjct 245 DNARPHTSLVTRQKLLELDWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKL 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F ++++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFDNKNQKFYERGIMMLPERWQKVIDQNGQY 339 >gb|AAP51088.1| transposase [Forficula auricularia] Length=342 Score = 301 bits (770), Expect = 5e-80, Method: Composition-based stats. Identities = 150/335 (44%), Positives = 213/335 (63%), Gaps = 0/335 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 K+ R I LF F+ + A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKEKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 RP EVD+D ++AII++D +TTRE+AE+L+V H+ + HLKQ+G V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 +R L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLH 246 QKKV+++VWW G++++ L P TI S Y +Q+ +++ ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 247 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAEN 306 DNARPH + T QKL ELG++VLPHPPYSPDL+P+DY F+ L N L GK F+N D + Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKL 304 Query 307 AFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 +F +++ FY GI L RWQK +D +G Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDQHGQY 339 >gb|AAZ67091.1| transposase [Adineta vaga] Length=345 Score = 300 bits (769), Expect = 7e-80, Method: Composition-based stats. Identities = 152/340 (44%), Positives = 207/340 (60%), Gaps = 6/340 (1%) Query 2 EMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 61 +M L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 62 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPH 121 RSGRP EVD D L+ +IE DP T R +AE+L H+TV +HL ++GK K W+PH Sbjct 68 LPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 122 ELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFP 181 ELS +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 182 KPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKG 241 K +LH KK+M++VWW G+IH+ L G TIT++ Y QQ+D + KL+ Q + Sbjct 188 KADLHSKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 242 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQ 301 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL+PTDYH F+ L N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 302 QDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >gb|AAZ67096.1| transposase [Adineta vaga] Length=345 Score = 300 bits (768), Expect = 8e-80, Method: Composition-based stats. Identities = 152/340 (44%), Positives = 207/340 (60%), Gaps = 6/340 (1%) Query 2 EMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 61 +M L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 62 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPH 121 RSGRP EVD D L+ +IE DP T R +AE+L H+TV +HL ++GK K W+PH Sbjct 68 LPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 122 ELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFP 181 ELS +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 182 KPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKG 241 K +LH KK+M++VWW G+IH+ L G TIT++ Y QQ+D + KL+ Q + Sbjct 188 KADLHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 242 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQ 301 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL+PTDYH F+ L N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTSEKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 302 QDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >gb|AAZ67092.1| transposase [Adineta vaga] Length=345 Score = 298 bits (764), Expect = 2e-79, Method: Composition-based stats. Identities = 151/340 (44%), Positives = 207/340 (60%), Gaps = 6/340 (1%) Query 2 EMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 61 +M L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 62 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPH 121 RSGRP EVD D L+ +IE DP T R +AE+L H+TV +HL ++GK K W+PH Sbjct 68 LPRSGRPMEVDVDLLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 122 ELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFP 181 ELS +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 182 KPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKG 241 K +LH KK+M++VWW G+IH+ L G TIT++ Y QQ+D + KL+ Q + Sbjct 188 KADLHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 242 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQ 301 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL+PTDYH F+ L N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 302 QDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 D + +F + +S DFY GI L RWQ+ +D NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVLDSNGKY 341 >pir||T25365 hypothetical protein T27E7.7 - Caenorhabditis elegans Length=339 Score = 298 bits (764), Expect = 2e-79, Method: Composition-based stats. Identities = 150/338 (44%), Positives = 207/338 (61%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGTWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWWS G +H+ L +TIT + Y Q+D + K L Sbjct 186 LHPKKIMICVWWSVQGPVHWELLPTNKTITDDYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T19261 hypothetical protein C14A6.4 - Caenorhabditis elegans Length=339 Score = 298 bits (764), Expect = 2e-79, Method: Composition-based stats. Identities = 149/338 (44%), Positives = 207/338 (61%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGTWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T19660 hypothetical protein C33A12.5 - Caenorhabditis elegans Length=339 Score = 298 bits (763), Expect = 3e-79, Method: Composition-based stats. Identities = 149/338 (44%), Positives = 207/338 (61%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGTWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEYL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T23086 hypothetical protein H12I19.6 - Caenorhabditis elegans Length=339 Score = 298 bits (763), Expect = 3e-79, Method: Composition-based stats. Identities = 149/338 (44%), Positives = 207/338 (61%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTTKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T19600 probable transposition protein C31A11.2 - Caenorhabditis elegans Length=339 Score = 298 bits (762), Expect = 4e-79, Method: Composition-based stats. Identities = 149/338 (44%), Positives = 207/338 (61%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T32726 hypothetical protein C45H4.5 - Caenorhabditis elegans Length=573 Score = 298 bits (762), Expect = 4e-79, Method: Composition-based stats. Identities = 144/329 (43%), Positives = 203/329 (61%), Gaps = 6/329 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G+ A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 111 LERRDVRLLLLYEFRLGQSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 170 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 171 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 230 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 231 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 290 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 291 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEQLY------F 344 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 345 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 404 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQK 333 + F SRS DF++ GI L S+WQ+ Sbjct 405 KTELSTFFSSRSPDFFSRGIMMLPSKWQQ 433 >pir||T19555 hypothetical protein C29E6.6 - Caenorhabditis elegans Length=339 Score = 298 bits (762), Expect = 4e-79, Method: Composition-based stats. Identities = 149/338 (44%), Positives = 207/338 (61%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPIELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T27435 hypothetical protein Y7A5A.4 - Caenorhabditis elegans Length=481 Score = 297 bits (761), Expect = 5e-79, Method: Composition-based stats. Identities = 148/338 (43%), Positives = 207/338 (61%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTDKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD N +F Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNVIFF 337 >pir||T18783 hypothetical protein B0564.5 - Caenorhabditis elegans Length=339 Score = 297 bits (761), Expect = 5e-79, Method: Composition-based stats. Identities = 148/338 (43%), Positives = 207/338 (61%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGTWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K+ L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKINGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNA PHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNAMPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T22780 hypothetical protein F56D5.7 - Caenorhabditis elegans Length=339 Score = 297 bits (761), Expect = 5e-79, Method: Composition-based stats. Identities = 149/338 (44%), Positives = 207/338 (61%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEYL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T20782 hypothetical protein F11D11.9 - Caenorhabditis elegans Length=355 Score = 297 bits (761), Expect = 5e-79, Method: Composition-based stats. Identities = 149/338 (44%), Positives = 207/338 (61%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGTWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >gb|AAZ67093.1| transposase [Adineta vaga] Length=345 Score = 297 bits (761), Expect = 6e-79, Method: Composition-based stats. Identities = 151/340 (44%), Positives = 206/340 (60%), Gaps = 6/340 (1%) Query 2 EMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 61 +M L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 62 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPH 121 RSGRP EVD D L+ +IE DP T R +AE+L H+TV +HL ++GK K W+PH Sbjct 68 LPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 122 ELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFP 181 ELS +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 182 KPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKG 241 K +LH KK+M++VWW G+IH+ L G TIT++ Y QQ+D + KL+ Q + Sbjct 188 KADLHSKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 242 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQ 301 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL+PTDYH F+ L N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 302 QDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 D + +F + +S DFY GI L RWQ+ VD N Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQEVVDSNSKY 341 >gb|AAF60591.1| Hypothetical protein Y45G12C.13 [Caenorhabditis elegans] Length=384 Score = 297 bits (760), Expect = 6e-79, Method: Composition-based stats. Identities = 147/334 (44%), Positives = 205/334 (61%), Gaps = 6/334 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCN 338 + F SRS DF++ GI L S+WQ+ VD N Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTN 333 >pir||T26396 hypothetical protein Y105C5B.t - Caenorhabditis elegans Length=339 Score = 297 bits (760), Expect = 7e-79, Method: Composition-based stats. Identities = 149/338 (44%), Positives = 206/338 (60%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KKVM+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKVMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL + G+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDFGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >gb|AAB00629.1| Hypothetical protein R05G6.2 [Caenorhabditis elegans] Length=339 Score = 296 bits (758), Expect = 1e-78, Method: Composition-based stats. Identities = 148/338 (43%), Positives = 206/338 (60%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+K GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKLKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGTWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T25335 hypothetical protein T26H8.1 - Caenorhabditis elegans Length=339 Score = 296 bits (758), Expect = 1e-78, Method: Composition-based stats. Identities = 148/338 (43%), Positives = 207/338 (61%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSP+L+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPNLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T20442 hypothetical protein E03H4.1 - Caenorhabditis elegans Length=339 Score = 296 bits (757), Expect = 1e-78, Method: Composition-based stats. Identities = 148/338 (43%), Positives = 206/338 (60%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +V DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVIGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >gb|AAZ67098.1| transposase [Adineta vaga] Length=345 Score = 295 bits (756), Expect = 2e-78, Method: Composition-based stats. Identities = 150/340 (44%), Positives = 205/340 (60%), Gaps = 6/340 (1%) Query 2 EMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 61 +M L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 62 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPH 121 RSGRP EVD D L+ +IE DP T R +AE+L H+TV +HL ++GK K W+PH Sbjct 68 LPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 122 ELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFP 181 ELS +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 182 KPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKG 241 K + H KK +++VWW G+IH+ L G TIT++ Y QQ+D + KL+ Q + Sbjct 188 KADSHSKKFILSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 242 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQ 301 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL+PTDYH F+ L N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 302 QDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >pir||T18779 transposase containing protein - Caenorhabditis elegans Length=708 Score = 295 bits (756), Expect = 2e-78, Method: Composition-based stats. Identities = 147/334 (44%), Positives = 204/334 (61%), Gaps = 6/334 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 266 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 325 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 326 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIPRHLGRLGFTSKLGTWVPHELS 385 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 386 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 445 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT + Y Q+D + K L Sbjct 446 LHPKKIMICVWWGVQGPVHWELLPTNKTITVDYYCAQLDRVAEKTNGKYEKLY------F 499 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 500 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 559 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCN 338 + F SRS DF++ GI L S+WQ+ VD N Sbjct 560 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTN 593 >gb|AAZ67101.1| transposase [Adineta vaga] Length=345 Score = 295 bits (755), Expect = 2e-78, Method: Composition-based stats. Identities = 150/340 (44%), Positives = 205/340 (60%), Gaps = 6/340 (1%) Query 2 EMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 61 +M L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSYREVRVLLLHEFRLGNKATEAANNICGMMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 62 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPH 121 RSGR EVD D L+ +IE DP T R +AE+L H+TV +HL ++GK K W+PH Sbjct 68 LPRSGRSMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 122 ELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFP 181 ELS +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 182 KPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKG 241 K +LH KK M+++WW G+IH+ L G TIT++ Y QQ+D + KL+ Q + Sbjct 188 KADLHPKKSMLSIWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 242 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQ 301 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL+PTDYH F+ L N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRNKKFDDE 301 Query 302 QDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >gb|AAZ67095.1| transposase [Adineta vaga] Length=345 Score = 295 bits (755), Expect = 3e-78, Method: Composition-based stats. Identities = 150/337 (44%), Positives = 204/337 (60%), Gaps = 6/337 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D R Sbjct 11 LSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDDLPR 70 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP EVD D L+ +IE DP T R +AE+L H+TV +HL ++GK K W+PHELS Sbjct 71 SGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPHELS 130 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +Q +R + LI + N +L ++T DEKW+LY N R QWL + PK + Sbjct 131 AHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYPRRRQWLSAGQTGVATPKAD 190 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M++VWW G+IH+ L G TIT++ Y QQ+D + KL+ Q + Sbjct 191 LHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY------F 244 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ +KL +LG+ +PHPPYSPDL+PTDYH F+ L N L+ K+F ++ D Sbjct 245 LHDNARPHVAKSAREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDESDV 304 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 305 KTELVKFFDEKSQDFYERGIMPLPERWQQVVDSNGKY 341 >pir||T32676 hypothetical protein K07C6.12 - Caenorhabditis elegans Length=339 Score = 295 bits (754), Expect = 3e-78, Method: Composition-based stats. Identities = 148/338 (43%), Positives = 206/338 (60%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++ A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLVHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGTWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T24136 hypothetical protein R10E4.8 - Caenorhabditis elegans Length=339 Score = 293 bits (749), Expect = 1e-77, Method: Composition-based stats. Identities = 147/340 (43%), Positives = 206/340 (60%), Gaps = 6/340 (1%) Query 3 MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDE 62 + L+++ +R + L+EF +G A E RNI A G G + T + WF+KF GD SLE+ Sbjct 4 ITLERRDVRLLLLYEFCLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEI 63 Query 63 ERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHE 122 E SGRP E++ + L ++E +P + RE+ ++L HST+ RHL ++G KL WVPHE Sbjct 64 ECSGRPVELNEEDLVKLVEEEPRLSLREMEKKLECCHSTIARHLGRLGFTSKLGIWVPHE 123 Query 123 LSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPK 182 LS +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PK Sbjct 124 LSASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPK 183 Query 183 PNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGP 242 P+LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 184 PDLHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY----- 238 Query 243 ILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQ 302 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 239 -FLHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEE 297 Query 303 DAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 298 HLKTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >gb|AAZ67099.1| transposase [Adineta vaga] Length=345 Score = 291 bits (746), Expect = 3e-77, Method: Composition-based stats. Identities = 148/340 (43%), Positives = 204/340 (60%), Gaps = 6/340 (1%) Query 2 EMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 61 +M L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLPHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 62 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPH 121 RSGRP EVD D L+ +IE DP T R +AE+L H+TV +HL ++GK K W+PH Sbjct 68 SPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 122 ELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFP 181 ELS +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 182 KPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKG 241 K + H KK +++VWW G+IH+ L G IT++ Y QQ+D + KL+ Q + Sbjct 188 KADFHSKKFILSVWWGFKGVIHWEVLPNGYPITADLYCQQLDRVPEKLKGKQDRVY---- 243 Query 242 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQ 301 LHDNARPHVA+ T ++L +LG+ +PHPPYSPDL+PTDYH F+ L N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREELLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 302 QDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >emb|CAA56855.1| planarian mariner-0 gene [Girardia tigrina] Length=273 Score = 290 bits (743), Expect = 6e-77, Method: Composition-based stats. Identities = 145/274 (52%), Positives = 187/274 (68%), Gaps = 2/274 (0%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 ++ +IR + +EF G + NIN+ + + TV WFK+F GD L ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDLSNQPR 60 Query 65 SGRPS-EVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHEL 123 GRP +VDND L+A +EAD + E+A + V ST++ HLKQI KVKKLDKWVPHEL Sbjct 61 -GRPEIKVDNDALKADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLDKWVPHEL 119 Query 124 SENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKP 183 + K +R + SL+ RN +PFL RIVTCDEKWI+YDNR+R +QWLD +E PKHFPK Sbjct 120 KDEHKQQRLDACLSLLSRNKADPFLHRIVTCDEKWIMYDNRKRSSQWLDPDEPPKHFPKR 179 Query 184 NLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPI 243 +HQKK+MVTVWWS+ G+IHY F+ PG +ITS+ Y Q+D+M KL QP + NR PI Sbjct 180 KVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQPKMFNRLTPI 239 Query 244 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPD 277 LLHDNARPH A+ T+ KL +LG E L HPPYSPD Sbjct 240 LLHDNARPHSAKNTVAKLQQLGLETLRHPPYSPD 273 >gb|AAZ67094.1| transposase [Adineta vaga] Length=345 Score = 290 bits (741), Expect = 1e-76, Method: Composition-based stats. Identities = 148/340 (43%), Positives = 203/340 (59%), Gaps = 6/340 (1%) Query 2 EMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 61 +M L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 62 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPH 121 RSGRP EV D L+ +IE DP T R +AE+L H+TV +HL ++GK K W+P+ Sbjct 68 LPRSGRPMEVGVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVGKHLNELGKTWKYGVWIPY 127 Query 122 ELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFP 181 ELS +Q + + LI N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQGVDACMDLITFYRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 182 KPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKG 241 K +LH KK+M++VWW G+I + L G TIT++ Y QQ+D + KL+ Q + Sbjct 188 KADLHSKKLMLSVWWGIKGVIRWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 242 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQ 301 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL+PTDYH F+ L N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 302 QDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >pir||T27281 hypothetical protein Y64G10A.d - Caenorhabditis elegans Length=352 Score = 289 bits (740), Expect = 1e-76, Method: Composition-based stats. Identities = 146/334 (43%), Positives = 204/334 (61%), Gaps = 6/334 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNA PHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNAMPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCN 338 + F SRS DF++ GI L S+WQ+ VD N Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTN 333 >gb|AAZ67103.1| transposase [Adineta vaga] Length=345 Score = 289 bits (740), Expect = 1e-76, Method: Composition-based stats. Identities = 149/337 (44%), Positives = 202/337 (59%), Gaps = 6/337 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L +++R + L EF++G KA E NI G G + RT Q WF D L+D R Sbjct 11 LSHREVRVLLLHEFRLGNKATEAASNICGTMGQGLVSTRTAQRWFNHCKNRDLELDDLPR 70 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP EVD D L+ +IE DP T R +AE+L H+TV +HL ++GK K W+PHELS Sbjct 71 SGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPHELS 130 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +Q +R + LI + N +L +VT +EKW+LY N R QWL + PK + Sbjct 131 AHQLQQRVDACMDLITSHRNYQWLSNLVTGEEKWVLYVNYTRRRQWLSAGQTGVATPKAD 190 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M++VWW G+IH+ L G TIT++ Y QQ+D + KL+ Q + Sbjct 191 LHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY------F 244 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL+PTDYH F+ L N L+ K+F + D Sbjct 245 LHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDEESDV 304 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 305 KTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >ref|XP_001121351.1| Gene info PREDICTED: similar to SET domain and mariner transposase fusion [Apis mellifera] Length=342 Score = 289 bits (739), Expect = 2e-76, Method: Composition-based stats. Identities = 146/332 (43%), Positives = 205/332 (61%), Gaps = 2/332 (0%) Query 3 MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDE 62 M DK +R L+EF+ GR A E RN+ F GT ++RT + W++KF D D+ Sbjct 1 MATDKVHLRHCILYEFQQGRNATEACRNLLKMF-EGTVSDRTCRRWYEKFETSDFDFSDK 59 Query 63 ERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHE 122 RSGRPS +D++ ++A++E DP TT E+AE LN + H+++IG K +WVPHE Sbjct 60 LRSGRPSLIDDNVVKAMLEQDPFLTTSEIAERLNSAQQIISDHIRKIGLGWKYSRWVPHE 119 Query 123 LSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPK 182 LS+ + R + + L+ RN EPFL+R++T DEKWI+Y+N R + + + K Sbjct 120 LSQKNLDDRVVICTFLLARNKIEPFLNRMITGDEKWIIYNNIVRKRTYCELGKPSPSTSK 179 Query 183 PNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEK-YAQQIDEMHRKLQRLQPALVNRKG 241 PNL K M+ +WW G IHY L P E + SEK Y QQ+D + +Q+ +PA+ NRK Sbjct 180 PNLTLNKRMLCIWWDIRGPIHYELLKPNEKLNSEKFYCQQLDNLKTAVQKKRPAMFNRKD 239 Query 242 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQ 301 IL HDNARPH A QK+ E+G+E+L HPPYSPD++ +DYH F L NFL K+F N+ Sbjct 240 IILHHDNARPHAALGARQKIAEVGWEILSHPPYSPDIALSDYHLFLSLQNFLTSKKFKNK 299 Query 302 QDAENAFQEFVESRSTDFYATGINKLISRWQK 333 +D + A +F S+ F+ GI KL SRWQK Sbjct 300 EDVKQALVQFFASKDETFFKNGIYKLPSRWQK 331 >pir||T27715 hypothetical protein ZK1225.3 - Caenorhabditis elegans Length=339 Score = 288 bits (738), Expect = 3e-76, Method: Composition-based stats. Identities = 146/338 (43%), Positives = 204/338 (60%), Gaps = 6/338 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGR E++ + L ++E +P + RE+ E+L HST+ RHL ++G KL WVPHELS Sbjct 66 SGRLVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +QK R V + L+ +L+ +V DEKW+LY N R QWL E PKP+ Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVIGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARP VA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ K+F +++ Sbjct 240 LHDNARPPVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 + F SRS DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >emb|CAD26968.1| transposase [Meloidogyne chitwoodi] Length=340 Score = 287 bits (735), Expect = 6e-76, Method: Composition-based stats. Identities = 144/339 (42%), Positives = 215/339 (63%), Gaps = 1/339 (0%) Query 4 MLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEE 63 M +KK+IR L EF++G AAE RNI A G +E T + WF KF GD S +D Sbjct 1 MDEKKRIRERLLHEFQLGHTAAEAARNIKKALGDNALDESTARRWFTKFRTGDFSTDDGF 60 Query 64 RSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHEL 123 RSGRPS + + LRA I +P T+TR++AEEL TV R++K++ + + VPH+L Sbjct 61 RSGRPSTFETEPLRAAINENPATSTRKLAEELGSSKDTVWRNMKEMELSYRSGRTVPHDL 120 Query 124 SENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKP 183 +E ++ +R E+ +L+ R PFLD+I+TCDE WILYDNR QWL + PK Sbjct 121 NEQKRQKRVEICRTLLQRQQTSPFLDQILTCDESWILYDNRASEKQWLAVGQDANATPK- 179 Query 184 NLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPI 243 LH KK +++VWW G++++ L TITSE Y +Q+ + ++L+R + RKG + Sbjct 180 QLHPKKQLLSVWWCVHGIVYWELLPLNRTITSEVYCEQLHRVQQQLRRPPYTVWARKGIL 239 Query 244 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQD 303 D ARPHV+ T +K+ +LG+++L H PYSPDL+P+DY+ F L +FL+GK+F N+++ Sbjct 240 FQQDGARPHVSAVTRKKIEDLGWDILEHSPYSPDLAPSDYYLFSPLKDFLRGKQFSNEEE 299 Query 304 AENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYF 342 A + F +S+ ++Y GI KL + W++C+ CNG+YF Sbjct 300 ICTALKNFFDSKGPEWYRKGIEKLPNLWERCIQCNGNYF 338 >gb|AAZ67102.1| transposase [Adineta vaga] Length=345 Score = 283 bits (725), Expect = 9e-75, Method: Composition-based stats. Identities = 144/337 (42%), Positives = 200/337 (59%), Gaps = 6/337 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L +++R + L EF++G KA E NI G G + RT Q WF D L+D R Sbjct 11 LSHREVRVLLLHEFRLGNKATEAASNICGTVGQGLVSTRTAQRWFNHCKNRDLELDDLPR 70 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGRP EVD D L+ +IE DP T R +AE+L H+TV +HL ++GK K W+PHELS Sbjct 71 SGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPHELS 130 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +Q +R + LI + N +L ++T +EKW+LY N R QWL + PK + Sbjct 131 AHQLQQRVDACMDLITSHRNYQWLSNLITGEEKWVLYVNYTRRRQWLSAGQTGVATPKAD 190 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK M+++WW G+IH+ L G IT++ Y Q+D + +L+ Q + Sbjct 191 LHSKKSMLSIWWGIKGVIHWEVLPNGYPITADLYCHQLDRVAERLKGKQDRVY------F 244 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL+PTDYH F+ L N L+ K+F ++ D Sbjct 245 LHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRNKKFDDESDV 304 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 305 KTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >gb|AAZ67105.1| transposase [Adineta vaga] Length=345 Score = 282 bits (721), Expect = 2e-74, Method: Composition-based stats. Identities = 146/337 (43%), Positives = 202/337 (59%), Gaps = 6/337 (1%) Query 5 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 64 L ++IR + L EF++ KA E NI G G + RT Q WF F D L+D R Sbjct 11 LSHREIRVLSLHEFRLDHKATEAANNICGTMGQGLVSTRTAQRWFNHFKNRDLELDDVPR 70 Query 65 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELS 124 SGR E+D LR +I+ DP +T +AE+L H+TV +HLK++GK K W+PH+LS Sbjct 71 SGRLMELDVGFLRQLIQQDPRSTLGYLAEQLGFSHTTVEKHLKELGKTWKYGVWIPHKLS 130 Query 125 ENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPN 184 +Q +R + LI + N +L ++T DEKW+LY N R QWL + PK + Sbjct 131 SHQLQQRGDTCMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATPKAD 190 Query 185 LHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPIL 244 LH KK+M++VWW G+IH+ L G TIT++ Y QQ+D + KL+ Q + Sbjct 191 LHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY------F 244 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL+PTDYH F+ L N L+ K+F ++ D Sbjct 245 LHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNGLRDKKFDDESDV 304 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 305 KTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >dbj|BAB86288.1| mariner transposase [Apis cerana] Length=336 Score = 282 bits (721), Expect = 2e-74, Method: Composition-based stats. Identities = 147/339 (43%), Positives = 208/339 (61%), Gaps = 6/339 (1%) Query 3 MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDE 62 M K+ R I LF ++ G+ A + + + +G G R Q WF KF + ++D Sbjct 1 MQDQKEHFRHILLFYYRKGKNAVQARKKLCEIYGEGILTVRQCQNWFSKFRSDNFDIKDA 60 Query 63 ERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHE 122 RSGRP E D D+++A+IEA+ TTRE+A LN+ +STV H+K++G V KLD WVPH Sbjct 61 PRSGRPVEADEDKIKALIEANRRITTREIATRLNLSNSTVHDHMKRLGFVSKLDIWVPHV 120 Query 123 LSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPK 182 L E R ++ SL+ R N+PFL RIVT DEKWI+YDN +R + E + K Sbjct 121 LKEKDLLCRIDICDSLLKREENDPFLKRIVTGDEKWIVYDNIKR-----ELNEPAQRTSK 175 Query 183 PNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGP 242 N+H KKVM++VWW G++ + L TI SE Y Q+D+++ +++ +P L+NRKG Sbjct 176 NNIH-KKVMLSVWWDFKGVVFFELLPNNCTINSEVYCNQLDKLNNSIKQKRPELINRKGV 234 Query 243 ILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQ 302 + HDNA+ H++ T QKL +LG+EVLPHPPYSPDL+P+DYH F+ L N L K F + + Sbjct 235 VFHHDNAKAHMSLMTRQKLLQLGWEVLPHPPYSPDLAPSDYHLFRSLQNSLNDKTFTSNE 294 Query 303 DAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 D +N +F ++ FY GI L RWQ +D NG Y Sbjct 295 DVKNYLDQFFANKDQKFYERGIMLLPKRWQYVLDHNGQY 333 >gb|AAZ67100.1| transposase [Adineta vaga] Length=345 Score = 279 bits (714), Expect = 1e-73, Method: Composition-based stats. Identities = 144/340 (42%), Positives = 198/340 (58%), Gaps = 6/340 (1%) Query 2 EMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 61 +M L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 62 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPH 121 RSGRP EVD D L+ +IE DP T R +AE+L H+TV +HL ++GK + W+PH Sbjct 68 LPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWEYGVWIPH 127 Query 122 ELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFP 181 ELS +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 182 KPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKG 241 K H KK +++ WW G+I + L G IT++ Q+D + KL+ Q + Sbjct 188 KVYFHSKKFILSFWWGIKGVIPWEVLPNGYPITADLDCHQLDRVAEKLKGKQDRVY---- 243 Query 242 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQ 301 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL+PTDYH F+ L N L+ K+F + Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDEE 301 Query 302 QDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >dbj|BAE88734.1| UniGene info unnamed protein product [Macaca fascicularis] Length=147 Score = 278 bits (712), Expect = 2e-73, Method: Composition-based stats. Identities = 131/143 (91%), Positives = 139/143 (97%), Gaps = 0/143 (0%) Query 201 LIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLHDNARPHVAQPTLQK 260 +IHYSFLNPGETITSEKYAQ+IDEMH+KLQ LQ ALVNRKGPILLHDNARPHVAQPTLQK Sbjct 5 IIHYSFLNPGETITSEKYAQEIDEMHQKLQHLQLALVNRKGPILLHDNARPHVAQPTLQK 64 Query 261 LNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAENAFQEFVESRSTDFY 320 LNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHNQQDAENAFQEFV+SRSTDFY Sbjct 65 LNELGYEVLPHPPYSPDLLPTNYHIFKHLNNFLQGKRFHNQQDAENAFQEFVKSRSTDFY 124 Query 321 ATGINKLISRWQKCVDCNGSYFD 343 ATGIN+LISRWQKCVDCNG+YFD Sbjct 125 ATGINQLISRWQKCVDCNGAYFD 147 >pir||T18991 hypothetical protein C06B8.5 - Caenorhabditis elegans Length=314 Score = 278 bits (710), Expect = 4e-73, Method: Composition-based stats. Identities = 142/317 (44%), Positives = 192/317 (60%), Gaps = 6/317 (1%) Query 26 ETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPL 85 E RNI A G G + T + WF+KF GD SLE+ ERSGRP E++ + L ++E +P Sbjct 2 EAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIERSGRPVELNEEDLVKLVEEEPR 61 Query 86 TTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSENQKNRRFEVSSSLILRNNNE 145 + RE+ E+L HST+ RHL ++G KL WVPHELS +QK R V + L+ Sbjct 62 LSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELSASQKLTRVNVCTQLLTFRRKF 121 Query 146 PFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLHQKKVMVTVWWSAAGLIHYS 205 +L+ +VT DEKW+LY N R QWL E PKP+LH KK+M+ VWW G +H+ Sbjct 122 DWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPDLHPKKIMICVWWGVQGPVHWE 181 Query 206 FLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLHDNARPHVAQPTLQKLNELG 265 L +TIT++ Y Q+D + K L LHDNARPHVA+ T QKL +LG Sbjct 182 LLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------FLHDNARPHVAKKTFQKLQDLG 235 Query 266 YEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAENAFQEFVESRSTDFYATGIN 325 + VLPHPPYSPDL+PTDYH F L ++++ K+F +++ + F SRS DF++ GI Sbjct 236 WTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHLKTELSTFFSSRSPDFFSRGIM 295 Query 326 KLISRWQKCVDCNGSYF 342 L S+WQ+ VD NG Y Sbjct 296 MLPSKWQQVVDTNGEYL 312 >gb|AAZ67106.1| transposase [Adineta vaga] Length=345 Score = 276 bits (707), Expect = 1e-72, Method: Composition-based stats. Identities = 144/341 (42%), Positives = 201/341 (58%), Gaps = 6/341 (1%) Query 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 + M L +++I + L EF++G KA E NI + G + RT Q WF +F G+ L Sbjct 7 LNMNLSRREILVLLLHEFRLGHKATEAANNICSTMGEDVLSTRTAQHWFNRFKNGNLELN 66 Query 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 D RSGRP EVD D L+ +IE DP T R +AE L + V +HLK++GK K W+P Sbjct 67 DLLRSGRPLEVDVDLLQQLIEQDPRLTLRCLAEHLGCSYVAVEKHLKELGKTWKYGVWIP 126 Query 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 HELS +Q R + L+ + N +L ++T DEKW+LY N QWL + Sbjct 127 HELSSHQLQHRVDACMDLMTSHRNYEWLRNLITGDEKWVLYVNYTHRRQWLSPGQTGVAT 186 Query 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 PKP+LH KKVM++VWW G+IH+ FL G TIT++ Y QQ+D + +KL Q + Sbjct 187 PKPDLHPKKVMLSVWWGVNGIIHWEFLPNGCTITADLYCQQLDRVAQKLNGKQDRVY--- 243 Query 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 LHDNARP VA+ T +KL +LG+ +PHPPYSPDL+PTDYH F+ L + L+ K+F + Sbjct 244 ---YLHDNARPRVAKLTCEKLLKLGWINVPHPPYSPDLAPTDYHLFRSLSHHLREKKFDD 300 Query 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 D + F +S DF+ GI L RW++ +D G+Y Sbjct 301 DNDMKMDISNFFGRKSKDFHERGILSLPERWRQVIDSGGAY 341 >gb|AAF60722.1| Hypothetical protein Y49F6A.4 [Caenorhabditis elegans] Length=514 Score = 273 bits (698), Expect = 1e-71, Method: Composition-based stats. Identities = 141/314 (44%), Positives = 191/314 (60%), Gaps = 6/314 (1%) Query 26 ETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPL 85 E RNI A G G + T + WF+KF GD SLE+ ERSGRP E++ + L ++E +P Sbjct 2 EAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIERSGRPVELNEEDLVKLVEEEPR 61 Query 86 TTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSENQKNRRFEVSSSLILRNNNE 145 + RE+ E+L HST+ RHL ++G KL WVPHELS +QK R V + L+ Sbjct 62 LSLREMEEKLECCHSTIARHLGRLGFTSKLGTWVPHELSASQKLTRVNVCTQLLTFRRKF 121 Query 146 PFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLHQKKVMVTVWWSAAGLIHYS 205 +L+ +VT DEKW+LY N R QWL E PKP+LH KK+M+ VWW G +H+ Sbjct 122 DWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPDLHPKKIMICVWWGVQGPVHWE 181 Query 206 FLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILLHDNARPHVAQPTLQKLNELG 265 L +TIT++ Y Q+D + K L LHDNARPHVA+ T QKL +LG Sbjct 182 LLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------FLHDNARPHVAKKTFQKLQDLG 235 Query 266 YEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAENAFQEFVESRSTDFYATGIN 325 + VLPHPPYSPDL+PTDYH F L ++++ K+F +++ + F SRS DF++ GI Sbjct 236 WTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHLKTELSTFFSSRSPDFFSRGIM 295 Query 326 KLISRWQKCVDCNG 339 L S+WQ+ VD NG Sbjct 296 MLPSKWQQVVDTNG 309 >ref|XP_001120719.1| Gene info PREDICTED: similar to T12B5.6 [Apis mellifera] Length=335 Score = 272 bits (696), Expect = 2e-71, Method: Composition-based stats. Identities = 142/339 (41%), Positives = 206/339 (60%), Gaps = 7/339 (2%) Query 3 MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDE 62 M K+ R I LF ++ G+ A + + + +G G R Q WF KF + ++D Sbjct 1 MQDQKEHFRHILLFYYRKGKNAVQARKKLCEIYGEGILTVRQCQNWFSKFRSDNFDIKDA 60 Query 63 ERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHE 122 R GRP E D D+++A+IEA+ TTRE+A LN+ +STV H+K++G V KLD WVPH Sbjct 61 PRPGRPVEADEDKIKALIEANRRITTREIAARLNLSNSTVHDHMKRLGFVSKLDIWVPHA 120 Query 123 LSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPK 182 L E RR ++ L+ R N+PFL+RI+T DEKWI+YDN +R E P+ K Sbjct 121 LKEKDLLRRIDICDLLLKREENDPFLERIITGDEKWIVYDNIKRELN----EPPPR--TK 174 Query 183 PNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGP 242 N+H KKV+++VWW G+I + L TI SE Y Q+D+++ +++ +P L+NRKG Sbjct 175 KNIH-KKVLLSVWWDFKGVIFFELLPDICTINSEVYCNQLDKLNNSIKQKRPELINRKGV 233 Query 243 ILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQ 302 + HDN + H++ T QKL +LG+EVLPHPPYSPDL+P+DYH F+ L N L + F + + Sbjct 234 VFHHDNTKAHMSLMTRQKLLQLGWEVLPHPPYSPDLAPSDYHLFRSLQNSLDDRTFSSNE 293 Query 303 DAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSY 341 D N ++ ++ FY GI L RWQ ++ NG Y Sbjct 294 DVTNYLDQYFANKDQKFYEHGIMLLPKRWQYVLEHNGQY 332 >gb|AAN86602.1| transposase [Carpelimus sp. HMR-1993] Length=150 Score = 268 bits (685), Expect = 4e-70, Method: Composition-based stats. Identities = 127/149 (85%), Positives = 140/149 (93%), Gaps = 0/149 (0%) Query 124 SENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKP 183 +ENQKNRRFEVSS+L+LRNNN+PFLDRIVTCDEKWILYDNRRR AQWLDR++AP+HFPKP Sbjct 1 NENQKNRRFEVSSALLLRNNNDPFLDRIVTCDEKWILYDNRRRSAQWLDRDQAPQHFPKP 60 Query 184 NLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPI 243 LHQKKVMVTVWWS AG+IH+SFLNPGETIT+E Y QQIDEMH+KLQR+ P LVN KGPI Sbjct 61 ALHQKKVMVTVWWSVAGVIHHSFLNPGETITAEIYCQQIDEMHQKLQRMCPRLVNMKGPI 120 Query 244 LLHDNARPHVAQPTLQKLNELGYEVLPHP 272 LLHDNARPHVAQPTLQKLN+LGYE LPHP Sbjct 121 LLHDNARPHVAQPTLQKLNQLGYETLPHP 149 >gb|AAB61385.1| transposase [Hydra littoralis] Length=150 Score = 263 bits (673), Expect = 8e-69, Method: Composition-based stats. Identities = 126/150 (84%), Positives = 138/150 (92%), Gaps = 0/150 (0%) Query 124 SENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKP 183 +ENQKNRRFEVSS+L+LRN N+PFL RIVTCDEKWILYDNRRR AQWLDR+EAP+HFPKP Sbjct 1 NENQKNRRFEVSSALLLRNKNDPFLGRIVTCDEKWILYDNRRRSAQWLDRDEAPQHFPKP 60 Query 184 NLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPI 243 NLHQKKVMVTVWWSAAGLIH+SFLN GETIT+EKY QQIDE H+KL+ + P LVN KGP+ Sbjct 61 NLHQKKVMVTVWWSAAGLIHHSFLNLGETITAEKYCQQIDETHQKLRCMCPRLVNMKGPV 120 Query 244 LLHDNARPHVAQPTLQKLNELGYEVLPHPP 273 LLHDNARPHVAQPTLQKLN LGYE LPHPP Sbjct 121 LLHDNARPHVAQPTLQKLNALGYETLPHPP 150 >gb|AAA66077.1| transposase [Mayetiola destructor] Length=347 Score = 261 bits (668), Expect = 3e-68, Method: Composition-based stats. Identities = 130/338 (38%), Positives = 195/338 (57%), Gaps = 1/338 (0%) Query 7 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 66 ++ +R + L F + AAE+ R + +G + WF++F GD ED+ER G Sbjct 10 RRHLREVLLGHFFAKKTAAESHRLLVEVYGEHALAKTQCFEWFQRFKSGDFDTEDKERPG 69 Query 67 RPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSEN 126 +P + ++++L A+++ D T E+A+ L V + + LK G ++K WVPHEL Sbjct 70 QPKKFEDEELEALLDEDCCQTQEELAKSLGVTQQAISKRLKAAGYIQKQGNWVPHELKPR 129 Query 127 QKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLH 186 RRF +S L+ R+ + FL RI+T DEKWI YDN +R ++ R K PK NLH Sbjct 130 DVERRFCMSEMLLQRHKKKSFLSRIITGDEKWIHYDNSKRKKSYVKRGGRAKSTPKSNLH 189 Query 187 QKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILL- 245 KVM+ +WW G+++Y L PG+TIT + Y Q+ + + L +P R G ++ Sbjct 190 GAKVMLCIWWDQRGVLYYELLEPGQTITGDLYRTQLIRLKQALAEKRPEYAKRHGAVIFH 249 Query 246 HDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAE 305 HDNARPHVA P L G+EVLPHPPYSPDL+P+DYH F+ + N L GKRF ++Q Sbjct 250 HDNARPHVALPVKNYLENSGWEVLPHPPYSPDLAPSDYHLFRSMQNDLAGKRFTSEQGIR 309 Query 306 NAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 F+ ++ F+ GI++L RW+K + +G YF+ Sbjct 310 KWLDSFLAAKPAKFFEKGIHELSERWEKVIASDGQYFE 347 >gb|AAC16613.1| transposase [Drosophila simulans] Length=345 Score = 257 bits (656), Expect = 8e-67, Method: Composition-based stats. Identities = 129/339 (38%), Positives = 201/339 (59%), Gaps = 1/339 (0%) Query 6 DKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERS 65 +K+Q R + +F F + + AAE+ R + AFG +T + WF++F GD ++D+E Sbjct 7 NKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDKEHG 66 Query 66 GRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSE 125 P ++ +L+A+++ D T +++AE+L V V L+++GK++K+ +WVPHEL+E Sbjct 67 KPPKRYEDAELQALLDEDGAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVGRWVPHELNE 126 Query 126 NQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNL 185 Q RR L+ R + FL RIVT DEKWI + N +R ++D + +PN Sbjct 127 RQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVNPKRKKSYVDPGQPATSTARPNR 186 Query 186 HQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK-GPIL 244 KK M+ VWW +G+I+Y L PGET+ + +Y QQ+ ++R LQR +P R+ G I Sbjct 187 FGKKTMLCVWWDQSGVIYYELLKPGETVNTARYQQQLINLNRALQRKRPEYQKRQHGVIF 246 Query 245 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDA 304 LHDNA H A+ L L +EVLPH YSPDL+P+DYH F + + L +RF + + Sbjct 247 LHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESV 306 Query 305 ENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 + E+ ++ +FY GI+KL RW+KCV +G YF+ Sbjct 307 KKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE 345 >gb|AAC28162.1| mariner transposase [Glossina palpalis] Length=150 Score = 256 bits (655), Expect = 1e-66, Method: Composition-based stats. Identities = 124/150 (82%), Positives = 138/150 (92%), Gaps = 0/150 (0%) Query 124 SENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKP 183 +ENQKNRRFEVSSSL+LRNN++PFL+RIVTCDEKWILYDNRRR AQWLD +EAP+HFPKP Sbjct 1 NENQKNRRFEVSSSLLLRNNDDPFLNRIVTCDEKWILYDNRRRSAQWLDADEAPQHFPKP 60 Query 184 NLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPI 243 LHQKK+MVTVWWSA GLIH+SFLNPGETIT+EKY QQIDEMH++LQ+ QPALVNRKGPI Sbjct 61 KLHQKKIMVTVWWSAVGLIHHSFLNPGETITAEKYCQQIDEMHQRLQQKQPALVNRKGPI 120 Query 244 LLHDNARPHVAQPTLQKLNELGYEVLPHPP 273 LLHDNARPHV+ T QKL ELGYE L HPP Sbjct 121 LLHDNARPHVSMITRQKLYELGYETLDHPP 150 >emb|CAH03740.1| transposase [Messor bouvieri] Length=345 Score = 256 bits (653), Expect = 2e-66, Method: Composition-based stats. Identities = 127/336 (37%), Positives = 200/336 (59%), Gaps = 1/336 (0%) Query 9 QIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRP 68 +R LF F ++AAE+ R + +G RT + WF++F GD +++D+ER GRP Sbjct 10 HLRHALLFLFHQKKRAAESHRLLVETYGEHAPTIRTCETWFRQFKCGDFNVQDKERPGRP 69 Query 69 SEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVPHELSENQK 128 ++ +L+ +++ D T +++AE+LNV + L+ +GK++K+ +WVPHEL++ Q Sbjct 70 KTFEDAELQELLDEDSTQTQKQLAEKLNVSRVAICERLQAMGKIQKMGRWVPHELNDRQM 129 Query 129 NRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHFPKPNLHQK 188 R VS L+ R + FL RIVT DEKWI ++N +R WL EA +PN + Sbjct 130 ENRKIVSEMLLQRYERKSFLHRIVTGDEKWIYFENPKRKKSWLSPGEAGPSTARPNRFGR 189 Query 189 KVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRKGPILL-HD 247 K M+ VWW G+++Y L PGET+ +++Y QQ+ ++ L +P R ++L HD Sbjct 190 KTMLCVWWDQIGVVYYELLKPGETVNTDRYRQQMINLNCALIEKRPQYAQRHDKVILQHD 249 Query 248 NARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAENA 307 NA H A+P + L LG+EVL HPPYSPDL+P+DYH F + + L + F + ++ + Sbjct 250 NAPSHTAKPVKEMLKSLGWEVLSHPPYSPDLAPSDYHLFASMGHALAEQHFADFEEVKKW 309 Query 308 FQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 E+ S+ F+ GI+KL RW KC++ NG YF+ Sbjct 310 LDEWFSSKEKLFFWNGIHKLSERWTKCIESNGQYFE 345 >pir||T29572 hypothetical protein F30B5.5 - Caenorhabditis elegans Length=617 Score = 255 bits (652), Expect = 3e-66, Method: Composition-based stats. Identities = 128/284 (45%), Positives = 175/284 (61%), Gaps = 6/284 (2%) Query 55 GDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKK 114 GD SLE+ ERSGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++G K Sbjct 24 GDFSLEEIERSGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSK 83 Query 115 LDKWVPHELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDRE 174 L WVPHELS +QK R V + L+ +L+ +VT DEKW+LY N R QWL Sbjct 84 LGIWVPHELSASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIG 143 Query 175 EAPKHFPKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQP 234 E PKP+LH KK+M+ VWW G +H+ L +TIT++ Y Q+D + K Sbjct 144 EKGIPTPKPDLHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYE 203 Query 235 ALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQ 294 L LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL+PTDYH F L ++++ Sbjct 204 KLY------FLHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMR 257 Query 295 GKRFHNQQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCN 338 K+F +++ + F SRS DF++ GI L S+WQ+ VD N Sbjct 258 DKQFDDEEHLKTELSTFFSSRSPDFFSRGIMMLPSKWQQAVDTN 301
  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding 
environmental samples from WGS projects
    Posted date:  May 27, 2007  5:53 PM
  Number of letters in database: 1,723,618,044
  Number of sequences in database:  4,984,388
Lambda     K      H
   0.318    0.134    0.414 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4984388
Number of Hits to DB: 61617238
Number of extensions: 2707126
Number of successful extensions: 7729
Number of sequences better than 10: 14
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 7820
Number of HSP's successfully gapped: 14
Length of query: 343
Length of database: 1723618044
Length adjustment: 133
Effective length of query: 210
Effective length of database: 1060694440
Effective search space: 222745832400
Effective search space used: 222745832400
T: 11
A: 40
X1: 16 (7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 78 (34.7 bits)