spacer

ClustalW Results


Results of search
Number of sequences 2
Alignment score 618
Sequence format Pearson
Sequence type aa
ClustalW version 1.83
JalView
Output file clustalw-20070528-17335129.output
Alignment file clustalw-20070528-17335129.aln
Guide tree file clustalw-20070528-17335129.dnd
Your input file clustalw-20070528-17335129.input

To save a result file right-click the file link in the above table and choose "Save Target As".
If you cannot see the JalView button, reload the page and check your browser settings to enable Java Applets.




Scores Table

SeqA Name     Len(aa)  SeqB Name     Len(aa)  Score
===================================================
1    Hsmar1   343      2    Hsmar2   351      32   
===================================================
PLEASE NOTE: Some scores may be missing from the above table if the alignment was done using multiple CPU mode. Please check the output.




Alignment

CLUSTAL W (1.83) multiple sequence alignment


Hsmar1          MEMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLE 60
Hsmar2          --MNSAKIEARTNIKFMVKLGWKNGEITDALRKVYGDNAPKKSAVYKWITRFKKGRDDVE 58
                  *   * : *: : * .*:* * .* *  :.:.:* .:.:: :*  *:.:* ** :.:*

Hsmar1          DEERSGRPS----EVDNDQLRAIIEADPLTTTREVAEELNVDHSTVVRHLKQIGKVKKLD 116
Hsmar2          DEARSGRPSTSICEEKINLVRALIEEDRRLTAETIANTTDISIGSAYTILTEKLKLSKLS 118
                ** ******    * . : :**:** *   *:. :*:  ::. .:.   *.:  *:.**.

Hsmar1          -KWVPHELSENQKNRRFEVSSSLILRNNNEP--FLDRIVTCDEKWILYDN---RRRPAQW 170
Hsmar2          TRWVPKPLRPDQLQTRAELSMEILNKWDQDPEAFLRRIVTGDETWLYQYDPEDKAQSKQW 178
                 :***: *  :* : * *:* .:: : :::*  ** **** **.*:   :   : :. **

Hsmar1          LDREEAPKHFPKPNLHQKKVMVTVWWSAAGLIHYSFLNPGETITSEKYAQQIDEMHRKLQ 230
Hsmar2          LPRGGSGPVKAKADWSRAKVMATVFWDAQGILLVDFLEGQRTITSAYYESVLRKLAKALA 238
                * *  :    .*.:  : ***.**:*.* *::  .**:  .****  * . : :: : * 

Hsmar1          RLQPALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLSPTDYHFFKHLD 290
Hsmar2          EKRPGKLHQR-VLLHHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLK 297
                . :*. ::::  :* **** .* :: *   *.*: :*:: ********:*:*:.:* :*.

Hsmar1          NFLQGKRFHNQQDAENAFQEFVESRSTDFYATGINKLISRWQKCVDCNGSYFD- 343
Hsmar2          KSLKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCLELDGAYVEK 351
                : *:*.:* . ::.:::   :::*:..:*:  *:*    * ***:: :*:*.: 
PLEASE NOTE: Showing colors on large alignments is slow.




Guide Tree

(Hsmar1:0.33965,Hsmar2:0.33965);


Cladogram

Right-click on the above tree to see display options.
Problems printing? Read how to print a Phylogram or Cladogram.
spacer
spacer