Job Title: BlastpHsmar1NP006506

Show Conserved Domains

RID=53KY1HFD012, BLASTP 2.2.16 [Mar-25-2007]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 53KY1HFD012


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           4,970,641 sequences; 1,719,627,930 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports

Query=  
Length=671


Distance tree of resultsNew  
Score E Sequences producing significant alignments: (Bits) Value ref|NP_006506.1| SET domain and mariner transposase fusion [H... 1392 0.0 UniGene infoGene info gb|EAW63905.1| SET domain and mariner transposase fusion gene... 1386 0.0 Gene info sp|Q53H47|SETMR_HUMAN Histone-lysine N-methyltransferase SETM... 1385 0.0 Gene info gb|AAC09350.1| unknown [Homo sapiens] 1384 0.0 UniGene infoGene info ref|XP_526121.2| PREDICTED: SET domain and mariner transposas... 1380 0.0 Gene info ref|XP_001099426.1| PREDICTED: similar to SET domain and mari... 1359 0.0 Gene info dbj|BAE87709.1| unnamed protein product [Macaca fascicularis] 973 0.0 UniGene info gb|ABC72088.1| SETMAR [Pan troglodytes] 915 0.0 gb|ABC72089.1| SETMAR [Gorilla gorilla] 914 0.0 gb|ABC72090.1| SETMAR [Pongo pygmaeus] 911 0.0 gb|ABC72091.1| SETMAR [Symphalangus syndactylus] 907 0.0 gb|ABC72092.1| SETMAR [Cercopithecus aethiops] 902 0.0 gb|ABC72093.1| SETMAR [Aotus trivirgatus] 888 0.0 gb|AAH08931.2| SETMAR protein [Homo sapiens] 797 0.0 UniGene infoGene info gb|EAW63904.1| SET domain and mariner transposase fusion gene... 796 0.0 Gene info gb|ABC72087.1| SETMAR [Homo sapiens] 721 0.0 Gene info gb|AAC52010.1| mariner transposase [Homo sapiens] 679 0.0 Gene info gb|EAW63903.1| SET domain and mariner transposase fusion gene... 670 0.0 Gene info gb|AAH11635.1| SETMAR protein [Homo sapiens] 670 0.0 UniGene infoGene info prf||2124399A transposase-like protein 638 0.0 ref|NP_001077195.1| hypothetical protein LOC534913 [Bos tauru... 601 4e-170 Gene info ref|XP_533755.2| PREDICTED: similar to SET domain and mariner... 536 1e-150 UniGene infoGene info ref|NP_001068976.1| hypothetical protein LOC511299 [Bos tauru... 527 7e-148 UniGene infoGene info ref|XP_001071895.1| PREDICTED: similar to SET domain and mari... 511 5e-143 UniGene infoGene info sp|Q5I0M0|SETMR_RAT Histone-lysine N-methyltransferase SETMAR... 510 1e-142 Gene info ref|XP_987717.1| PREDICTED: SET domain and mariner transposas... 506 2e-141 UniGene infoGene info ref|XP_001001353.1| PREDICTED: similar to SET domain and mari... 504 7e-141 Gene info sp|Q80UJ9|SETMR_MOUSE Histone-lysine N-methyltransferase SETM... 503 2e-140 Gene info emb|CAA56856.1| planarian mariner-9 gene [Girardia tigrina] 365 6e-99 emb|CAA50801.1| mariner-1 protein [Girardia tigrina] 363 2e-98 emb|CAA56857.1| planarian mariner-8 gene [Girardia tigrina] 363 3e-98 emb|CAA56858.1| planarian mariner-5 gene [Girardia tigrina] 362 5e-98 prf||1917335A mariner 1 element 360 2e-97 emb|CAA56859.1| planarian mariner-3 gene [Girardia tigrina] 359 3e-97 emb|CAA56763.1| manirer-2 [Girardia tigrina] 350 2e-94 dbj|BAA21826.1| transposase [Attacus atlas] >dbj|BAB32436.1| ... 333 2e-89 dbj|BAA23532.1| transposase [Bombyx mori] 328 8e-88 gb|AAP51087.1| transposase [Forficula auricularia] 318 9e-85 gb|AAP51085.1| transposase [Forficula auricularia] 318 9e-85 gb|AAP51098.1| transposase [Forficula auricularia] >gb|AAP510... 317 2e-84 gb|AAP51090.1| transposase [Forficula auricularia] >gb|AAP510... 316 4e-84 gb|AAP51096.1| transposase [Forficula auricularia] 315 5e-84 gb|AAP51086.1| transposase [Forficula auricularia] 315 6e-84 gb|AAP51093.1| transposase [Forficula auricularia] 315 6e-84 gb|AAP51092.1| transposase [Forficula auricularia] 315 8e-84 gb|AAO12863.1| Famar1 transposase [Forficula auricularia] 315 9e-84 gb|AAP51091.1| transposase [Forficula auricularia] 314 1e-83 gb|AAP51083.1| transposase [Forficula auricularia] 313 2e-83 gb|AAP51095.1| transposase [Forficula auricularia] 313 3e-83 gb|AAP51097.1| transposase [Forficula auricularia] 313 3e-83 gb|AAP51089.1| transposase [Forficula auricularia] 311 9e-83 gb|AAB17945.1| mariner transposase [Ceratitis capitata] 310 2e-82 ref|NP_001073580.1| Ammar1 transposase [Apis mellifera] >gb|A... 310 2e-82 UniGene infoGene info gb|AAZ67097.1| transposase [Adineta vaga] 310 2e-82 gb|AAO12864.1| Ccmar2 transposase [Ceratitis capitata] 309 3e-82 gb|AAP51082.1| transposase [Forficula auricularia] 309 4e-82 gb|AAP51084.1| transposase [Forficula auricularia] 309 5e-82 gb|AAP51088.1| transposase [Forficula auricularia] 308 8e-82 gb|AAZ67096.1| transposase [Adineta vaga] 308 9e-82 gb|AAZ67092.1| transposase [Adineta vaga] 307 2e-81 gb|AAO12862.1| Camar1 transposase [Chymomyza amoena] 306 3e-81 gb|AAZ67091.1| transposase [Adineta vaga] 305 7e-81 gb|AAZ67101.1| transposase [Adineta vaga] 304 1e-80 gb|AAZ67095.1| transposase [Adineta vaga] 302 4e-80 gb|AAZ67093.1| transposase [Adineta vaga] 302 5e-80 emb|CAD26968.1| transposase [Meloidogyne chitwoodi] 301 6e-80 pir||T25365 hypothetical protein T27E7.7 - Caenorhabditis elegan 300 2e-79 gb|AAZ67098.1| transposase [Adineta vaga] 300 2e-79 pir||T19261 hypothetical protein C14A6.4 - Caenorhabditis elegan 300 3e-79 pir||T20782 hypothetical protein F11D11.9 - Caenorhabditis elega 299 3e-79 pir||T19660 hypothetical protein C33A12.5 - Caenorhabditis elega 299 4e-79 pir||T19600 probable transposition protein C31A11.2 - Caenorh... 299 4e-79 pir||T23086 hypothetical protein H12I19.6 - Caenorhabditis elega 299 5e-79 pir||T19555 hypothetical protein C29E6.6 - Caenorhabditis elegan 298 5e-79 pir||T22780 hypothetical protein F56D5.7 - Caenorhabditis elegan 298 6e-79 pir||T18783 hypothetical protein B0564.5 - Caenorhabditis elegan 298 6e-79 pir||T18779 transposase containing protein - Caenorhabditis eleg 298 8e-79 pir||T26396 hypothetical protein Y105C5B.t - Caenorhabditis eleg 298 9e-79 gb|AAB00629.1| Hypothetical protein R05G6.2 [Caenorhabditis eleg 297 1e-78 pir||T27435 hypothetical protein Y7A5A.4 - Caenorhabditis elegan 297 1e-78 gb|AAF60591.1| Hypothetical protein Y45G12C.13 [Caenorhabditis e 297 1e-78 pir||T20442 hypothetical protein E03H4.1 - Caenorhabditis elegan 297 2e-78 pir||T25335 hypothetical protein T26H8.1 - Caenorhabditis elegan 297 2e-78 gb|AAZ67103.1| transposase [Adineta vaga] 296 2e-78 pir||T32676 hypothetical protein K07C6.12 - Caenorhabditis elega 296 3e-78 dbj|BAE88734.1| unnamed protein product [Macaca fascicularis] 296 4e-78 UniGene info emb|CAA56855.1| planarian mariner-0 gene [Girardia tigrina] 295 4e-78 gb|AAZ67099.1| transposase [Adineta vaga] 295 5e-78 pir||T32726 hypothetical protein C45H4.5 - Caenorhabditis elegan 294 1e-77 gb|AAZ67094.1| transposase [Adineta vaga] 293 3e-77 pir||T27281 hypothetical protein Y64G10A.d - Caenorhabditis eleg 292 6e-77 pir||T24136 hypothetical protein R10E4.8 - Caenorhabditis elegan 292 6e-77 gb|AAZ67105.1| transposase [Adineta vaga] 291 1e-76 pir||T27715 hypothetical protein ZK1225.3 - Caenorhabditis elega 290 3e-76 gb|AAZ67102.1| transposase [Adineta vaga] 288 1e-75 gb|AAZ67100.1| transposase [Adineta vaga] 285 6e-75 ref|XP_001121351.1| PREDICTED: similar to SET domain and mari... 283 2e-74 Gene info dbj|BAB86288.1| mariner transposase [Apis cerana] 282 4e-74 gb|AAZ67106.1| transposase [Adineta vaga] 282 6e-74 pir||T18991 hypothetical protein C06B8.5 - Caenorhabditis elegan 278 8e-73
Alignments
>ref|NP_006506.1| UniGene infoGene info SET domain and mariner transposase fusion [Homo sapiens] gb|AAC52012.1| UniGene infoGene info unknown [Homo sapiens] Length=671 Score = 1392 bits (3603), Expect = 0.0, Method: Composition-based stats. Identities = 671/671 (100%), Positives = 671/671 (100%), Gaps = 0/671 (0%) Query 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 60 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP Sbjct 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 60 Query 61 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 120 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV Sbjct 61 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 120 Query 121 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 180 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI Sbjct 121 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 180 Query 181 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 240 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV Sbjct 181 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 240 Query 241 PEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 300 PEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI Sbjct 241 PEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 300 Query 301 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN 360 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN Sbjct 301 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN 360 Query 361 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA 420 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA Sbjct 361 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA 420 Query 421 EELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV 480 EELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV Sbjct 421 EELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV 480 Query 481 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET 540 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET Sbjct 481 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET 540 Query 541 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP 600 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP Sbjct 541 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP 600 Query 601 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQ 660 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQ Sbjct 601 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQ 660 Query 661 KCVDCNGSYFD 671 KCVDCNGSYFD Sbjct 661 KCVDCNGSYFD 671 >gb|EAW63905.1| Gene info SET domain and mariner transposase fusion gene, isoform CRA_c [Homo sapiens] Length=684 Score = 1386 bits (3587), Expect = 0.0, Method: Composition-based stats. Identities = 668/671 (99%), Positives = 668/671 (99%), Gaps = 0/671 (0%) Query 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 60 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP Sbjct 14 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 73 Query 61 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 120 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV Sbjct 74 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 133 Query 121 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 180 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI Sbjct 134 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 193 Query 181 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 240 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV Sbjct 194 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 253 Query 241 PEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 300 PEEELSYDYSGRYLNLTVS KERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI Sbjct 254 PEEELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 313 Query 301 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN 360 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN Sbjct 314 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN 373 Query 361 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA 420 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA Sbjct 374 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA 433 Query 421 EELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV 480 EELNVNHSTVVRHLKQI KVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV Sbjct 434 EELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV 493 Query 481 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET 540 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET Sbjct 494 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET 553 Query 541 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP 600 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP Sbjct 554 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP 613 Query 601 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQ 660 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQ Sbjct 614 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQ 673 Query 661 KCVDCNGSYFD 671 KCVDCNGSYFD Sbjct 674 KCVDCNGSYFD 684 >sp|Q53H47|SETMR_HUMAN Gene info Histone-lysine N-methyltransferase SETMAR (SET domain and mariner transposase fusion gene-containing protein) (Metnase) (Hsmar1) [Includes: Histone-lysine N-methyltransferase; Mariner transposase Hsmar1] dbj|BAD96454.1| UniGene infoGene info SET domain and mariner transposase fusion gene variant [Homo sapiens] gb|AAY29570.1| UniGene infoGene info metnase [Homo sapiens] Length=671 Score = 1385 bits (3586), Expect = 0.0, Method: Composition-based stats. Identities = 668/671 (99%), Positives = 668/671 (99%), Gaps = 0/671 (0%) Query 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 60 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP Sbjct 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 60 Query 61 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 120 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV Sbjct 61 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 120 Query 121 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 180 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI Sbjct 121 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 180 Query 181 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 240 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV Sbjct 181 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 240 Query 241 PEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 300 PEEELSYDYSGRYLNLTVS KERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI Sbjct 241 PEEELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 300 Query 301 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN 360 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN Sbjct 301 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN 360 Query 361 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA 420 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA Sbjct 361 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA 420 Query 421 EELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV 480 EELNVNHSTVVRHLKQI KVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV Sbjct 421 EELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV 480 Query 481 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET 540 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET Sbjct 481 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET 540 Query 541 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP 600 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP Sbjct 541 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP 600 Query 601 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQ 660 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQ Sbjct 601 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQ 660 Query 661 KCVDCNGSYFD 671 KCVDCNGSYFD Sbjct 661 KCVDCNGSYFD 671 >gb|AAC09350.1| UniGene infoGene info unknown [Homo sapiens] Length=671 Score = 1384 bits (3581), Expect = 0.0, Method: Composition-based stats. Identities = 667/671 (99%), Positives = 667/671 (99%), Gaps = 0/671 (0%) Query 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 60 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP Sbjct 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 60 Query 61 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 120 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV Sbjct 61 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 120 Query 121 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 180 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI Sbjct 121 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 180 Query 181 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 240 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV Sbjct 181 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 240 Query 241 PEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 300 PEEELSYDYSGRYLNLTVS KERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI Sbjct 241 PEEELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 300 Query 301 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN 360 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN Sbjct 301 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN 360 Query 361 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA 420 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA Sbjct 361 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA 420 Query 421 EELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV 480 EELNVNHSTVVRHLKQI KVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV Sbjct 421 EELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV 480 Query 481 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET 540 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET Sbjct 481 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET 540 Query 541 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP 600 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP Sbjct 541 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP 600 Query 601 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQ 660 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLI RWQ Sbjct 601 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLIFRWQ 660 Query 661 KCVDCNGSYFD 671 KCVDCNGSYFD Sbjct 661 KCVDCNGSYFD 671 >ref|XP_526121.2| Gene info PREDICTED: SET domain and mariner transposase fusion [Pan troglodytes] Length=684 Score = 1380 bits (3573), Expect = 0.0, Method: Composition-based stats. Identities = 665/671 (99%), Positives = 667/671 (99%), Gaps = 0/671 (0%) Query 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 60 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP Sbjct 14 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 73 Query 61 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 120 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV Sbjct 74 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 133 Query 121 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 180 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI Sbjct 134 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 193 Query 181 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 240 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV Sbjct 194 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 253 Query 241 PEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 300 PEEELSYDYSGRYLNLTVS KERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI Sbjct 254 PEEELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 313 Query 301 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN 360 SCG+EKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN Sbjct 314 SCGHEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN 373 Query 361 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA 420 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA Sbjct 374 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA 433 Query 421 EELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV 480 EELNVNHSTVVRHLKQI KVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV Sbjct 434 EELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV 493 Query 481 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET 540 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET Sbjct 494 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET 553 Query 541 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP 600 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP Sbjct 554 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP 613 Query 601 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQ 660 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAF+EFVESQSTDFY TGINQLISRWQ Sbjct 614 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFREFVESQSTDFYTTGINQLISRWQ 673 Query 661 KCVDCNGSYFD 671 KCVDCNGSYFD Sbjct 674 KCVDCNGSYFD 684 >ref|XP_001099426.1| Gene info PREDICTED: similar to SET domain and mariner transposase fusion gene [Macaca mulatta] Length=671 Score = 1359 bits (3517), Expect = 0.0, Method: Composition-based stats. Identities = 652/671 (97%), Positives = 662/671 (98%), Gaps = 0/671 (0%) Query 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 60 MAEFK+KPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP Sbjct 1 MAEFKKKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 60 Query 61 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 120 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV Sbjct 61 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 120 Query 121 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 180 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI Sbjct 121 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 180 Query 181 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 240 IAIREHVY GQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV Sbjct 181 IAIREHVYTGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 240 Query 241 PEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 300 PEEELSYDYSGRYLNLT S KERLD+GKLRKPCYCGAKSCTAFLPFD SLYCP+EKSNI Sbjct 241 PEEELSYDYSGRYLNLTGSEDKERLDNGKLRKPCYCGAKSCTAFLPFDGSLYCPLEKSNI 300 Query 301 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN 360 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN Sbjct 301 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNIN 360 Query 361 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA 420 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA Sbjct 361 NAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA 420 Query 421 EELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV 480 EELNVNHSTVVRHLKQI KVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV Sbjct 421 EELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIV 480 Query 481 TCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGET 540 TCDEKWILYDNRRRSAQWLDQE APKHF KPILHPKK+MVTIWWSAAG+IHYSFLNPGET Sbjct 481 TCDEKWILYDNRRRSAQWLDQEAAPKHFSKPILHPKKIMVTIWWSAAGVIHYSFLNPGET 540 Query 541 ITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP 600 ITSEKYAQEIDEM+QKLQ LQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP Sbjct 541 ITSEKYAQEIDEMHQKLQHLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHP 600 Query 601 PYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQ 660 PYSPDLLPTNYH+FKHLNNFLQGKRFHNQQDAENAFQEFV+S+STDFYATGINQLISRWQ Sbjct 601 PYSPDLLPTNYHIFKHLNNFLQGKRFHNQQDAENAFQEFVKSRSTDFYATGINQLISRWQ 660 Query 661 KCVDCNGSYFD 671 KCVDCNG+YFD Sbjct 661 KCVDCNGAYFD 671 >dbj|BAE87709.1| UniGene info unnamed protein product [Macaca fascicularis] Length=479 Score = 973 bits (2515), Expect = 0.0, Method: Composition-based stats. Identities = 461/479 (96%), Positives = 470/479 (98%), Gaps = 0/479 (0%) Query 193 METFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGR 252 METFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGR Sbjct 1 METFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGR 60 Query 253 YLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCG 312 YLNLT S KERLD+GKLRKPCYCGAKSCTAFLPFD SLYCP+EKSNISCGNEKEPSMCG Sbjct 61 YLNLTGSEDKERLDNGKLRKPCYCGAKSCTAFLPFDGSLYCPLEKSNISCGNEKEPSMCG 120 Query 313 SAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERT 372 SAPSVFPSCKRLT ETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERT Sbjct 121 SAPSVFPSCKRLTPETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERT 180 Query 373 VQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVR 432 VQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVR Sbjct 181 VQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVR 240 Query 433 HLKQIEKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNR 492 HLKQI KVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNR Sbjct 241 HLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNR 300 Query 493 RRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDE 552 RRSAQWLDQE APKHF KPILHPKK+MVTIWWSAAG+IHYSFLNPGETITSEKYAQEIDE Sbjct 301 RRSAQWLDQEAAPKHFSKPILHPKKIMVTIWWSAAGVIHYSFLNPGETITSEKYAQEIDE 360 Query 553 MNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYH 612 M+QKLQ LQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYH Sbjct 361 MHQKLQHLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYH 420 Query 613 VFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 +FKHLNNFLQGKRFHNQQDAENAFQEFV+S+STDFYATGINQLISRWQKCVDCNG+YFD Sbjct 421 IFKHLNNFLQGKRFHNQQDAENAFQEFVKSRSTDFYATGINQLISRWQKCVDCNGAYFD 479 >gb|ABC72088.1| SETMAR [Pan troglodytes] Length=446 Score = 915 bits (2365), Expect = 0.0, Method: Composition-based stats. Identities = 438/446 (98%), Positives = 440/446 (98%), Gaps = 0/446 (0%) Query 226 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFL 285 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVS KERLDHGKLRKPCYCGAKSCTAFL Sbjct 1 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFL 60 Query 286 PFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFE 345 PFDSSLYCPVEK NISCG+EKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFE Sbjct 61 PFDSSLYCPVEKLNISCGHEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFE 120 Query 346 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR 405 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR Sbjct 121 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR 180 Query 406 AIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSS 465 AIIEADPLTTTREVAEELNVNHSTVVRHLKQI KVKKLDKWVPHELTENQKNRRFEVSS Sbjct 181 AIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSF 240 Query 466 LILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWS 525 LILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWS Sbjct 241 LILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWS 300 Query 526 AAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPT 585 AAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPT Sbjct 301 AAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPT 360 Query 586 LQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQST 645 LQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAF+EFVESQST Sbjct 361 LQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFREFVESQST 420 Query 646 DFYATGINQLISRWQKCVDCNGSYFD 671 DFY TGINQLISRWQKCVDCNGSYFD Sbjct 421 DFYTTGINQLISRWQKCVDCNGSYFD 446 >gb|ABC72089.1| SETMAR [Gorilla gorilla] Length=446 Score = 914 bits (2363), Expect = 0.0, Method: Composition-based stats. Identities = 438/446 (98%), Positives = 441/446 (98%), Gaps = 0/446 (0%) Query 226 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFL 285 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVS KERLDHGKLRKPC+CGAKSCTAFL Sbjct 1 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSEDKERLDHGKLRKPCHCGAKSCTAFL 60 Query 286 PFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFE 345 PFDSSLYCPVEKSNI CGNEKEPSMCGSAPSVFPSCKRLTLET KMMLDKKQIRAIFLFE Sbjct 61 PFDSSLYCPVEKSNIRCGNEKEPSMCGSAPSVFPSCKRLTLETTKMMLDKKQIRAIFLFE 120 Query 346 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR 405 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR Sbjct 121 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR 180 Query 406 AIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSS 465 AIIEADPLTTTREVAEELNVNHSTVVRHLKQI KVKKLDKWVPHELTENQKNRRFEVSSS Sbjct 181 AIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSS 240 Query 466 LILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWS 525 LILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWS Sbjct 241 LILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWS 300 Query 526 AAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPT 585 AAGLIHYSFLNPGETITSEKYAQEIDEM+QKLQRLQLALVNRKGPILLHDNARPHVAQPT Sbjct 301 AAGLIHYSFLNPGETITSEKYAQEIDEMHQKLQRLQLALVNRKGPILLHDNARPHVAQPT 360 Query 586 LQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQST 645 LQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFV+SQST Sbjct 361 LQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVKSQST 420 Query 646 DFYATGINQLISRWQKCVDCNGSYFD 671 DFYATGINQLISRWQKCVDCNGSYFD Sbjct 421 DFYATGINQLISRWQKCVDCNGSYFD 446 >gb|ABC72090.1| SETMAR [Pongo pygmaeus] Length=446 Score = 911 bits (2354), Expect = 0.0, Method: Composition-based stats. Identities = 436/446 (97%), Positives = 441/446 (98%), Gaps = 0/446 (0%) Query 226 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFL 285 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLT S KERLD+GKLRKPCYCGAKSCTAFL Sbjct 1 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLTGSEDKERLDNGKLRKPCYCGAKSCTAFL 60 Query 286 PFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFE 345 PFDSSLYCP+EKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFE Sbjct 61 PFDSSLYCPLEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFE 120 Query 346 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR 405 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR Sbjct 121 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR 180 Query 406 AIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSS 465 AIIEADPLTTTREVAEELNVNHSTVVRHLKQI KVKKLDKWVPHELTENQKN RFEVSSS Sbjct 181 AIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNHRFEVSSS 240 Query 466 LILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWS 525 LILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWS Sbjct 241 LILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWS 300 Query 526 AAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPT 585 AAGLIHYSFLNPGETITSEKYAQEIDEM+QKLQRLQLALVNRKGPILLHDNARPHVAQPT Sbjct 301 AAGLIHYSFLNPGETITSEKYAQEIDEMHQKLQRLQLALVNRKGPILLHDNARPHVAQPT 360 Query 586 LQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQST 645 LQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFV+S+ST Sbjct 361 LQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVKSRST 420 Query 646 DFYATGINQLISRWQKCVDCNGSYFD 671 DFYATGINQLISRWQKCVDCNGSYFD Sbjct 421 DFYATGINQLISRWQKCVDCNGSYFD 446 >gb|ABC72091.1| SETMAR [Symphalangus syndactylus] Length=446 Score = 907 bits (2343), Expect = 0.0, Method: Composition-based stats. Identities = 431/446 (96%), Positives = 440/446 (98%), Gaps = 0/446 (0%) Query 226 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFL 285 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLT S KERLD+GKLRKPCYCGAKSCTAFL Sbjct 1 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLTGSEDKERLDNGKLRKPCYCGAKSCTAFL 60 Query 286 PFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFE 345 PFDSSLYCP+EKS ISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFE Sbjct 61 PFDSSLYCPLEKSIISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFE 120 Query 346 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR 405 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR Sbjct 121 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR 180 Query 406 AIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSS 465 AIIEADPLTTTREVAEELNVNHSTVVRHLKQI KVKKLDKWVPHELTENQKNRRFEVSSS Sbjct 181 AIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSS 240 Query 466 LILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWS 525 LILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKK M+TIWWS Sbjct 241 LILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKAMITIWWS 300 Query 526 AAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPT 585 AAGLIHYSFLNPGET+TSEKYAQEIDEM+QKLQRLQLALV+RKGP+LLHDNARPHVAQPT Sbjct 301 AAGLIHYSFLNPGETVTSEKYAQEIDEMHQKLQRLQLALVSRKGPVLLHDNARPHVAQPT 360 Query 586 LQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQST 645 LQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEF+ES+ST Sbjct 361 LQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFIESRST 420 Query 646 DFYATGINQLISRWQKCVDCNGSYFD 671 DFYATGINQLISRWQKCVDCNGSYFD Sbjct 421 DFYATGINQLISRWQKCVDCNGSYFD 446 >gb|ABC72092.1| SETMAR [Cercopithecus aethiops] Length=446 Score = 902 bits (2332), Expect = 0.0, Method: Composition-based stats. Identities = 429/446 (96%), Positives = 438/446 (98%), Gaps = 0/446 (0%) Query 226 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFL 285 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLT S KERLD+GKLRKPCYCGAKSCTAFL Sbjct 1 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLTGSEDKERLDNGKLRKPCYCGAKSCTAFL 60 Query 286 PFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFE 345 PFD SLYCP+E+SNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFE Sbjct 61 PFDGSLYCPLEQSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFE 120 Query 346 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR 405 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR Sbjct 121 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR 180 Query 406 AIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSS 465 AIIEADPLTTTREVAEELNVNHSTVVRHLKQI KVKKLDKWVPHELTENQKNRRFEVSSS Sbjct 181 AIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSS 240 Query 466 LILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWS 525 LILRN NEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF KPILHPKK+MVTIWWS Sbjct 241 LILRNRNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFSKPILHPKKIMVTIWWS 300 Query 526 AAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPT 585 AAG+IHYSFLNPGETITSEKYAQEIDEM+QKLQ LQLALVNRKGPILLHDNARPHVAQPT Sbjct 301 AAGVIHYSFLNPGETITSEKYAQEIDEMHQKLQHLQLALVNRKGPILLHDNARPHVAQPT 360 Query 586 LQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQST 645 LQKLNELGYEVLPHPPYSPDLLPTNYH+FKHLNNFLQGKRFHNQQDAENAFQEFV+S+ST Sbjct 361 LQKLNELGYEVLPHPPYSPDLLPTNYHIFKHLNNFLQGKRFHNQQDAENAFQEFVKSRST 420 Query 646 DFYATGINQLISRWQKCVDCNGSYFD 671 DFYATGINQLISRWQKCVDCNGSYFD Sbjct 421 DFYATGINQLISRWQKCVDCNGSYFD 446 >gb|ABC72093.1| SETMAR [Aotus trivirgatus] Length=446 Score = 888 bits (2294), Expect = 0.0, Method: Composition-based stats. Identities = 425/446 (95%), Positives = 433/446 (97%), Gaps = 0/446 (0%) Query 226 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFL 285 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLT S KERLD+ KLRKPCYCGAKSCTAFL Sbjct 1 SMVPKLALFAAKDIVPEEELSYDYSGRYLNLTGSEDKERLDNVKLRKPCYCGAKSCTAFL 60 Query 286 PFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFE 345 PFDSSLYCP+EKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKM LDKKQIRAIFLFE Sbjct 61 PFDSSLYCPLEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMRLDKKQIRAIFLFE 120 Query 346 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLR 405 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDND LR Sbjct 121 FKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDHLR 180 Query 406 AIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSS 465 AIIEADPLTTTREVAEELNVNHSTVVRHLKQI KVKKLDKWVPHELTENQKNRRFEVSSS Sbjct 181 AIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSS 240 Query 466 LILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWS 525 LILRN+NEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH KKVMVTIWWS Sbjct 241 LILRNNNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHQKKVMVTIWWS 300 Query 526 AAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPT 585 AAGLIHYSFLNPGETITSEKY QEIDEM+QKLQRL LALVNRKGPILLHDNARPHV QPT Sbjct 301 AAGLIHYSFLNPGETITSEKYVQEIDEMHQKLQRLPLALVNRKGPILLHDNARPHVVQPT 360 Query 586 LQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQST 645 LQKLNELGYEVLPHPPYSPDLLPTNYH+FKHL+NFLQGKRFHNQQDAENAFQEF+ES+S Sbjct 361 LQKLNELGYEVLPHPPYSPDLLPTNYHIFKHLSNFLQGKRFHNQQDAENAFQEFIESRSR 420 Query 646 DFYATGINQLISRWQKCVDCNGSYFD 671 DFY TGINQLISRWQKCVDCNGSYFD Sbjct 421 DFYTTGINQLISRWQKCVDCNGSYFD 446 >gb|AAH08931.2| UniGene infoGene info SETMAR protein [Homo sapiens] Length=429 Score = 797 bits (2059), Expect = 0.0, Method: Composition-based stats. Identities = 385/401 (96%), Positives = 385/401 (96%), Gaps = 0/401 (0%) Query 271 RKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMK 330 RK C SSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMK Sbjct 29 RKTCRWARGPRGPRRRPSSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMK 88 Query 331 MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDE 390 MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDE Sbjct 89 MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDE 148 Query 391 ERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHE 450 ERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQI KVKKLDKWVPHE Sbjct 149 ERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHE 208 Query 451 LTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPK 510 LTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPK Sbjct 209 LTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPK 268 Query 511 PILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGP 570 PILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGP Sbjct 269 PILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGP 328 Query 571 ILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQ 630 ILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQ Sbjct 329 ILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQ 388 Query 631 DAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 DAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD Sbjct 389 DAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 429 >gb|EAW63904.1| Gene info SET domain and mariner transposase fusion gene, isoform CRA_b [Homo sapiens] Length=448 Score = 796 bits (2055), Expect = 0.0, Method: Composition-based stats. Identities = 382/383 (99%), Positives = 382/383 (99%), Gaps = 0/383 (0%) Query 289 SSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKM 348 SSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKM Sbjct 66 SSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKM 125 Query 349 GRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAII 408 GRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAII Sbjct 126 GRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAII 185 Query 409 EADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSSLIL 468 EADPLTTTREVAEELNVNHSTVVRHLKQI KVKKLDKWVPHELTENQKNRRFEVSSSLIL Sbjct 186 EADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLIL 245 Query 469 RNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAG 528 RNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAG Sbjct 246 RNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAG 305 Query 529 LIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQK 588 LIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQK Sbjct 306 LIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQK 365 Query 589 LNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFY 648 LNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFY Sbjct 366 LNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFY 425 Query 649 ATGINQLISRWQKCVDCNGSYFD 671 ATGINQLISRWQKCVDCNGSYFD Sbjct 426 ATGINQLISRWQKCVDCNGSYFD 448 >gb|ABC72087.1| Gene info SETMAR [Homo sapiens] Length=344 Score = 721 bits (1860), Expect = 0.0, Method: Composition-based stats. Identities = 343/344 (99%), Positives = 343/344 (99%), Gaps = 0/344 (0%) Query 328 TMKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESL 387 TMKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESL Sbjct 1 TMKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESL 60 Query 388 EDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWV 447 EDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQI KVKKLDKWV Sbjct 61 EDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWV 120 Query 448 PHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKH 507 PHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKH Sbjct 121 PHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKH 180 Query 508 FPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNR 567 FPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNR Sbjct 181 FPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNR 240 Query 568 KGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFH 627 KGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFH Sbjct 241 KGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFH 300 Query 628 NQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 NQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD Sbjct 301 NQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 344 >gb|AAC52010.1| Gene info mariner transposase [Homo sapiens] Length=343 Score = 679 bits (1753), Expect = 0.0, Method: Composition-based stats. Identities = 323/343 (94%), Positives = 336/343 (97%), Gaps = 0/343 (0%) Query 329 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 388 M+MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE Sbjct 1 MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60 Query 389 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVP 448 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNV+HSTVVRHLKQI KVKKLDKWVP Sbjct 61 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLDKWVP 120 Query 449 HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF 508 HEL+ENQKNRRFEVSSSLILRN+NEPFLDRIVTCDEKWILYDNRRR AQWLD+EEAPKHF Sbjct 121 HELSENQKNRRFEVSSSLILRNNNEPFLDRIVTCDEKWILYDNRRRPAQWLDREEAPKHF 180 Query 509 PKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRK 568 PKP LH KKVMVT+WWSAAGLIHYSFLNPGETITSEKYAQ+IDEM++KLQRLQ ALVNRK Sbjct 181 PKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQPALVNRK 240 Query 569 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHN 628 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL PT+YH FKHL+NFLQGKRFHN Sbjct 241 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLDNFLQGKRFHN 300 Query 629 QQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 QQDAENAFQEFVES+STDFYATGIN+LISRWQKCVDCNGSYFD Sbjct 301 QQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD 343 >gb|EAW63903.1| Gene info SET domain and mariner transposase fusion gene, isoform CRA_a [Homo sapiens] Length=365 Score = 670 bits (1728), Expect = 0.0, Method: Composition-based stats. Identities = 327/336 (97%), Positives = 330/336 (98%), Gaps = 1/336 (0%) Query 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 60 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP Sbjct 14 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 73 Query 61 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 120 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV Sbjct 74 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 133 Query 121 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 180 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI Sbjct 134 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 193 Query 181 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 240 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV Sbjct 194 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 253 Query 241 PEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 300 PEEELSYDYSGRYLNLTVS KERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI Sbjct 254 PEEELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 313 Query 301 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKK 336 SCGNEKEPSMCGSAPSVFPSCKRLTLE + + DK+ Sbjct 314 SCGNEKEPSMCGSAPSVFPSCKRLTLE-VSLFSDKQ 348 >gb|AAH11635.1| UniGene infoGene info SETMAR protein [Homo sapiens] Length=352 Score = 670 bits (1728), Expect = 0.0, Method: Composition-based stats. Identities = 327/336 (97%), Positives = 330/336 (98%), Gaps = 1/336 (0%) Query 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 60 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP Sbjct 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 60 Query 61 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 120 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV Sbjct 61 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 120 Query 121 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 180 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI Sbjct 121 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 180 Query 181 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 240 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV Sbjct 181 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 240 Query 241 PEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 300 PEEELSYDYSGRYLNLTVS KERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI Sbjct 241 PEEELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 300 Query 301 SCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKK 336 SCGNEKEPSMCGSAPSVFPSCKRLTLE + + DK+ Sbjct 301 SCGNEKEPSMCGSAPSVFPSCKRLTLE-VSLFSDKQ 335 >prf||2124399A transposase-like protein Length=340 Score = 638 bits (1645), Expect = 0.0, Method: Composition-based stats. Identities = 307/341 (90%), Positives = 322/341 (94%), Gaps = 1/341 (0%) Query 331 MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDE 390 MMLDKKQIRAIFLFEFKMG KAAETTRNI+NAFGPGTANE TVQWWFKKFCKGDESLEDE Sbjct 1 MMLDKKQIRAIFLFEFKMGHKAAETTRNISNAFGPGTANEHTVQWWFKKFCKGDESLEDE 60 Query 391 ERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHE 450 E SGRPSEVDNDQLRAII+ADPLTT REVAEEL V+HSTVV+HLKQI KVKKLDKWVPHE Sbjct 61 EYSGRPSEVDNDQLRAIIKADPLTTRREVAEELEVDHSTVVQHLKQIGKVKKLDKWVPHE 120 Query 451 LTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPK 510 L++N N RFEVSS IL N+NEPFLD+IVTCDEKWILYDN RR AQWLD+EEAPKHFPK Sbjct 121 LSKNFLNCRFEVSS-FILCNNNEPFLDQIVTCDEKWILYDNWRRPAQWLDREEAPKHFPK 179 Query 511 PILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGP 570 P LH KKVMVT+WWSAAGLIHYSFLNPGETITSEKYAQ+IDEM++KLQRLQLALVNRKGP Sbjct 180 PNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQRLQLALVNRKGP 239 Query 571 ILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQ 630 ILLHDNARPHVAQPTLQKLNELGYEVLPH PYSPDL PTNYH FKHL+NFLQGKRFHNQQ Sbjct 240 ILLHDNARPHVAQPTLQKLNELGYEVLPHLPYSPDLSPTNYHFFKHLDNFLQGKRFHNQQ 299 Query 631 DAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 DAENAFQEFVESQSTDFYATGIN+LISRWQKCVDCNGSYFD Sbjct 300 DAENAFQEFVESQSTDFYATGINKLISRWQKCVDCNGSYFD 340 >ref|NP_001077195.1| Gene info hypothetical protein LOC534913 [Bos taurus] gb|AAI34646.1| Gene info Unknown (protein for MGC:151518) [Bos taurus] Length=343 Score = 601 bits (1550), Expect = 4e-170, Method: Composition-based stats. Identities = 290/345 (84%), Positives = 314/345 (91%), Gaps = 6/345 (1%) Query 327 ETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDES 386 +TM+MML+KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTA ERTVQWWFKKF KGDES Sbjct 5 KTMEMMLEKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTAKERTVQWWFKKFRKGDES 64 Query 387 LEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKW 446 LED+ERS RPSEVDNDQLR II+ADPL TTR++AEEL VNHSTVVRHLKQI KVKKL+KW Sbjct 65 LEDDERSARPSEVDNDQLREIIDADPLKTTRKIAEELKVNHSTVVRHLKQIGKVKKLNKW 124 Query 447 VPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPK 506 VPHELTE QKNRRFEVSSSLILRN NEPFLDRIVTC EKWIL DN+R+ AQ LD+ + Sbjct 125 VPHELTEIQKNRRFEVSSSLILRNKNEPFLDRIVTCHEKWILSDNQRQPAQRLDRGKTLN 184 Query 507 HFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVN 566 L+ KK+MVT+WWSAAGLIHYSFLNPGETITSEKYAQ+I+EM+QKLQ LQ ALVN Sbjct 185 ------LYQKKIMVTVWWSAAGLIHYSFLNPGETITSEKYAQQINEMHQKLQHLQPALVN 238 Query 567 RKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRF 626 RKGP+LLHDNARPHVAQP LQK NELGYEVLPHPP+SPDLLPT+YH FKHL+NFLQGKRF Sbjct 239 RKGPVLLHDNARPHVAQPALQKFNELGYEVLPHPPHSPDLLPTHYHFFKHLDNFLQGKRF 298 Query 627 HNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 HNQQDAENAFQEFVES+ST FYATGIN+L SRWQKCVDCNGSYFD Sbjct 299 HNQQDAENAFQEFVESRSTGFYATGINELTSRWQKCVDCNGSYFD 343 >ref|XP_533755.2| UniGene infoGene info PREDICTED: similar to SET domain and mariner transposase fusion gene [Canis familiaris] Length=318 Score = 536 bits (1382), Expect = 1e-150, Method: Composition-based stats. Identities = 247/288 (85%), Positives = 262/288 (90%), Gaps = 0/288 (0%) Query 14 QLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFPGCICVKTPCLPGT 73 +LDVA G EN+PV AWPPG P PFQYTPDHV GPG D+DPTQITFPGCIC+KTPCLPGT Sbjct 31 RLDVARGLENVPVSAWPPGTEPEPFQYTPDHVAGPGTDVDPTQITFPGCICLKTPCLPGT 90 Query 74 CSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVVQKGLQFHFQVFKT 133 CSCLRHGENYDDNSCL DIGS GK A+PVFECNVLC+CSDHCRNRVVQ+GLQF QVFKT Sbjct 91 CSCLRHGENYDDNSCLIDIGSEGKCAKPVFECNVLCQCSDHCRNRVVQQGLQFQLQVFKT 150 Query 134 HKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVYNGQVM 193 KKGWGLRTLEFIPKGRFVCEYAGEVLG+SEVQRRI LQT D NYIIAIREHVYNGQV+ Sbjct 151 DKKGWGLRTLEFIPKGRFVCEYAGEVLGYSEVQRRIQLQTIQDPNYIIAIREHVYNGQVI 210 Query 194 ETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRY 253 ETFVDP+ IGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDI+PEEELSYDYSGR+ Sbjct 211 ETFVDPSCIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDILPEEELSYDYSGRF 270 Query 254 LNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNIS 301 LNL S KERLDHGK+RK CYCGAKSC AFLP+DSSLYCP+EK NIS Sbjct 271 LNLMDSEDKERLDHGKIRKCCYCGAKSCAAFLPYDSSLYCPLEKPNIS 318 >ref|NP_001068976.1| UniGene infoGene info hypothetical protein LOC511299 [Bos taurus] sp|Q0VD24|SETMR_BOVIN Gene info Histone-lysine N-methyltransferase SETMAR (SET domain and mariner transposase fusion gene-containing protein homolog) gb|AAI19875.1| UniGene infoGene info Similar to SET domain and mariner transposase fusion gene [Bos taurus] Length=306 Score = 527 bits (1358), Expect = 7e-148, Method: Composition-based stats. Identities = 247/301 (82%), Positives = 261/301 (86%), Gaps = 0/301 (0%) Query 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFP 60 MA +E PEA QLDVA G ENLPV AWPPGA P PFQYTPDHV GPGAD DP+QITFP Sbjct 1 MATCEEVPEALKGQLDVARGLENLPVSAWPPGAEPEPFQYTPDHVAGPGADADPSQITFP 60 Query 61 GCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVV 120 GC C+KTPCLPGTCSCLRH NYDD SCLRDIGS K EPVFECNVLC+CS+ CRNRVV Sbjct 61 GCACLKTPCLPGTCSCLRHENNYDDRSCLRDIGSEAKCTEPVFECNVLCQCSERCRNRVV 120 Query 121 QKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYI 180 Q GLQFH QVFKT KGWGLRTL+FIPKGRFVCEYAGEVLG SEVQRR+ LQT DSNYI Sbjct 121 QWGLQFHLQVFKTDHKGWGLRTLDFIPKGRFVCEYAGEVLGISEVQRRVQLQTIHDSNYI 180 Query 181 IAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIV 240 IAIREHVYNGQVMETFVDP IGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAA+DI+ Sbjct 181 IAIREHVYNGQVMETFVDPASIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAARDIL 240 Query 241 PEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNI 300 PEEELSYDYSGR+LNL S KERLD+GKLRKPCYCGA+SC AFLP+DSSLYCP EK + Sbjct 241 PEEELSYDYSGRFLNLMHSEDKERLDNGKLRKPCYCGARSCAAFLPYDSSLYCPTEKPDT 300 Query 301 S 301 S Sbjct 301 S 301 >ref|XP_001071895.1| UniGene infoGene info PREDICTED: similar to SET domain and mariner transposase fusion gene [Rattus norvegicus] ref|XP_001078264.1| Gene info PREDICTED: similar to SET domain and mariner transposase fusion gene [Rattus norvegicus] Length=315 Score = 511 bits (1317), Expect = 5e-143, Method: Composition-based stats. Identities = 237/303 (78%), Positives = 258/303 (85%), Gaps = 2/303 (0%) Query 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAP--APFQYTPDHVVGPGADIDPTQIT 58 +A +E+ EA EQ DVACG ENLPV WP GA P PFQYTPDHV GPGAD+DPTQIT Sbjct 13 IAPSEEESEATIEQQDVACGLENLPVSLWPLGAGPRPKPFQYTPDHVAGPGADMDPTQIT 72 Query 59 FPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNR 118 FPGC C+KTPC+PGTCSCLRH NY+DN CLRD+GS KYA+PVFECNVLC+C +HCRNR Sbjct 73 FPGCACIKTPCVPGTCSCLRHESNYNDNLCLRDVGSEAKYAKPVFECNVLCQCGEHCRNR 132 Query 119 VVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSN 178 VVQ GLQF QVF+T KKGWGLRTLE+IPKGRFVCEYAGEVLGFSEVQRRIHLQT D N Sbjct 133 VVQSGLQFLLQVFQTEKKGWGLRTLEYIPKGRFVCEYAGEVLGFSEVQRRIHLQTAHDPN 192 Query 179 YIIAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKD 238 YIIA+REH YNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKD Sbjct 193 YIIALREHTYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKD 252 Query 239 IVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKS 298 I+P EELSYDYSGR+LN S KER+D G+ RKPCYCGA+SC FLP+DSSLY P+E Sbjct 253 ILPGEELSYDYSGRFLNQISSKDKERIDCGQPRKPCYCGAQSCATFLPYDSSLYGPLENP 312 Query 299 NIS 301 S Sbjct 313 GTS 315 >sp|Q5I0M0|SETMR_RAT Gene info Histone-lysine N-methyltransferase SETMAR (SET domain and mariner transposase fusion gene-containing protein homolog) gb|AAH88181.1| UniGene infoGene info SET domain and mariner transposase fusion gene [Rattus norvegicus] Length=315 Score = 510 bits (1313), Expect = 1e-142, Method: Composition-based stats. Identities = 236/303 (77%), Positives = 257/303 (84%), Gaps = 2/303 (0%) Query 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAP--APFQYTPDHVVGPGADIDPTQIT 58 +A +E+ EA EQ DVACG ENLPV WP GA P PFQYTPDHV GPG D+DPTQIT Sbjct 13 IAPSEEESEATIEQQDVACGLENLPVSLWPLGAGPRPKPFQYTPDHVAGPGVDMDPTQIT 72 Query 59 FPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNR 118 FPGC C+KTPC+PGTCSCLRH NY+DN CLRD+GS KYA+PVFECNVLC+C +HCRNR Sbjct 73 FPGCACIKTPCVPGTCSCLRHESNYNDNLCLRDVGSEAKYAKPVFECNVLCQCGEHCRNR 132 Query 119 VVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSN 178 VVQ GLQF QVF+T KKGWGLRTLE+IPKGRFVCEYAGEVLGFSEVQRRIHLQT D N Sbjct 133 VVQSGLQFLLQVFQTEKKGWGLRTLEYIPKGRFVCEYAGEVLGFSEVQRRIHLQTAHDPN 192 Query 179 YIIAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKD 238 YIIA+REH YNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKD Sbjct 193 YIIALREHTYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKD 252 Query 239 IVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKS 298 I+P EELSYDYSGR+LN S KER+D G+ RKPCYCGA+SC FLP+DSSLY P+E Sbjct 253 ILPGEELSYDYSGRFLNQISSKDKERIDCGQPRKPCYCGAQSCATFLPYDSSLYGPLENP 312 Query 299 NIS 301 S Sbjct 313 GTS 315 >ref|XP_987717.1| UniGene infoGene info PREDICTED: SET domain and mariner transposase fusion gene [Mus musculus] ref|XP_993009.1| Gene info PREDICTED: similar to SET domain and mariner transposase fusion gene [Mus musculus] Length=309 Score = 506 bits (1303), Expect = 2e-141, Method: Composition-based stats. Identities = 234/294 (79%), Positives = 254/294 (86%), Gaps = 2/294 (0%) Query 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAP--APFQYTPDHVVGPGADIDPTQIT 58 +A +E+ APTEQ DVACG ENLPV WP GA P PFQYTPDHV GPGADIDPTQIT Sbjct 13 IAASEEESVAPTEQQDVACGLENLPVSLWPLGAEPRPKPFQYTPDHVAGPGADIDPTQIT 72 Query 59 FPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNR 118 FPGC C++TPC+PGTCSCLRH NYDDN CLRD+GS GKYA+PVFECNVLC+C CRNR Sbjct 73 FPGCACIETPCVPGTCSCLRHENNYDDNLCLRDVGSEGKYAKPVFECNVLCQCGMRCRNR 132 Query 119 VVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSN 178 VVQ GL F QVF+T KKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQT DSN Sbjct 133 VVQNGLHFLLQVFQTEKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTSHDSN 192 Query 179 YIIAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKD 238 YIIA+REH+Y+GQ+METFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKD Sbjct 193 YIIAVREHIYSGQIMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKD 252 Query 239 IVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLY 292 I+P EELSYDYSGR+LN S KE++D RKPCYCGA+SCT FLP+DSSLY Sbjct 253 ILPGEELSYDYSGRFLNQVSSKDKEKIDCSPPRKPCYCGAQSCTTFLPYDSSLY 306 >ref|XP_001001353.1| Gene info PREDICTED: similar to SET domain and mariner transposase fusion gene [Mus musculus] Length=309 Score = 504 bits (1298), Expect = 7e-141, Method: Composition-based stats. Identities = 233/294 (79%), Positives = 253/294 (86%), Gaps = 2/294 (0%) Query 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAP--APFQYTPDHVVGPGADIDPTQIT 58 +A +E+ APTEQ DVACG ENLPV WP GA P PFQYTPDHV GPGADIDPTQIT Sbjct 13 IAASEEESVAPTEQQDVACGLENLPVSLWPLGAEPRPKPFQYTPDHVAGPGADIDPTQIT 72 Query 59 FPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNR 118 FPGC C++TPC+PGTCSCLRH NYDDN CLRD+GS GKYA+PVFECNVLC+C CRNR Sbjct 73 FPGCACIETPCVPGTCSCLRHENNYDDNLCLRDVGSEGKYAKPVFECNVLCQCGMRCRNR 132 Query 119 VVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSN 178 VVQ GL F QVF+T KKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQT DSN Sbjct 133 VVQNGLHFLLQVFQTEKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTSHDSN 192 Query 179 YIIAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKD 238 YIIA+REH+Y+GQ+METFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKD Sbjct 193 YIIAVREHIYSGQIMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKD 252 Query 239 IVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLY 292 I+P EELSYDYSGR+LN KE++D RKPCYCGA+SCT FLP+DSSLY Sbjct 253 ILPGEELSYDYSGRFLNQVSRKDKEKIDCSPPRKPCYCGAQSCTTFLPYDSSLY 306 >sp|Q80UJ9|SETMR_MOUSE Gene info Histone-lysine N-methyltransferase SETMAR (SET domain and mariner transposase fusion gene-containing protein homolog) gb|AAH45208.1| UniGene infoGene info SET domain and mariner transposase fusion gene [Mus musculus] Length=309 Score = 503 bits (1294), Expect = 2e-140, Method: Composition-based stats. Identities = 232/294 (78%), Positives = 252/294 (85%), Gaps = 2/294 (0%) Query 1 MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAP--APFQYTPDHVVGPGADIDPTQIT 58 +A +E+ APTEQ DVACG ENLPV WP GA P PFQYTPDHV GPGADIDPTQIT Sbjct 13 IAASEEESVAPTEQQDVACGLENLPVSLWPLGAEPRPKPFQYTPDHVAGPGADIDPTQIT 72 Query 59 FPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNR 118 FPGC C++TPC+PGTCSCLRH NYDDN C RD+GS GKYA+PVFECNVLC+C CRNR Sbjct 73 FPGCACIETPCVPGTCSCLRHENNYDDNLCFRDVGSEGKYAKPVFECNVLCQCGMRCRNR 132 Query 119 VVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSN 178 VVQ GL F QVF+T KKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQT DSN Sbjct 133 VVQNGLHFLLQVFQTEKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTSHDSN 192 Query 179 YIIAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKD 238 YIIA+REH+Y+GQ+METFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKD Sbjct 193 YIIAVREHIYSGQIMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKD 252 Query 239 IVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSSLY 292 I+P EELSYDYSGR+LN KE++D RKPCYCGA+SCT FLP+DSSLY Sbjct 253 ILPGEELSYDYSGRFLNQVSRKDKEKIDCSPPRKPCYCGAQSCTTFLPYDSSLY 306 >emb|CAA56856.1| planarian mariner-9 gene [Girardia tigrina] Length=339 Score = 365 bits (936), Expect = 6e-99, Method: Composition-based stats. Identities = 173/340 (50%), Positives = 231/340 (67%), Gaps = 2/340 (0%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 ++ +IR + +EF G + NIN+ + + TV WFK++ GD L ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRYRSGDFDLSNQPR 60 Query 393 SGRPS-EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHEL 451 GRP +VDND L+A +EAD + E+A + V ST++ HLKQI KVKKLDKWVPHEL Sbjct 61 -GRPEIKVDNDALKADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLDKWVPHEL 119 Query 452 TENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKP 511 + K +R + SL+ RN +PFL RIVTCDEKWI+YDNR+RS+QWLD +E PKH PK Sbjct 120 KDEHKQQRLDACLSLLSRNKADPFLHRIVTCDEKWIMYDNRKRSSQWLDPDEPPKHCPKR 179 Query 512 ILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPI 571 +H KK+MVT+WWS+ G+IHY F+ PG +ITS+ Y ++D+M +KL Q + NR PI Sbjct 180 KVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQPKMFNRLTPI 239 Query 572 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQD 631 LLHDNARPH A+ T+ KL +LG E L HPPYSPDL PT+YH F+ L+NFL GK F + Sbjct 240 LLHDNARPHSAKNTVAKLQQLGLETLRHPPYSPDLAPTDYHFFQSLDNFLSGKNFTSSGA 299 Query 632 AENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 + AFQEF++S+ + FY G+N L +WQ+CVD G YFD Sbjct 300 VKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 339 >emb|CAA50801.1| mariner-1 protein [Girardia tigrina] Length=339 Score = 363 bits (933), Expect = 2e-98, Method: Composition-based stats. Identities = 170/339 (50%), Positives = 228/339 (67%), Gaps = 0/339 (0%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 ++ +IR + +EF G + NIN+ + + TV WFK+F GD + ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDMSNQPR 60 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 S +VDND L+A +EAD + E+A + V S ++ HLKQI KVKKLDKWVPHEL Sbjct 61 SRPEIKVDNDALKADVEADSSQSALELASKFGVAKSIILIHLKQINKVKKLDKWVPHELK 120 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 + K +R + SL+ RN +PFL RIVTCDEKWI+YDNR+RS+QWLD +E PKH PK Sbjct 121 DEHKQQRLDACLSLLSRNKADPFLHRIVTCDEKWIMYDNRKRSSQWLDPDEPPKHCPKRK 180 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 +H KK+MVT+WWS+ G+IHY F+ PG +ITS+ Y ++D+M +KL Q + NR PIL Sbjct 181 VHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQPKMFNRLTPIL 240 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPH A+ T+ KL +LG E L HPPYSPDL PT+YH F+ L+NFL GK F + Sbjct 241 LHDNARPHSAKNTVAKLQQLGLETLRHPPYSPDLAPTDYHFFQSLDNFLSGKNFTSSGAV 300 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 + AFQEF++S+ + FY G+N L +WQ+CVD G YFD Sbjct 301 KTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 339 >emb|CAA56857.1| planarian mariner-8 gene [Girardia tigrina] Length=339 Score = 363 bits (931), Expect = 3e-98, Method: Composition-based stats. Identities = 172/340 (50%), Positives = 230/340 (67%), Gaps = 2/340 (0%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 ++ +IR + +EF G + NIN+ + + TV WFK+F GD L ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDLSNQPR 60 Query 393 SGRPS-EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHEL 451 GRP +VDND L+A +EAD + E+A + V ST++ HLKQI KVKKLDKWVPHEL Sbjct 61 -GRPEIKVDNDALKADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLDKWVPHEL 119 Query 452 TENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKP 511 + K +R + SL+ RN +PFL RIVTCDEKWI+YDNR+RS+QWLD +E PKH PK Sbjct 120 KDEHKQQRLDACLSLLSRNKADPFLHRIVTCDEKWIMYDNRKRSSQWLDPDEPPKHCPKR 179 Query 512 ILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPI 571 +H KK+MVT+WWS+ G+IHY F+ PG +ITS+ Y ++D+M +KL Q + NR PI Sbjct 180 KVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQAKMFNRLTPI 239 Query 572 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQD 631 LL+DNARPH A+ T+ K +LG E L HPPYSPDL PT+YH F+ L+NFL GK F + Sbjct 240 LLYDNARPHSAKNTVAKRQQLGLETLRHPPYSPDLAPTDYHFFQSLDNFLSGKNFTSSGA 299 Query 632 AENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 + AFQEF++S+ + FY G+N L +WQ+CVD G YFD Sbjct 300 VKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 339 >emb|CAA56858.1| planarian mariner-5 gene [Girardia tigrina] Length=339 Score = 362 bits (928), Expect = 5e-98, Method: Composition-based stats. Identities = 172/340 (50%), Positives = 229/340 (67%), Gaps = 2/340 (0%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 ++ +IR + +EF G + NIN+ + + TV WFK+F GD L ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDLSNQPR 60 Query 393 SGRPS-EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHEL 451 GRP +VDND L+A +EAD + E+A + V ST++ HLKQI KVKKLDKWVPHEL Sbjct 61 -GRPEIKVDNDALKADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLDKWVPHEL 119 Query 452 TENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKP 511 + K +R + SL+ RN +PFL RIVTC EKWI+YDNR+RS+QWLD +E PKH PK Sbjct 120 KDEHKQQRLDACLSLLSRNKADPFLHRIVTCGEKWIMYDNRKRSSQWLDPDEPPKHCPKR 179 Query 512 ILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPI 571 +H KK+MVT+WWS+ G+IHY F+ PG +ITS+ Y ++D+M +KL Q + NR PI Sbjct 180 KVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQPKMFNRLTPI 239 Query 572 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQD 631 LLHDNARPH A+ T+ KL +LG E L HPPYSPDL PT+YH F+ L+NF GK F + Sbjct 240 LLHDNARPHSAKNTVAKLQQLGLETLRHPPYSPDLAPTDYHFFQSLDNFFSGKYFTSSGA 299 Query 632 AENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 + AFQEF++S+ + FY G+N L +WQ+CVD G YFD Sbjct 300 VKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 339 >prf||1917335A mariner 1 element Length=338 Score = 360 bits (924), Expect = 2e-97, Method: Composition-based stats. Identities = 170/339 (50%), Positives = 228/339 (67%), Gaps = 1/339 (0%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 ++ +IR + +EF G + NIN+ + + TV WFK+F GD + ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDMSNQPR 60 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 S +VDND L+A +EAD + E+A + V S ++ HLKQI KVKKLDKWVPHEL Sbjct 61 SRPEIKVDNDALKADVEADSSQSALELASKFGVAKSIILIHLKQINKVKKLDKWVPHELK 120 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 + K +R + SL+ RN +PFL RIVTCDEKWI+YDNR+RS+QWLD +E PKH PK Sbjct 121 DEHKQQRLDACLSLLSRNKADPFLHRIVTCDEKWIMYDNRKRSSQWLD-DEPPKHCPKRK 179 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 +H KK+MVT+WWS+ G+IHY F+ PG +ITS+ Y ++D+M +KL Q + NR PIL Sbjct 180 VHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQPKMFNRLTPIL 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPH A+ T+ KL +LG E L HPPYSPDL PT+YH F+ L+NFL GK F + Sbjct 240 LHDNARPHSAKNTVAKLQQLGLETLRHPPYSPDLAPTDYHFFQSLDNFLSGKNFTSSGAV 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 + AFQEF++S+ + FY G+N L +WQ+CVD G YFD Sbjct 300 KTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 338 >emb|CAA56859.1| planarian mariner-3 gene [Girardia tigrina] Length=339 Score = 359 bits (922), Expect = 3e-97, Method: Composition-based stats. Identities = 172/340 (50%), Positives = 229/340 (67%), Gaps = 2/340 (0%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 ++ +IR + +EF G + NIN+ + + TV WFK+F GD L ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDLSNQPR 60 Query 393 SGRPS-EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHEL 451 GRP +VDND L+A +EAD + E+A + V ST++ HLKQI KVKKLDKWVPHEL Sbjct 61 -GRPEIKVDNDALKADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLDKWVPHEL 119 Query 452 TENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKP 511 + K +R + SL+ RN +PFL RIVTCDEKWI+YDNR+RS+QWLD +E PKH PK Sbjct 120 KDEHKQQRLDACLSLLSRNKADPFLHRIVTCDEKWIMYDNRKRSSQWLDPDEPPKHCPKR 179 Query 512 ILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPI 571 +H KK+MVT+WWS+ G+IHY F+ PG +ITS+ Y ++D+M +KL Q + NR PI Sbjct 180 KVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQPKMFNRLTPI 239 Query 572 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQD 631 LLHDNARPH A+ T+ KL +LG E L HP YSPDL PT+ H F+ L+NFL GK F + Sbjct 240 LLHDNARPHSAKNTVAKLQQLGLETLRHPTYSPDLAPTDCHFFQSLDNFLSGKNFTSSGA 299 Query 632 AENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 + AFQEF++S+ + FY G+N L +WQ+CVD G YFD Sbjct 300 VKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMGGYFD 339 >emb|CAA56763.1| manirer-2 [Girardia tigrina] Length=365 Score = 350 bits (898), Expect = 2e-94, Method: Composition-based stats. Identities = 168/336 (50%), Positives = 226/336 (67%), Gaps = 2/336 (0%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 ++ +IR + +EF G + NIN+ + + TV WFK+F GD L ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDLSNQPR 60 Query 393 SGRPS-EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHEL 451 GRP +VDND L+A +EAD + E+A + V ST++ HLKQI KVKKLDKWVPHEL Sbjct 61 -GRPEIKVDNDALKADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLDKWVPHEL 119 Query 452 TENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKP 511 + K +R + SL+ RN +PFL RI+TCDEKWI+YDNR+RS+QWLD +E PKH PK Sbjct 120 KDEHKQQRLDACLSLLSRNKADPFLHRIMTCDEKWIMYDNRKRSSQWLDPDEPPKHCPKR 179 Query 512 ILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPI 571 +H KK+MVT+WWS+ G+IHY F+ PG +ITS+ Y ++D+M +KL Q + NR PI Sbjct 180 KVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQPKMFNRLTPI 239 Query 572 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQD 631 LLHDNARPH A+ T+ KL +LG E L HP YSPDL PT+ H F+ L+NFL GK F + Sbjct 240 LLHDNARPHSAKNTVAKLQQLGLETLRHPTYSPDLAPTDCHFFQSLDNFLSGKNFTSSGA 299 Query 632 AENAFQEFVESQSTDFYATGINQLISRWQKCVDCNG 667 + AFQEF++S+ + FY G+N L +WQ+CVD G Sbjct 300 VKTAFQEFIDSRESVFYTKGLNVLPLKWQQCVDNMG 335 >dbj|BAA21826.1| transposase [Attacus atlas] dbj|BAB32436.1| transposase [Fungia sp. Kusabiraishi] Length=316 Score = 333 bits (854), Expect = 2e-89, Method: Composition-based stats. Identities = 158/317 (49%), Positives = 224/317 (70%), Gaps = 2/317 (0%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 ++ + R I+ +EF G AAET R IN+ +G G E TV++WF++F G+ L ++ R Sbjct 1 MENLKYRVIYEYEFHRGTSAAETARRINDVYGGGVTKENTVRFWFQRFRSGNFDLRNKPR 60 Query 393 SGRP-SEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHEL 451 GRP ++VDN++L+AI+EADP TT E+A V+ V+ HLKQ KVKKL++WVPHEL Sbjct 61 -GRPDTKVDNEELKAIVEADPSQTTPELAAGCGVSDKIVLIHLKQTGKVKKLERWVPHEL 119 Query 452 TENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKP 511 +E + R + +L+ R++NE L+RI+TCDEKWILYDNR+RS+QWL+ E K PK Sbjct 120 SETNRQTRVDCCVTLLNRHNNEGILNRIITCDEKWILYDNRKRSSQWLNPGEPAKSCPKR 179 Query 512 ILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPI 571 L KK++V++WW++AG++HYSFL G TIT++ Y Q++ M +KL Q L+NR P+ Sbjct 180 KLTQKKLLVSVWWTSAGVVHYSFLKSGLTITADVYCQQLQVMMEKLAAKQPRLINRSRPL 239 Query 572 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQD 631 LLHDNARPH AQ T KL EL E L HPPYSPDL PT+YH F++L+NFLQGK+F++ Sbjct 240 LLHDNARPHTAQQTATKLGELQLECLRHPPYSPDLAPTDYHFFRNLDNFLQGKKFNSDGA 299 Query 632 AENAFQEFVESQSTDFY 648 + AF++F++S+ F+ Sbjct 300 VQTAFKDFIDSRPNSFF 316 >dbj|BAA23532.1| transposase [Bombyx mori] Length=338 Score = 328 bits (840), Expect = 8e-88, Method: Composition-based stats. Identities = 162/341 (47%), Positives = 236/341 (69%), Gaps = 5/341 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 ++ + R I+ ++F G AAETT+ IN+ +G G A E TV++WF++F G+ L+++ R Sbjct 1 MENMKYRYIYEYQFYRGTSAAETTQRINDVYGAGVAKESTVRFWFQRFRSGNFDLQNQPR 60 Query 393 SGRP-SEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHEL 451 GRP ++V N++L+AI+EAD +T E+ V+ TV+ HLKQI KVKKL++WVPHEL Sbjct 61 -GRPETKVKNEELKAIVEADQSQSTSEIVAGFGVSDKTVLIHLKQIGKVKKLERWVPHEL 119 Query 452 TENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKP 511 +E+ R + +L+ R++NE L+RI TCDEK +LYDNR+R +QWL+ + K +PK Sbjct 120 SESNLQTRIDCCVTLLNRHYNEGILNRINTCDEKGVLYDNRKRLSQWLNPGDPAKSYPKR 179 Query 512 ILHPKKVMVTIWW-SAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGP 570 L KK++V++WW S A ++HYSFL G+TIT++ Y Q++ M ++L Q LVNR P Sbjct 180 KLTQKKLLVSVWWTSIASVVHYSFLKSGQTITADIYCQQLQTMKEELAAKQPRLVNRSRP 239 Query 571 ILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQ 630 +LLHDNARPH AQ T KL+EL L HPPYS DL P +YH F +L+NFLQ K+ ++ Sbjct 240 LLLHDNARPHTAQQTTTKLDELQLACLRHPPYS-DLAPIDYHFFLNLDNFLQ-KKINSDA 297 Query 631 DAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 671 + AF+EF++S+ F++ GIN+L R QKC+D NG+YFD Sbjct 298 AVQTAFKEFIDSRYHGFFSKGINELPKRLQKCIDNNGAYFD 338 >gb|AAP51087.1| transposase [Forficula auricularia] Length=342 Score = 318 bits (814), Expect = 9e-85, Method: Composition-based stats. Identities = 148/335 (44%), Positives = 215/335 (64%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFLKGKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+AE+L+V+H+ + HLKQ+ V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F +++ FY GI L+ RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLLERWQKVIDQNGQY 339 >gb|AAP51085.1| transposase [Forficula auricularia] Length=342 Score = 318 bits (814), Expect = 9e-85, Method: Composition-based stats. Identities = 148/335 (44%), Positives = 215/335 (64%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ G+ A++ + + +G ER Q WF KFC GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCALYGNEALKERQCQNWFAKFCSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+AE+L+V+H+ + HLKQ+ V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPTQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T +KL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D + Sbjct 245 DNARPHTSLVTRKKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKL 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLVQFFANKNQKFYERGIMMLPERWQKVIDQNGQY 339 >gb|AAP51098.1| transposase [Forficula auricularia] gb|AAP51099.1| transposase [Forficula auricularia] gb|AAP51100.1| transposase [Forficula auricularia] Length=342 Score = 317 bits (812), Expect = 2e-84, Method: Composition-based stats. Identities = 148/335 (44%), Positives = 216/335 (64%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ G+ A+++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQSHKRLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+AE+L+V+H+ + HLKQ+ V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWGRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQY 339 >gb|AAP51090.1| transposase [Forficula auricularia] gb|AAP51094.1| transposase [Forficula auricularia] Length=342 Score = 316 bits (809), Expect = 4e-84, Method: Composition-based stats. Identities = 149/335 (44%), Positives = 214/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCAVYGDEAFKERQCQNWFAKFRFGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+AE+L+V+H+ + HLKQ+ V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 RR + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTRRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D + Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKL 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQY 339 >gb|AAP51096.1| transposase [Forficula auricularia] Length=345 Score = 315 bits (808), Expect = 5e-84, Method: Composition-based stats. Identities = 149/335 (44%), Positives = 213/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ G+ A + + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNALQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+AE+L+V+H+ + HLKQ+ V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F ++S FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKSQKFYERGIMMLPERWQKVIDQNGKY 339 >gb|AAP51086.1| transposase [Forficula auricularia] Length=341 Score = 315 bits (807), Expect = 6e-84, Method: Composition-based stats. Identities = 149/335 (44%), Positives = 213/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ G+ A + + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNALQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+AE+L+V+H+ + HLKQ+ V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F ++S FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKSQKFYERGIMMLPERWQKVIDQNGKY 339 >gb|AAP51093.1| transposase [Forficula auricularia] Length=342 Score = 315 bits (807), Expect = 6e-84, Method: Composition-based stats. Identities = 148/335 (44%), Positives = 214/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCAVYGDEAFKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+AE+L+V+H+ + HLKQ+ V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D + Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKL 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDHNGQY 339 >gb|AAP51092.1| transposase [Forficula auricularia] Length=342 Score = 315 bits (806), Expect = 8e-84, Method: Composition-based stats. Identities = 146/335 (43%), Positives = 214/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+AE+L+V+H+ + H+K + V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHIKHLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRFLQNSLNGKNFNNDDDVKS 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLSERWQKVIDQNGQY 339 >gb|AAO12863.1| Famar1 transposase [Forficula auricularia] Length=342 Score = 315 bits (806), Expect = 9e-84, Method: Composition-based stats. Identities = 148/335 (44%), Positives = 214/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCAVYGDEAFKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+AE+L+V+H+ + HLKQ+ V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQY 339 >gb|AAP51091.1| transposase [Forficula auricularia] Length=342 Score = 314 bits (804), Expect = 1e-83, Method: Composition-based stats. Identities = 147/335 (43%), Positives = 214/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ G+ A++ + + +G ER Q WF KF G SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCAIYGDEAFKERQCQNWFAKFRSGGFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+AE+L+V+H+ + HLKQ+ V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDHNGQY 339 >gb|AAP51083.1| transposase [Forficula auricularia] Length=342 Score = 313 bits (802), Expect = 2e-83, Method: Composition-based stats. Identities = 147/335 (43%), Positives = 213/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ G A + + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGTNALQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EV++D ++AII++D +TTRE+AE+L+V+H+ + HLKQ+ V+KLD WVPHEL E Sbjct 65 RPVEVNDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVDYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQY 339 >gb|AAP51095.1| transposase [Forficula auricularia] Length=341 Score = 313 bits (801), Expect = 3e-83, Method: Composition-based stats. Identities = 148/335 (44%), Positives = 212/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ G+ A + + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNALQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+A +L+V+H+ + HLKQ+ V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAHKLHVSHTCIENHLKQLGFVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F ++S FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKSQKFYERGIMMLPERWQKVIDQNGKY 339 >gb|AAP51097.1| transposase [Forficula auricularia] Length=342 Score = 313 bits (801), Expect = 3e-83, Method: Composition-based stats. Identities = 147/335 (43%), Positives = 213/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII +D +TTRE+AE+L+V+H+ + HLK + V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIINSDCHSTTREIAEKLHVSHTCIENHLKHLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N +++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNEVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D + Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKL 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQY 339 >gb|AAP51089.1| transposase [Forficula auricularia] Length=342 Score = 311 bits (797), Expect = 9e-83, Method: Composition-based stats. Identities = 147/335 (43%), Positives = 213/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKNASQAHKKLCAVYGNEAFKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+AE+ +V+H+ + HLKQ+ V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKPHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYKRGIMMLPERWQKVIDQNGQY 339 >gb|AAB17945.1| mariner transposase [Ceratitis capitata] Length=338 Score = 310 bits (795), Expect = 2e-82, Method: Composition-based stats. Identities = 145/327 (44%), Positives = 204/327 (62%), Gaps = 0/327 (0%) Query 343 LFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDND 402 L+EF+ G+ T++I + RTV+ WF KF GD +LED RSGRP E+DND Sbjct 9 LYEFRKGKTVGAATKDIREVYSDRAPALRTVKKWFAKFRSGDFNLEDRPRSGRPCELDND 68 Query 403 QLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEV 462 LR + + +T+EVA ELNVN T R LK++ KLDKWVPH+L+E K R Sbjct 69 VLRISVANNSRISTKEVASELNVNKPTAFRRLKKVGYTLKLDKWVPHQLSEKNKVDRMST 128 Query 463 SSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTI 522 + SL+ R NEPFLDR++T DEKWILY+N +R W E + K LHP V++ I Sbjct 129 AISLLRRVKNEPFLDRLLTGDEKWILYNNVQRKRTWKQAHEGAEPMSKGGLHPMMVLLCI 188 Query 523 WWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVA 582 WW G+I++ L GETIT+ KY Q++ E+ + + + NRKG + +DNARPHVA Sbjct 189 WWDIRGVIYFELLPAGETITANKYCQQLVELKKAIDEKRPIFANRKGVLFHYDNARPHVA 248 Query 583 QPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVES 642 +PTL KL E+ +E++PH PYSPD+ P++YH+F+ L N L GK+F N +D ++ F Sbjct 249 KPTLAKLKEMNWEIMPHSPYSPDIAPSDYHLFRSLQNNLNGKKFKNVEDVKSHLDNFFNE 308 Query 643 QSTDFYATGINQLISRWQKCVDCNGSY 669 + DFY +GI +L+ RW+ + +G Y Sbjct 309 KPRDFYESGIRKLVERWEWIAEHDGEY 335 >ref|NP_001073580.1| UniGene infoGene info Ammar1 transposase [Apis mellifera] gb|AAO12861.1| Gene info Ammar1 transposase [Apis mellifera] Length=342 Score = 310 bits (795), Expect = 2e-82, Method: Composition-based stats. Identities = 147/335 (43%), Positives = 214/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHYRHILLFYFRKGKNASQAHKKLCAVYGDEALKERQCQNWFDKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+AE+L+V+H+ + HLKQ+ V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKEK 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPREPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 RKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRPELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDIKS 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F +++ FY GI L RWQK +D NG + Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDQNGQH 339 >gb|AAZ67097.1| transposase [Adineta vaga] Length=345 Score = 310 bits (794), Expect = 2e-82, Method: Composition-based stats. Identities = 150/340 (44%), Positives = 210/340 (61%), Gaps = 6/340 (1%) Query 330 KMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 389 KM L +++R + L EF++GRKA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGRKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 390 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPH 449 RSGRP EVD D L+ +IE DP T R +AE+L +H+TV +HL ++ K K W+PH Sbjct 68 LPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 450 ELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFP 509 EL+ +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 510 KPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKG 569 K LHPKK+M+++WW G+IH+ L G TIT++ Y Q++D + +KL+ Q + Sbjct 188 KADLHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 570 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 629 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL PT+YH+F+ L+N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTSEKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 630 QDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >gb|AAO12864.1| Ccmar2 transposase [Ceratitis capitata] Length=342 Score = 309 bits (792), Expect = 3e-82, Method: Composition-based stats. Identities = 146/335 (43%), Positives = 213/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKGKTASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+ ++AII++D +TTRE+AE+L+V+H+ + HLKQ+ V+KLD WVPHEL E Sbjct 65 RPVEVDDALIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPTQTTSKADIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S+ Y +++ ++N ++ + L NRK + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSDVYIEQLTKLNNAVEEKRPELTNRKSIVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D ++ Sbjct 245 DNARPHTSLATRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKS 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F +++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKIIDQNGQY 339 >gb|AAP51082.1| transposase [Forficula auricularia] Length=342 Score = 309 bits (791), Expect = 4e-82, Method: Composition-based stats. Identities = 145/335 (43%), Positives = 212/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFLKGKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+AE+L+V+H+ + H+K + V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHIKHLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLAQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSAVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL EL ++VLPHPPYSPDL P++Y +F+ L N L GK F+N D + Sbjct 245 DNARPHTSLVTRQKLLELDWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKL 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F ++++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFDNKNQKFYERGIMMLPERWQKVIDQNGQY 339 >gb|AAP51084.1| transposase [Forficula auricularia] Length=342 Score = 309 bits (791), Expect = 5e-82, Method: Composition-based stats. Identities = 145/335 (43%), Positives = 212/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F G+ A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFLKGKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+AE+L+V+H+ + H+K + V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHIKHLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R + L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINICDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL EL ++VLPHPPYSPDL P++Y +F+ L N L GK F+N D + Sbjct 245 DNARPHTSLVTRQKLLELDWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKL 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F ++++ FY GI L RWQK +D NG Y Sbjct 305 YLIQFFDNKNQKFYERGIMMLPERWQKVIDQNGQY 339 >gb|AAP51088.1| transposase [Forficula auricularia] Length=342 Score = 308 bits (789), Expect = 8e-82, Method: Composition-based stats. Identities = 146/335 (43%), Positives = 212/335 (63%), Gaps = 0/335 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I LF F+ + A++ + + +G ER Q WF KF GD SL+DE+RSG Sbjct 5 KEHFRHILLFYFRKEKNASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP EVD+D ++AII++D +TTRE+AE+L+V+H+ + HLKQ+ V+KLD WVPHEL E Sbjct 65 RPVEVDDDLIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPHELKET 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 +R L RN N+PFL R++T DEKW++Y+N +R W E + K +H Sbjct 125 HLTQRINSCDLLKKRNENDPFLKRLITGDEKWVVYNNIKRKRSWSRPGEPAQTTSKAGIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKV++++WW G++++ L P TI S Y +++ ++N ++ + L NRKG + H Sbjct 185 QKKVLLSVWWDYKGIVYFELLPPNRTINSVVYIEQLTKLNNAVEEKRAELTNRKGVVFHH 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG++VLPHPPYSPDL P++Y +F+ L N L GK F+N D + Sbjct 245 DNARPHTSLVTRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKL 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 +F +++ FY GI L RWQK +D +G Y Sbjct 305 YLIQFFANKNQKFYERGIMMLPERWQKVIDQHGQY 339 >gb|AAZ67096.1| transposase [Adineta vaga] Length=345 Score = 308 bits (788), Expect = 9e-82, Method: Composition-based stats. Identities = 149/340 (43%), Positives = 209/340 (61%), Gaps = 6/340 (1%) Query 330 KMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 389 KM L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 390 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPH 449 RSGRP EVD D L+ +IE DP T R +AE+L +H+TV +HL ++ K K W+PH Sbjct 68 LPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 450 ELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFP 509 EL+ +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 510 KPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKG 569 K LHPKK+M+++WW G+IH+ L G TIT++ Y Q++D + +KL+ Q + Sbjct 188 KADLHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 570 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 629 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL PT+YH+F+ L+N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTSEKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 630 QDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >gb|AAZ67092.1| transposase [Adineta vaga] Length=345 Score = 307 bits (786), Expect = 2e-81, Method: Composition-based stats. Identities = 148/340 (43%), Positives = 209/340 (61%), Gaps = 6/340 (1%) Query 330 KMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 389 KM L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 390 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPH 449 RSGRP EVD D L+ +IE DP T R +AE+L +H+TV +HL ++ K K W+PH Sbjct 68 LPRSGRPMEVDVDLLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 450 ELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFP 509 EL+ +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 510 KPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKG 569 K LHPKK+M+++WW G+IH+ L G TIT++ Y Q++D + +KL+ Q + Sbjct 188 KADLHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 570 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 629 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL PT+YH+F+ L+N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 630 QDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D + +F + +S DFY GI L RWQ+ +D NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVLDSNGKY 341 >gb|AAO12862.1| Camar1 transposase [Chymomyza amoena] Length=342 Score = 306 bits (784), Expect = 3e-81, Method: Composition-based stats. Identities = 149/338 (44%), Positives = 207/338 (61%), Gaps = 1/338 (0%) Query 335 KKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSG 394 K+ R I + F+ G+ A + + + + +G ER Q WF+KF GD SL+DE RSG Sbjct 5 KEHFRHILYYYFRKGKNAEQVAKKLRDVYGDKALKERQCQNWFRKFRSGDFSLKDEPRSG 64 Query 395 RPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTEN 454 RP+EVD+DQ++A+IE D T RE+ E+LN+ STV H+K + VKKLD WVPHEL E Sbjct 65 RPNEVDDDQIKALIELDRHVTEREIGEKLNIPKSTVHYHIKSLGLVKKLDIWVPHELKEI 124 Query 455 QKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILH 514 R + RN +PFL RI+T DEKWI+Y+N R W E + K +H Sbjct 125 HLTNRINACDMHLKRNEFDPFLKRIITGDEKWIVYNNVNRKRSWSKHGEPAQTTSKADIH 184 Query 515 PKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLH 574 KKVM+++WW G++++ L +TI S+ Y Q++D++N + + L+NRKG I Sbjct 185 QKKVMLSVWWDWKGVVYFELLPRNQTINSDVYCQQLDKLNAAINEKRPELINRKGVIFHQ 244 Query 575 DNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAEN 634 DNARPH + T QKL ELG+EVL HPPYSPDL P++YH+F+ L N L GK F N + ++ Sbjct 245 DNARPHTSLMTRQKLRELGWEVLMHPPYSPDLAPSDYHLFRSLQNSLNGKTFGNDEAIKS 304 Query 635 AFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY-FD 671 +F + FY GI L RWQK ++ NG+Y FD Sbjct 305 HLVQFFADKGQKFYERGIQNLPGRWQKVIEQNGNYIFD 342 >gb|AAZ67091.1| transposase [Adineta vaga] Length=345 Score = 305 bits (781), Expect = 7e-81, Method: Composition-based stats. Identities = 148/340 (43%), Positives = 208/340 (61%), Gaps = 6/340 (1%) Query 330 KMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 389 KM L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 390 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPH 449 RSGRP EVD D L+ +IE DP T R +AE+L +H+TV +HL ++ K K W+PH Sbjct 68 LPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 450 ELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFP 509 EL+ +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 510 KPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKG 569 K LH KK+M+++WW G+IH+ L G TIT++ Y Q++D + +KL+ Q + Sbjct 188 KADLHSKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 570 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 629 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL PT+YH+F+ L+N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 630 QDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >gb|AAZ67101.1| transposase [Adineta vaga] Length=345 Score = 304 bits (779), Expect = 1e-80, Method: Composition-based stats. Identities = 149/340 (43%), Positives = 207/340 (60%), Gaps = 6/340 (1%) Query 330 KMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 389 KM L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSYREVRVLLLHEFRLGNKATEAANNICGMMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 390 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPH 449 RSGR EVD D L+ +IE DP T R +AE+L +H+TV +HL ++ K K W+PH Sbjct 68 LPRSGRSMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 450 ELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFP 509 EL+ +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 510 KPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKG 569 K LHPKK M++IWW G+IH+ L G TIT++ Y Q++D + +KL+ Q + Sbjct 188 KADLHPKKSMLSIWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 570 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 629 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL PT+YH+F+ L+N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRNKKFDDE 301 Query 630 QDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >gb|AAZ67095.1| transposase [Adineta vaga] Length=345 Score = 302 bits (774), Expect = 4e-80, Method: Composition-based stats. Identities = 147/340 (43%), Positives = 208/340 (61%), Gaps = 6/340 (1%) Query 330 KMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 389 K+ L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KINLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 390 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPH 449 RSGRP EVD D L+ +IE DP T R +AE+L +H+TV +HL ++ K K W+PH Sbjct 68 LPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 450 ELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFP 509 EL+ +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYPRRRQWLSAGQTGVATP 187 Query 510 KPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKG 569 K LHPKK+M+++WW G+IH+ L G TIT++ Y Q++D + +KL+ Q + Sbjct 188 KADLHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 570 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 629 LHDNARPHVA+ +KL +LG+ +PHPPYSPDL PT+YH+F+ L+N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSAREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 630 QDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMPLPERWQQVVDSNGKY 341 >gb|AAZ67093.1| transposase [Adineta vaga] Length=345 Score = 302 bits (773), Expect = 5e-80, Method: Composition-based stats. Identities = 147/340 (43%), Positives = 207/340 (60%), Gaps = 6/340 (1%) Query 330 KMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 389 KM L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 390 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPH 449 RSGRP EVD D L+ +IE DP T R +AE+L +H+TV +HL ++ K K W+PH Sbjct 68 LPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 450 ELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFP 509 EL+ +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 510 KPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKG 569 K LH KK+M+++WW G+IH+ L G TIT++ Y Q++D + +KL+ Q + Sbjct 188 KADLHSKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 570 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 629 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL PT+YH+F+ L+N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 630 QDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D + +F + +S DFY GI L RWQ+ VD N Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQEVVDSNSKY 341 >emb|CAD26968.1| transposase [Meloidogyne chitwoodi] Length=340 Score = 301 bits (772), Expect = 6e-80, Method: Composition-based stats. Identities = 143/339 (42%), Positives = 217/339 (64%), Gaps = 1/339 (0%) Query 332 MLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEE 391 M +KK+IR L EF++G AAE RNI A G +E T + WF KF GD S +D Sbjct 1 MDEKKRIRERLLHEFQLGHTAAEAARNIKKALGDNALDESTARRWFTKFRTGDFSTDDGF 60 Query 392 RSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHEL 451 RSGRPS + + LRA I +P T+TR++AEEL + TV R++K++E + + VPH+L Sbjct 61 RSGRPSTFETEPLRAAINENPATSTRKLAEELGSSKDTVWRNMKEMELSYRSGRTVPHDL 120 Query 452 TENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKP 511 E ++ +R E+ +L+ R PFLD+I+TCDE WILYDNR QWL + PK Sbjct 121 NEQKRQKRVEICRTLLQRQQTSPFLDQILTCDESWILYDNRASEKQWLAVGQDANATPKQ 180 Query 512 ILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPI 571 LHPKK ++++WW G++++ L TITSE Y +++ + Q+L+R + RKG + Sbjct 181 -LHPKKQLLSVWWCVHGIVYWELLPLNRTITSEVYCEQLHRVQQQLRRPPYTVWARKGIL 239 Query 572 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQD 631 D ARPHV+ T +K+ +LG+++L H PYSPDL P++Y++F L +FL+GK+F N+++ Sbjct 240 FQQDGARPHVSAVTRKKIEDLGWDILEHSPYSPDLAPSDYYLFSPLKDFLRGKQFSNEEE 299 Query 632 AENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 A + F +S+ ++Y GI +L + W++C+ CNG+YF Sbjct 300 ICTALKNFFDSKGPEWYRKGIEKLPNLWERCIQCNGNYF 338 >pir||T25365 hypothetical protein T27E7.7 - Caenorhabditis elegans Length=339 Score = 300 bits (768), Expect = 2e-79, Method: Composition-based stats. Identities = 145/338 (42%), Positives = 208/338 (61%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGTWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WWS G +H+ L +TIT + Y ++D + +K L Sbjct 186 LHPKKIMICVWWSVQGPVHWELLPTNKTITDDYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >gb|AAZ67098.1| transposase [Adineta vaga] Length=345 Score = 300 bits (767), Expect = 2e-79, Method: Composition-based stats. Identities = 146/340 (42%), Positives = 206/340 (60%), Gaps = 6/340 (1%) Query 330 KMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 389 KM L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 390 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPH 449 RSGRP EVD D L+ +IE DP T R +AE+L +H+TV +HL ++ K K W+PH Sbjct 68 LPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 450 ELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFP 509 EL+ +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 510 KPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKG 569 K H KK ++++WW G+IH+ L G TIT++ Y Q++D + +KL+ Q + Sbjct 188 KADSHSKKFILSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 570 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 629 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL PT+YH+F+ L+N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 630 QDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >pir||T19261 hypothetical protein C14A6.4 - Caenorhabditis elegans Length=339 Score = 300 bits (767), Expect = 3e-79, Method: Composition-based stats. Identities = 144/338 (42%), Positives = 208/338 (61%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGTWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T20782 hypothetical protein F11D11.9 - Caenorhabditis elegans Length=355 Score = 299 bits (766), Expect = 3e-79, Method: Composition-based stats. Identities = 144/338 (42%), Positives = 208/338 (61%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGTWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T19660 hypothetical protein C33A12.5 - Caenorhabditis elegans Length=339 Score = 299 bits (765), Expect = 4e-79, Method: Composition-based stats. Identities = 144/338 (42%), Positives = 208/338 (61%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGTWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEYL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T19600 probable transposition protein C31A11.2 - Caenorhabditis elegans Length=339 Score = 299 bits (765), Expect = 4e-79, Method: Composition-based stats. Identities = 144/338 (42%), Positives = 208/338 (61%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T23086 hypothetical protein H12I19.6 - Caenorhabditis elegans Length=339 Score = 299 bits (765), Expect = 5e-79, Method: Composition-based stats. Identities = 144/338 (42%), Positives = 208/338 (61%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTTKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T19555 hypothetical protein C29E6.6 - Caenorhabditis elegans Length=339 Score = 298 bits (764), Expect = 5e-79, Method: Composition-based stats. Identities = 144/338 (42%), Positives = 208/338 (61%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPIELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T22780 hypothetical protein F56D5.7 - Caenorhabditis elegans Length=339 Score = 298 bits (764), Expect = 6e-79, Method: Composition-based stats. Identities = 144/338 (42%), Positives = 208/338 (61%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEYL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T18783 hypothetical protein B0564.5 - Caenorhabditis elegans Length=339 Score = 298 bits (764), Expect = 6e-79, Method: Composition-based stats. Identities = 143/338 (42%), Positives = 208/338 (61%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGTWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K+ L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKINGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNA PHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNAMPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T18779 transposase containing protein - Caenorhabditis elegans Length=708 Score = 298 bits (763), Expect = 8e-79, Method: Composition-based stats. Identities = 144/340 (42%), Positives = 209/340 (61%), Gaps = 7/340 (2%) Query 328 TMKMM-LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDES 386 TM ++ L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD S Sbjct 260 TMTIIKLERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFS 319 Query 387 LEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKW 446 LE+ ERSGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL W Sbjct 320 LEEIERSGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIPRHLGRLGFTSKLGTW 379 Query 447 VPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPK 506 VPHEL+ +QK R V + L+ +L+ +VT DEKW+LY N R QWL E Sbjct 380 VPHELSASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGI 439 Query 507 HFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVN 566 PKP LHPKK+M+ +WW G +H+ L +TIT + Y ++D + +K L Sbjct 440 PTPKPDLHPKKIMICVWWGVQGPVHWELLPTNKTITVDYYCAQLDRVAEKTNGKYEKLY- 498 Query 567 RKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRF 626 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F Sbjct 499 -----FLHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQF 553 Query 627 HNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCN 666 +++ + F S+S DF++ GI L S+WQ+ VD N Sbjct 554 DDEEHLKTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTN 593 >pir||T26396 hypothetical protein Y105C5B.t - Caenorhabditis elegans Length=339 Score = 298 bits (762), Expect = 9e-79, Method: Composition-based stats. Identities = 144/338 (42%), Positives = 207/338 (61%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKKVM+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKVMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPHVA+ T QKL + G+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDFGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >gb|AAB00629.1| Hypothetical protein R05G6.2 [Caenorhabditis elegans] Length=339 Score = 297 bits (761), Expect = 1e-78, Method: Composition-based stats. Identities = 143/338 (42%), Positives = 207/338 (61%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+K GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKLKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGTWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T27435 hypothetical protein Y7A5A.4 - Caenorhabditis elegans Length=481 Score = 297 bits (761), Expect = 1e-78, Method: Composition-based stats. Identities = 143/338 (42%), Positives = 208/338 (61%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTDKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD N +F Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNVIFF 337 >gb|AAF60591.1| Hypothetical protein Y45G12C.13 [Caenorhabditis elegans] Length=384 Score = 297 bits (761), Expect = 1e-78, Method: Composition-based stats. Identities = 142/334 (42%), Positives = 206/334 (61%), Gaps = 6/334 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCN 666 + F S+S DF++ GI L S+WQ+ VD N Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTN 333 >pir||T20442 hypothetical protein E03H4.1 - Caenorhabditis elegans Length=339 Score = 297 bits (760), Expect = 2e-78, Method: Composition-based stats. Identities = 143/338 (42%), Positives = 207/338 (61%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +V DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVIGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >pir||T25335 hypothetical protein T26H8.1 - Caenorhabditis elegans Length=339 Score = 297 bits (760), Expect = 2e-78, Method: Composition-based stats. Identities = 143/338 (42%), Positives = 208/338 (61%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPHVA+ T QKL +LG+ VLPHPPYSP+L PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPNLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >gb|AAZ67103.1| transposase [Adineta vaga] Length=345 Score = 296 bits (759), Expect = 2e-78, Method: Composition-based stats. Identities = 146/340 (42%), Positives = 206/340 (60%), Gaps = 6/340 (1%) Query 330 KMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 389 K+ L +++R + L EF++G KA E NI G G + RT Q WF D L+D Sbjct 8 KINLSHREVRVLLLHEFRLGNKATEAASNICGTMGQGLVSTRTAQRWFNHCKNRDLELDD 67 Query 390 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPH 449 RSGRP EVD D L+ +IE DP T R +AE+L +H+TV +HL ++ K K W+PH Sbjct 68 LPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 450 ELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFP 509 EL+ +Q +R + LI + N +L +VT +EKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLVTGEEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 510 KPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKG 569 K LHPKK+M+++WW G+IH+ L G TIT++ Y Q++D + +KL+ Q + Sbjct 188 KADLHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 570 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 629 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL PT+YH+F+ L+N L+ K+F + Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDEE 301 Query 630 QDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >pir||T32676 hypothetical protein K07C6.12 - Caenorhabditis elegans Length=339 Score = 296 bits (757), Expect = 3e-78, Method: Composition-based stats. Identities = 143/338 (42%), Positives = 207/338 (61%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++ A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLVHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGTWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >dbj|BAE88734.1| UniGene info unnamed protein product [Macaca fascicularis] Length=147 Score = 296 bits (757), Expect = 4e-78, Method: Composition-based stats. Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%) Query 529 LIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQK 588 +IHYSFLNPGETITSEKYAQEIDEM+QKLQ LQLALVNRKGPILLHDNARPHVAQPTLQK Sbjct 5 IIHYSFLNPGETITSEKYAQEIDEMHQKLQHLQLALVNRKGPILLHDNARPHVAQPTLQK 64 Query 589 LNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFY 648 LNELGYEVLPHPPYSPDLLPTNYH+FKHLNNFLQGKRFHNQQDAENAFQEFV+S+STDFY Sbjct 65 LNELGYEVLPHPPYSPDLLPTNYHIFKHLNNFLQGKRFHNQQDAENAFQEFVKSRSTDFY 124 Query 649 ATGINQLISRWQKCVDCNGSYFD 671 ATGINQLISRWQKCVDCNG+YFD Sbjct 125 ATGINQLISRWQKCVDCNGAYFD 147 >emb|CAA56855.1| planarian mariner-0 gene [Girardia tigrina] Length=273 Score = 295 bits (756), Expect = 4e-78, Method: Composition-based stats. Identities = 142/274 (51%), Positives = 187/274 (68%), Gaps = 2/274 (0%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 ++ +IR + +EF G + NIN+ + + TV WFK+F GD L ++ R Sbjct 1 MEISEIRILMKYEFHRGATTRQAVGNINSVYPTQAVTQTTVAHWFKRFRSGDFDLSNQPR 60 Query 393 SGRPS-EVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHEL 451 GRP +VDND L+A +EAD + E+A + V ST++ HLKQI KVKKLDKWVPHEL Sbjct 61 -GRPEIKVDNDALKADVEADSSQSALELASKFGVAKSTILIHLKQINKVKKLDKWVPHEL 119 Query 452 TENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKP 511 + K +R + SL+ RN +PFL RIVTCDEKWI+YDNR+RS+QWLD +E PKHFPK Sbjct 120 KDEHKQQRLDACLSLLSRNKADPFLHRIVTCDEKWIMYDNRKRSSQWLDPDEPPKHFPKR 179 Query 512 ILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPI 571 +H KK+MVT+WWS+ G+IHY F+ PG +ITS+ Y ++D+M +KL Q + NR PI Sbjct 180 KVHQKKLMVTVWWSSYGVIHYDFMVPGTSITSDVYCSQLDDMMEKLAIKQPKMFNRLTPI 239 Query 572 LLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPD 605 LLHDNARPH A+ T+ KL +LG E L HPPYSPD Sbjct 240 LLHDNARPHSAKNTVAKLQQLGLETLRHPPYSPD 273 >gb|AAZ67099.1| transposase [Adineta vaga] Length=345 Score = 295 bits (756), Expect = 5e-78, Method: Composition-based stats. Identities = 144/340 (42%), Positives = 205/340 (60%), Gaps = 6/340 (1%) Query 330 KMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 389 KM L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLPHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 390 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPH 449 RSGRP EVD D L+ +IE DP T R +AE+L +H+TV +HL ++ K K W+PH Sbjct 68 SPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 450 ELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFP 509 EL+ +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 510 KPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKG 569 K H KK ++++WW G+IH+ L G IT++ Y Q++D + +KL+ Q + Sbjct 188 KADFHSKKFILSVWWGFKGVIHWEVLPNGYPITADLYCQQLDRVPEKLKGKQDRVY---- 243 Query 570 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 629 LHDNARPHVA+ T ++L +LG+ +PHPPYSPDL PT+YH+F+ L+N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREELLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 630 QDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >pir||T32726 hypothetical protein C45H4.5 - Caenorhabditis elegans Length=573 Score = 294 bits (753), Expect = 1e-77, Method: Composition-based stats. Identities = 141/335 (42%), Positives = 208/335 (62%), Gaps = 7/335 (2%) Query 328 TMKMM-LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDES 386 TM ++ L+++ +R + L+EF++G+ A E RNI A G G + T + WF+KF GD S Sbjct 105 TMTIIKLERRDVRLLLLYEFRLGQSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFS 164 Query 387 LEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKW 446 LE+ ERSGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL W Sbjct 165 LEEIERSGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIW 224 Query 447 VPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPK 506 VPHEL+ +QK R V + L+ +L+ +VT DEKW+LY N R QWL E Sbjct 225 VPHELSASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGI 284 Query 507 HFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVN 566 PKP LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 285 PTPKPDLHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEQLY- 343 Query 567 RKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRF 626 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F Sbjct 344 -----FLHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQF 398 Query 627 HNQQDAENAFQEFVESQSTDFYATGINQLISRWQK 661 +++ + F S+S DF++ GI L S+WQ+ Sbjct 399 DDEEHLKTELSTFFSSRSPDFFSRGIMMLPSKWQQ 433 >gb|AAZ67094.1| transposase [Adineta vaga] Length=345 Score = 293 bits (749), Expect = 3e-77, Method: Composition-based stats. Identities = 144/340 (42%), Positives = 204/340 (60%), Gaps = 6/340 (1%) Query 330 KMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 389 KM L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 390 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPH 449 RSGRP EV D L+ +IE DP T R +AE+L +H+TV +HL ++ K K W+P+ Sbjct 68 LPRSGRPMEVGVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVGKHLNELGKTWKYGVWIPY 127 Query 450 ELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFP 509 EL+ +Q + + LI N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQGVDACMDLITFYRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 510 KPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKG 569 K LH KK+M+++WW G+I + L G TIT++ Y Q++D + +KL+ Q + Sbjct 188 KADLHSKKLMLSVWWGIKGVIRWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 570 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 629 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL PT+YH+F+ L+N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDDE 301 Query 630 QDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >pir||T27281 hypothetical protein Y64G10A.d - Caenorhabditis elegans Length=352 Score = 292 bits (747), Expect = 6e-77, Method: Composition-based stats. Identities = 141/334 (42%), Positives = 205/334 (61%), Gaps = 6/334 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGRP E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRPVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNA PHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNAMPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCN 666 + F S+S DF++ GI L S+WQ+ VD N Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTN 333 >pir||T24136 hypothetical protein R10E4.8 - Caenorhabditis elegans Length=339 Score = 292 bits (747), Expect = 6e-77, Method: Composition-based stats. Identities = 142/340 (41%), Positives = 207/340 (60%), Gaps = 6/340 (1%) Query 331 MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDE 390 + L+++ +R + L+EF +G A E RNI A G G + T + WF+KF GD SLE+ Sbjct 4 ITLERRDVRLLLLYEFCLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEI 63 Query 391 ERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHE 450 E SGRP E++ + L ++E +P + RE+ ++L HST+ RHL ++ KL WVPHE Sbjct 64 ECSGRPVELNEEDLVKLVEEEPRLSLREMEKKLECCHSTIARHLGRLGFTSKLGIWVPHE 123 Query 451 LTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPK 510 L+ +QK R V + L+ +L+ +VT DEKW+LY N R QWL E PK Sbjct 124 LSASQKLTRVNVCTQLLTFRRKFDWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPK 183 Query 511 PILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGP 570 P LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 184 PDLHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY----- 238 Query 571 ILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQ 630 LHDNARPHVA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 239 -FLHDNARPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEE 297 Query 631 DAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 298 HLKTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >gb|AAZ67105.1| transposase [Adineta vaga] Length=345 Score = 291 bits (745), Expect = 1e-76, Method: Composition-based stats. Identities = 143/340 (42%), Positives = 206/340 (60%), Gaps = 6/340 (1%) Query 330 KMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 389 K+ L ++IR + L EF++ KA E NI G G + RT Q WF F D L+D Sbjct 8 KINLSHREIRVLSLHEFRLDHKATEAANNICGTMGQGLVSTRTAQRWFNHFKNRDLELDD 67 Query 390 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPH 449 RSGR E+D LR +I+ DP +T +AE+L +H+TV +HLK++ K K W+PH Sbjct 68 VPRSGRLMELDVGFLRQLIQQDPRSTLGYLAEQLGFSHTTVEKHLKELGKTWKYGVWIPH 127 Query 450 ELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFP 509 +L+ +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 KLSSHQLQQRGDTCMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 510 KPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKG 569 K LHPKK+M+++WW G+IH+ L G TIT++ Y Q++D + +KL+ Q + Sbjct 188 KADLHPKKLMLSVWWGIKGVIHWEVLPNGYTITADLYCQQLDRVAEKLKGKQDRVY---- 243 Query 570 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 629 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL PT+YH+F+ L+N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNGLRDKKFDDE 301 Query 630 QDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >pir||T27715 hypothetical protein ZK1225.3 - Caenorhabditis elegans Length=339 Score = 290 bits (741), Expect = 3e-76, Method: Composition-based stats. Identities = 141/338 (41%), Positives = 205/338 (60%), Gaps = 6/338 (1%) Query 333 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEER 392 L+++ +R + L+EF++G A E RNI A G G + T + WF+KF GD SLE+ ER Sbjct 6 LERRDVRLLLLYEFRLGHSAMEAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIER 65 Query 393 SGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELT 452 SGR E++ + L ++E +P + RE+ E+L HST+ RHL ++ KL WVPHEL+ Sbjct 66 SGRLVELNEEDLVKLVEEEPRLSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELS 125 Query 453 ENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPI 512 +QK R V + L+ +L+ +V DEKW+LY N R QWL E PKP Sbjct 126 ASQKLTRVNVCTQLLTFRRKFDWLNNLVIGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPD 185 Query 513 LHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL 572 LHPKK+M+ +WW G +H+ L +TIT++ Y ++D + +K L Sbjct 186 LHPKKIMICVWWGVQGPVHWELLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------F 239 Query 573 LHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDA 632 LHDNARP VA+ T QKL +LG+ VLPHPPYSPDL PT+YH+F L+++++ K+F +++ Sbjct 240 LHDNARPPVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHL 299 Query 633 ENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF 670 + F S+S DF++ GI L S+WQ+ VD NG Y Sbjct 300 KTELSTFFSSRSPDFFSRGIMMLPSKWQQVVDTNGEYL 337 >gb|AAZ67102.1| transposase [Adineta vaga] Length=345 Score = 288 bits (736), Expect = 1e-75, Method: Composition-based stats. Identities = 142/340 (41%), Positives = 203/340 (59%), Gaps = 6/340 (1%) Query 330 KMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 389 K+ L +++R + L EF++G KA E NI G G + RT Q WF D L+D Sbjct 8 KINLSHREVRVLLLHEFRLGNKATEAASNICGTVGQGLVSTRTAQRWFNHCKNRDLELDD 67 Query 390 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPH 449 RSGRP EVD D L+ +IE DP T R +AE+L +H+TV +HL ++ K K W+PH Sbjct 68 LPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWKYGVWIPH 127 Query 450 ELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFP 509 EL+ +Q +R + LI + N +L ++T +EKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGEEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 510 KPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKG 569 K LH KK M++IWW G+IH+ L G IT++ Y ++D + ++L+ Q + Sbjct 188 KADLHSKKSMLSIWWGIKGVIHWEVLPNGYPITADLYCHQLDRVAERLKGKQDRVY---- 243 Query 570 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 629 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL PT+YH+F+ L+N L+ K+F ++ Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRNKKFDDE 301 Query 630 QDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >gb|AAZ67100.1| transposase [Adineta vaga] Length=345 Score = 285 bits (729), Expect = 6e-75, Method: Composition-based stats. Identities = 141/340 (41%), Positives = 200/340 (58%), Gaps = 6/340 (1%) Query 330 KMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 389 KM L +++R + L EF++G KA E NI G G + RT Q WF F GD L+D Sbjct 8 KMNLSHREVRVLLLHEFRLGHKATEAASNICGTMGQGLVSTRTAQRWFNHFKNGDLELDD 67 Query 390 EERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPH 449 RSGRP EVD D L+ +IE DP T R +AE+L +H+TV +HL ++ K + W+PH Sbjct 68 LPRSGRPMEVDVDFLKQLIEEDPRLTLRCLAEQLGCSHTTVEKHLNELGKTWEYGVWIPH 127 Query 450 ELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFP 509 EL+ +Q +R + LI + N +L ++T DEKW+LY N R QWL + P Sbjct 128 ELSAHQLQQRVDACMDLITSHRNYQWLSNLITGDEKWVLYVNYTRRRQWLSAGQTGVATP 187 Query 510 KPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKG 569 K H KK +++ WW G+I + L G IT++ ++D + +KL+ Q + Sbjct 188 KVYFHSKKFILSFWWGIKGVIPWEVLPNGYPITADLDCHQLDRVAEKLKGKQDRVY---- 243 Query 570 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 629 LHDNARPHVA+ T +KL +LG+ +PHPPYSPDL PT+YH+F+ L+N L+ K+F + Sbjct 244 --FLHDNARPHVAKSTREKLLKLGWITIPHPPYSPDLAPTDYHLFRSLSNDLRDKKFDEE 301 Query 630 QDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D + +F + +S DFY GI L RWQ+ VD NG Y Sbjct 302 SDVKTELVKFFDEKSQDFYERGIMSLPERWQQVVDSNGKY 341 >ref|XP_001121351.1| Gene info PREDICTED: similar to SET domain and mariner transposase fusion [Apis mellifera] Length=342 Score = 283 bits (725), Expect = 2e-74, Method: Composition-based stats. Identities = 140/332 (42%), Positives = 202/332 (60%), Gaps = 2/332 (0%) Query 331 MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDE 390 M DK +R L+EF+ GR A E RN+ F GT ++RT + W++KF D D+ Sbjct 1 MATDKVHLRHCILYEFQQGRNATEACRNLLKMF-EGTVSDRTCRRWYEKFETSDFDFSDK 59 Query 391 ERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHE 450 RSGRPS +D++ ++A++E DP TT E+AE LN + H+++I K +WVPHE Sbjct 60 LRSGRPSLIDDNVVKAMLEQDPFLTTSEIAERLNSAQQIISDHIRKIGLGWKYSRWVPHE 119 Query 451 LTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPK 510 L++ + R + + L+ RN EPFL+R++T DEKWI+Y+N R + + + K Sbjct 120 LSQKNLDDRVVICTFLLARNKIEPFLNRMITGDEKWIIYNNIVRKRTYCELGKPSPSTSK 179 Query 511 PILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEK-YAQEIDEMNQKLQRLQLALVNRKG 569 P L K M+ IWW G IHY L P E + SEK Y Q++D + +Q+ + A+ NRK Sbjct 180 PNLTLNKRMLCIWWDIRGPIHYELLKPNEKLNSEKFYCQQLDNLKTAVQKKRPAMFNRKD 239 Query 570 PILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQ 629 IL HDNARPH A QK+ E+G+E+L HPPYSPD+ ++YH+F L NFL K+F N+ Sbjct 240 IILHHDNARPHAALGARQKIAEVGWEILSHPPYSPDIALSDYHLFLSLQNFLTSKKFKNK 299 Query 630 QDAENAFQEFVESQSTDFYATGINQLISRWQK 661 +D + A +F S+ F+ GI +L SRWQK Sbjct 300 EDVKQALVQFFASKDETFFKNGIYKLPSRWQK 331 >dbj|BAB86288.1| mariner transposase [Apis cerana] Length=336 Score = 282 bits (722), Expect = 4e-74, Method: Composition-based stats. Identities = 142/339 (41%), Positives = 206/339 (60%), Gaps = 6/339 (1%) Query 331 MMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDE 390 M K+ R I LF ++ G+ A + + + +G G R Q WF KF + ++D Sbjct 1 MQDQKEHFRHILLFYYRKGKNAVQARKKLCEIYGEGILTVRQCQNWFSKFRSDNFDIKDA 60 Query 391 ERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHE 450 RSGRP E D D+++A+IEA+ TTRE+A LN+++STV H+K++ V KLD WVPH Sbjct 61 PRSGRPVEADEDKIKALIEANRRITTREIATRLNLSNSTVHDHMKRLGFVSKLDIWVPHV 120 Query 451 LTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPK 510 L E R ++ SL+ R N+PFL RIVT DEKWI+YDN +R + E + K Sbjct 121 LKEKDLLCRIDICDSLLKREENDPFLKRIVTGDEKWIVYDNIKR-----ELNEPAQRTSK 175 Query 511 PILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGP 570 +H KKVM+++WW G++ + L TI SE Y ++D++N +++ + L+NRKG Sbjct 176 NNIH-KKVMLSVWWDFKGVVFFELLPNNCTINSEVYCNQLDKLNNSIKQKRPELINRKGV 234 Query 571 ILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQ 630 + HDNA+ H++ T QKL +LG+EVLPHPPYSPDL P++YH+F+ L N L K F + + Sbjct 235 VFHHDNAKAHMSLMTRQKLLQLGWEVLPHPPYSPDLAPSDYHLFRSLQNSLNDKTFTSNE 294 Query 631 DAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D +N +F ++ FY GI L RWQ +D NG Y Sbjct 295 DVKNYLDQFFANKDQKFYERGIMLLPKRWQYVLDHNGQY 333 >gb|AAZ67106.1| transposase [Adineta vaga] Length=345 Score = 282 bits (721), Expect = 6e-74, Method: Composition-based stats. Identities = 141/341 (41%), Positives = 202/341 (59%), Gaps = 6/341 (1%) Query 329 MKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 388 + M L +++I + L EF++G KA E NI + G + RT Q WF +F G+ L Sbjct 7 LNMNLSRREILVLLLHEFRLGHKATEAANNICSTMGEDVLSTRTAQHWFNRFKNGNLELN 66 Query 389 DEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVP 448 D RSGRP EVD D L+ +IE DP T R +AE L ++ V +HLK++ K K W+P Sbjct 67 DLLRSGRPLEVDVDLLQQLIEQDPRLTLRCLAEHLGCSYVAVEKHLKELGKTWKYGVWIP 126 Query 449 HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHF 508 HEL+ +Q R + L+ + N +L ++T DEKW+LY N QWL + Sbjct 127 HELSSHQLQHRVDACMDLMTSHRNYEWLRNLITGDEKWVLYVNYTHRRQWLSPGQTGVAT 186 Query 509 PKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRK 568 PKP LHPKKVM+++WW G+IH+ FL G TIT++ Y Q++D + QKL Q + Sbjct 187 PKPDLHPKKVMLSVWWGVNGIIHWEFLPNGCTITADLYCQQLDRVAQKLNGKQDRVY--- 243 Query 569 GPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHN 628 LHDNARP VA+ T +KL +LG+ +PHPPYSPDL PT+YH+F+ L++ L+ K+F + Sbjct 244 ---YLHDNARPRVAKLTCEKLLKLGWINVPHPPYSPDLAPTDYHLFRSLSHHLREKKFDD 300 Query 629 QQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 669 D + F +S DF+ GI L RW++ +D G+Y Sbjct 301 DNDMKMDISNFFGRKSKDFHERGILSLPERWRQVIDSGGAY 341 >pir||T18991 hypothetical protein C06B8.5 - Caenorhabditis elegans Length=314 Score = 278 bits (711), Expect = 8e-73, Method: Composition-based stats. Identities = 137/317 (43%), Positives = 193/317 (60%), Gaps = 6/317 (1%) Query 354 ETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPL 413 E RNI A G G + T + WF+KF GD SLE+ ERSGRP E++ + L ++E +P Sbjct 2 EAERNICGAMGEGALSYNTAKSWFQKFKNGDFSLEEIERSGRPVELNEEDLVKLVEEEPR 61 Query 414 TTTREVAEELNVNHSTVVRHLKQIEKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNE 473 + RE+ E+L HST+ RHL ++ KL WVPHEL+ +QK R V + L+ Sbjct 62 LSLREMEEKLECCHSTIARHLGRLGFTSKLGIWVPHELSASQKLTRVNVCTQLLTFRRKF 121 Query 474 PFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYS 533 +L+ +VT DEKW+LY N R QWL E PKP LHPKK+M+ +WW G +H+ Sbjct 122 DWLNNLVTGDEKWVLYVNHSRKRQWLPIGEKGIPTPKPDLHPKKIMICVWWGVQGPVHWE 181 Query 534 FLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELG 593 L +TIT++ Y ++D + +K L LHDNARPHVA+ T QKL +LG Sbjct 182 LLPTNKTITADYYCAQLDRVAEKTNGKYEKLY------FLHDNARPHVAKKTFQKLQDLG 235 Query 594 YEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGIN 653 + VLPHPPYSPDL PT+YH+F L+++++ K+F +++ + F S+S DF++ GI Sbjct 236 WTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEHLKTELSTFFSSRSPDFFSRGIM 295 Query 654 QLISRWQKCVDCNGSYF 670 L S+WQ+ VD NG Y Sbjct 296 MLPSKWQQVVDTNGEYL 312
  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding 
environmental samples from WGS projects
    Posted date:  May 20, 2007  4:45 PM
  Number of letters in database: 1,719,627,930
  Number of sequences in database:  4,970,641
Lambda     K      H
   0.320    0.136    0.428 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4970641
Number of Hits to DB: 119178262
Number of extensions: 5254814
Number of successful extensions: 13053
Number of sequences better than 10: 64
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 13044
Number of HSP's successfully gapped: 66
Length of query: 671
Length of database: 1719627930
Length adjustment: 139
Effective length of query: 532
Effective length of database: 1028708831
Effective search space: 547273098092
Effective search space used: 547273098092
T: 11
A: 40
X1: 16 (7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 81 (35.8 bits)