NCBIProtein banner
My NCBI
[Sign In]  [Register]
PubMedNucleotideProteinGenomeStructurePMCTaxonomyOMIMBooks
 Search  for    
 LimitsPreview/IndexHistoryClipboardDetails
 Display   Show
  Range: from   to 
1:  Q53H47Reports  Histone-lysine N-...[gi:74740552] BLink, Conserved Domains, Links
>gi|74740552|sp|Q53H47|SETMR_HUMAN Histone-lysine N-methyltransferase SETMAR (SET domain and mariner transposase fusion gene-containing protein) (Metnase) (Hsmar1) [Includes: Histone-lysine N-methyltransferase; Mariner transposase Hsmar1] MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFPGCICVKTPCL PGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGL RTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVYNGQVMETFVDPTYIGNIGRFLN HSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKS CTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGR KAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVA EELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYD NRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRL QLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQ DAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH