Job Title: Mus musculus Gh transl protein

BLASTX 2.2.16 (Mar-25-2007)
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

RID: 668CBRE8012


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           4,999,723 sequences; 1,728,490,168 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports

Query=  Mus musculus Gh transl protein
Length=935


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|NP_032143.1|  growth hormone [Mus musculus] >sp|P06880|SOM...   397    4e-109 UniGene infoGene info
gb|AAC99988.1|  growth hormome [Mus musculus]                       395    2e-108 Gene info
sp|P01244|SOMA_RAT  Somatotropin precursor (Growth hormone) >e...   389    1e-106 Gene info
ref|NP_001030020.1|  growth hormone 1 [Rattus norvegicus] >emb...   387    5e-106 UniGene infoGene info
sp|P37886|SOMA_MESAU  Somatotropin precursor (Growth hormone) ...   387    6e-106
emb|CAA80601.1|  dog growth hormone [Canis familiaris]              375    1e-102 UniGene infoGene info
ref|NP_001003168.1|  growth hormone [Canis lupus familiaris] >...   375    1e-102 UniGene infoGene info
sp|Q9GMB2|SOMA_NYCPY  Somatotropin precursor (Growth hormone) ...   375    1e-102
sp|P46407|SOMA_RABIT  Somatotropin precursor (Growth hormone) ...   375    2e-102
sp|O70615|SOMA_SPAEH  Somatotropin precursor (Growth hormone) ...   375    2e-102
gb|ABG67748.1|  growth hormone [Lama pacos]                         374    3e-102
sp|Q7YRR6|SOMA_CAMDR  Somatotropin precursor (Growth hormone) ...   374    3e-102
sp|Q659Q8|SOMA_BALPH  Somatotropin precursor (Growth hormone) ...   374    4e-102
emb|CAA42448.2|  growth factor [Mustela vison]                      374    5e-102
sp|P19795|SOMA_MUSVI  Somatotropin precursor (Growth hormone) ...   374    5e-102
gb|AAW48243.1|  growth hormone [Sus scrofa] >gb|AAW48246.1| gr...   373    9e-102
gb|AAS89356.1|  growth hormone [Sus scrofa] >gb|AAW48240.1| gr...   373    9e-102 UniGene info
gb|AAA96142.1|  growth hormone precursor                            373    9e-102 Gene info
gb|AAA31045.1|  growth hormone precursor                            373    9e-102 UniGene info
ref|NP_001009337.1|  growth hormone [Felis catus] >sp|P46404|S...   373    9e-102 Gene info
sp|Q7YQB8|SOMA_HIPAM  Somatotropin precursor (Growth hormone) ...   372    1e-101
prf||1709310A  somatotropin                                         372    1e-101
ref|NP_001075417.1|  growth hormone [Equus caballus] >sp|P0124...   372    1e-101 Gene info
sp|Q8MI73|SOMA_DELDE  Somatotropin precursor (Growth hormone) ...   372    1e-101
sp|Q9GKA1|SOMA_GALSE  Somatotropin precursor (Growth hormone) ...   372    2e-101
sp|Q8HYE5|SOMA_AILME  Somatotropin precursor (Growth hormone) ...   372    2e-101
gb|AAW48242.1|  growth hormone [Sus scrofa]                         371    3e-101
prf||1608112A  somatotropin                                         371    3e-101
sp|P01248|SOMA_PIG  Somatotropin precursor (Growth hormone) >g...   371    3e-101
gb|AAW48247.1|  growth hormone [Sus scrofa] >gb|AAY89257.1| gr...   371    4e-101
gb|AAW29440.1|  growth hormone [Equus caballus]                     369    2e-100 Gene info
gb|ABH10665.1|  growth hormone [Equus caballus]                     368    2e-100 Gene info
gb|ABH10664.1|  growth hormone [Equus caballus]                     368    3e-100 Gene info
sp|P20392|SOMA_LOXAF  Somatotropin (Growth hormone) >prf||1509285   367    4e-100
pir||STHO  somatotropin - horse                                     365    1e-99 
sp|P10766|SOMA_VULVU  Somatotropin (Growth hormone) >pir||JS04...   365    2e-99 
sp|P37885|SOMA_LAMPA  Somatotropin (Growth hormone) >gb|ABO209...   365    3e-99 
prf||1104245A  somatotropin                                         364    3e-99 
ref|NP_999034.1|  growth hormone [Sus scrofa] >gb|AAA73477.1| gro   362    1e-98  UniGene infoGene info
gb|AAA73478.1|  growth hormone                                      360    8e-98  UniGene info
gb|AAA30964.1|  growth hormone                                      359    1e-97 
sp|Q9JKM4|SOMA_CAVPO  Somatotropin precursor (Growth hormone) ...   355    3e-96 
sp|O62754|SOMA_TRIVU  Somatotropin precursor (Growth hormone) ...   348    2e-94 
ref|NP_001028165.1|  growth hormone [Monodelphis domestica] >s...   348    2e-94  UniGene infoGene info
emb|CAJ18232.1|  growth hormone, variant B [Cervus elaphus]         348    3e-94 
sp|P56437|SOMA_CEREL  Somatotropin precursor (Growth hormone) ...   348    3e-94 
gb|ABC18163.1|  growth hormone precursor [Bubalus bubalis]          347    7e-94 
gb|AAF67172.1|AF238493_1  growth hormone [Cavia porcellus]          346    9e-94 
gb|ABO21735.1|  growth hormone precursor [Ovis aries]               345    2e-93  Gene info
gb|AAF03130.1|  growth hormone [Capra hircus]                       345    2e-93 
gb|ABC18166.1|  growth hormone precursor [Bos taurus]               345    2e-93  UniGene infoGene info
ref|NP_851339.1|  growth hormone [Bos taurus] >sp|P01246|SOMA_...   345    2e-93  UniGene infoGene info
emb|CAC29336.1|  growth hormone-1 protein [Tragulus javanicus]      344    5e-93 
gb|AAX31661.1|  somatotropin [Bubalus bubalis]                      344    5e-93 
gb|AAF03131.1|  growth hormone [Bubalus bubalis] >gb|AAF03132....   344    5e-93 
gb|ABC18164.1|  growth hormone precursor [Capra hircus]             343    6e-93 
sp|Q7YQD2|SOMA_GIRCA  Somatotropin precursor (Growth hormone) ...   343    6e-93 
sp|O18938|SOMA_BUBBU  Somatotropin precursor (Growth hormone) ...   343    6e-93 
emb|CAC29337.1|  growth hormone-2 protein [Tragulus javanicus]      343    1e-92 
gb|ABC18167.1|  growth hormone precursor [Bos taurus]               343    1e-92  UniGene infoGene info
gb|ABO64651.1|  growth hormone [Bos taurus]                         342    1e-92  Gene info
gb|AAX07134.1|  growth hormone 1 [Bos taurus]                       342    1e-92  UniGene infoGene info
sp|Q864S7|SOMA_BOSMU  Somatotropin precursor (Growth hormone) ...   342    1e-92 
gb|ABF13538.1|  growth hormone [Ovis aries]                         342    2e-92 
sp|P33092|SOMA_BALBO  Somatotropin (Growth hormone) >prf||0812180   342    2e-92 
sp|P67930|SOMA_SHEEP  Somatotropin precursor (Growth hormone) ...   342    2e-92 
gb|ABF13513.1|  growth hormone [Ovis aries] >gb|ABF13533.1| gr...   341    3e-92 
sp|Q1HFN3|SOMA_BOSGF  Somatotropin precursor (Growth hormone) ...   341    3e-92 
ref|NP_001009315.2|  growth hormone [Ovis aries] >gb|AAB24467....   341    3e-92  UniGene infoGene info
gb|ABF13546.1|  growth hormone [Ovis aries]                         341    4e-92 
gb|ABC18165.1|  growth hormone precursor [Bos taurus]               341    4e-92  UniGene infoGene info
gb|ABO21737.1|  growth hormone precursor [Ovis aries]               340    5e-92  Gene info
gb|AAX35770.1|  growth hormone [Capra hircus]                       340    5e-92 
gb|ABF13564.1|  growth hormone [Ovis aries]                         340    7e-92 
gb|ABF13556.1|  growth hormone [Ovis aries]                         340    7e-92 
gb|ABF13524.1|  growth hormone [Ovis aries]                         340    9e-92 
gb|ABF13566.1|  growth hormone [Ovis aries]                         339    1e-91 
gb|ABF13562.1|  growth hormone [Ovis aries]                         339    1e-91 
gb|ABO21741.1|  growth hormone precursor [Capra hircus]             339    1e-91 
gb|ABK20344.1|  growth hormone [Ovis aries]                         339    1e-91  UniGene infoGene info
gb|ABF13511.1|  growth hormone [Ovis aries] >gb|ABF13514.1| gr...   339    1e-91 
gb|ABF13512.1|  growth hormone [Ovis aries] >gb|ABF13521.1| gr...   339    1e-91 
gb|AAC48679.1|  placental growth hormone [Ovis aries]               339    1e-91  UniGene infoGene info
prf||1805146A  somatotropin                                         339    1e-91 
gb|ABO21736.1|  growth hormone precursor [Ovis aries]               338    2e-91  Gene info
gb|ABF13570.1|  growth hormone [Ovis aries]                         338    2e-91 
gb|ABF13525.1|  growth hormone [Ovis aries]                         338    3e-91 
gb|ABF13534.1|  growth hormone [Ovis aries]                         337    4e-91 
gb|ABF13550.1|  growth hormone [Ovis aries]                         337    6e-91 
gb|ABF13517.1|  growth hormone [Ovis aries] >gb|ABF13530.1| gr...   337    7e-91 
gb|ABF13572.1|  growth hormone [Ovis aries]                         337    7e-91 
gb|ABF13522.1|  growth hormone [Ovis aries]                         337    7e-91 
gb|AAA31527.1|  growth hormone precursor                            337    7e-91 
gb|ABF13542.1|  growth hormone [Ovis aries]                         336    1e-90 
gb|ABF13568.1|  growth hormone [Ovis aries]                         336    1e-90 
gb|ABF13531.1|  growth hormone [Ovis aries]                         335    2e-90 
gb|ABF13528.1|  growth hormone [Ovis aries]                         333    8e-90 
dbj|BAE66634.1|  growth hormone [Ovis aries]                        332    1e-89  UniGene infoGene info
gb|ABF13527.1|  growth hormone [Ovis aries]                         332    2e-89 
gb|ABF13576.1|  growth hormone [Ovis aries]                         329    2e-88 
Alignments
>ref|NP_032143.1| UniGene infoGene info growth hormone [Mus musculus] sp|P06880|SOMA_MOUSE Gene info Somatotropin precursor (Growth hormone) emb|CAA26650.1| UniGene infoGene info unnamed protein product [Mus musculus] emb|CAA86658.1| Gene info growth hormone [Mus musculus] dbj|BAB31931.1| UniGene infoGene info unnamed protein product [Mus musculus] dbj|BAB31932.1| UniGene infoGene info unnamed protein product [Mus musculus] dbj|BAB31933.1| UniGene infoGene info unnamed protein product [Mus musculus] dbj|BAB31935.1| UniGene infoGene info unnamed protein product [Mus musculus] dbj|BAB31937.1| UniGene infoGene info unnamed protein product [Mus musculus] dbj|BAC27096.1| UniGene infoGene info unnamed protein product [Mus musculus] gb|AAH61157.1| UniGene infoGene info Growth hormone [Mus musculus] emb|CAM23793.1| Gene info growth hormone [Mus musculus] Length=216 Score = 397 bits (1021), Expect = 4e-109 Identities = 216/216 (100%), Positives = 216/216 (100%), Gaps = 0/216 (0%) Frame = +2 Query 62 MATDSRtswlltvsllcllwPQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERA 241 MATDSRTSWLLTVSLLCLLWPQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERA Sbjct 1 MATDSRTSWLLTVSLLCLLWPQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERA 60 Query 242 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR 421 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR Sbjct 61 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR 120 Query 422 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDAL 601 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDAL Sbjct 121 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDAL 180 Query 602 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF 709 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF Sbjct 181 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF 216 >gb|AAC99988.1| Gene info growth hormome [Mus musculus] Length=216 Score = 395 bits (1015), Expect = 2e-108 Identities = 215/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%) Frame = +2 Query 62 MATDSRtswlltvsllcllwPQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERA 241 MATDSRTSWLLTVSLLCLLWPQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKE ERA Sbjct 1 MATDSRTSWLLTVSLLCLLWPQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKELERA 60 Query 242 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR 421 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR Sbjct 61 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR 120 Query 422 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDAL 601 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDAL Sbjct 121 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDAL 180 Query 602 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF 709 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF Sbjct 181 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF 216 >sp|P01244|SOMA_RAT Gene info Somatotropin precursor (Growth hormone) emb|CAA24548.1| Gene info presomatotropin [Rattus norvegicus] emb|CAA24549.1| Gene info presomatotropin [Rattus norvegicus] Length=216 Score = 389 bits (1000), Expect = 1e-106 Identities = 208/216 (96%), Positives = 211/216 (97%), Gaps = 0/216 (0%) Frame = +2 Query 62 MATDSRtswlltvsllcllwPQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERA 241 MA DS+T WLLT SLLCLLWPQEA AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERA Sbjct 1 MAADSQTPWLLTFSLLCLLWPQEAGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERA 60 Query 242 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR 421 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR Sbjct 61 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR 120 Query 422 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDAL 601 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPR+GQILKQTYDKFDANMRSDDAL Sbjct 121 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDAL 180 Query 602 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF 709 LKNYGLLSCFKKDLHKAETYLRVMKCRRF ESSCAF Sbjct 181 LKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF 216 >ref|NP_001030020.1| UniGene infoGene info growth hormone 1 [Rattus norvegicus] emb|CAA24547.1| UniGene infoGene info unnamed protein product [Rattus norvegicus] gb|AAB04025.1| UniGene infoGene info presomatotropin [Rattus norvegicus] Length=216 Score = 387 bits (994), Expect = 5e-106 Identities = 207/216 (95%), Positives = 210/216 (97%), Gaps = 0/216 (0%) Frame = +2 Query 62 MATDSRtswlltvsllcllwPQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERA 241 MA DS+T WLLT SLLCLLWPQEA A PAMPLSSLF+NAVLRAQHLHQLAADTYKEFERA Sbjct 1 MAADSQTPWLLTFSLLCLLWPQEAGALPAMPLSSLFANAVLRAQHLHQLAADTYKEFERA 60 Query 242 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR 421 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR Sbjct 61 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR 120 Query 422 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDAL 601 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPR+GQILKQTYDKFDANMRSDDAL Sbjct 121 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDAL 180 Query 602 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF 709 LKNYGLLSCFKKDLHKAETYLRVMKCRRF ESSCAF Sbjct 181 LKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF 216 >sp|P37886|SOMA_MESAU Somatotropin precursor (Growth hormone) gb|AAB20368.1| growth hormone [Mesocricetus auratus] Length=216 Score = 387 bits (993), Expect = 6e-106 Identities = 206/216 (95%), Positives = 210/216 (97%), Gaps = 0/216 (0%) Frame = +2 Query 62 MATDSRtswlltvsllcllwPQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERA 241 MA DS+TS LLT +LLCLLWPQEA AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERA Sbjct 1 MAADSQTSRLLTFTLLCLLWPQEAGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERA 60 Query 242 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR 421 YIPEGQRYSIQNAQ AFCFSETIPAPTGKEEAQQR+DMELLRFSLLLIQSWLGPVQFLSR Sbjct 61 YIPEGQRYSIQNAQTAFCFSETIPAPTGKEEAQQRSDMELLRFSLLLIQSWLGPVQFLSR 120 Query 422 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDAL 601 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFD NMRSDDAL Sbjct 121 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDTNMRSDDAL 180 Query 602 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF 709 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF Sbjct 181 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF 216 >emb|CAA80601.1| UniGene infoGene info dog growth hormone [Canis familiaris] Length=216 Score = 375 bits (964), Expect = 1e-102 Identities = 184/196 (93%), Positives = 192/196 (97%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQE AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS Sbjct 21 PQEVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 80 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKD Sbjct 81 ETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKD 140 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETY Sbjct 141 LEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETY 200 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 201 LRVMKCRRFVESSCAF 216 >ref|NP_001003168.1| UniGene infoGene info growth hormone [Canis lupus familiaris] sp|P33711|SOMA_CANFA Gene info Somatotropin precursor (Growth hormone) gb|AAD43366.1|AF069071_1 UniGene infoGene info growth hormone [Canis familiaris] gb|AAF21502.1|U92533_1 Gene info growth hormone [Canis familiaris] Length=216 Score = 375 bits (964), Expect = 1e-102 Identities = 184/196 (93%), Positives = 192/196 (97%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQE AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS Sbjct 21 PQEVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 80 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKD Sbjct 81 ETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKD 140 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETY Sbjct 141 LEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETY 200 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 201 LRVMKCRRFVESSCAF 216 >sp|Q9GMB2|SOMA_NYCPY Somatotropin precursor (Growth hormone) emb|CAC03504.1| growth hormone [Nycticebus pygmaeus] Length=217 Score = 375 bits (964), Expect = 1e-102 Identities = 185/196 (94%), Positives = 192/196 (97%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQEA AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS Sbjct 22 PQEAGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 81 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+DMELLRFSLLLIQSWLGPVQ LSR+FTNSL+ GTSDRVYEKLKD Sbjct 82 ETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQLLSRVFTNSLVLGTSDRVYEKLKD 141 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPRVGQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETY Sbjct 142 LEEGIQALMRELEDGSPRVGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETY 201 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 202 LRVMKCRRFVESSCAF 217 >sp|P46407|SOMA_RABIT Somatotropin precursor (Growth hormone) emb|CAA86287.1| growth hormone precursor [Oryctolagus cuniculus] Length=216 Score = 375 bits (963), Expect = 2e-102 Identities = 184/196 (93%), Positives = 192/196 (97%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQEASAFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS Sbjct 21 PQEASAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 80 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+DMELLRFSLLLIQSWLGPVQFLSR FTN+L+FGTSDRVYEKLKD Sbjct 81 ETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQFLSRAFTNTLVFGTSDRVYEKLKD 140 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPRVGQ+LKQTYDKFD N+R DDALLKNYGLLSCFKKDLHKAETY Sbjct 141 LEEGIQALMRELEDGSPRVGQLLKQTYDKFDTNLRGDDALLKNYGLLSCFKKDLHKAETY 200 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSC F Sbjct 201 LRVMKCRRFVESSCVF 216 >sp|O70615|SOMA_SPAEH Somatotropin precursor (Growth hormone) emb|CAA06716.1| growth hormone [Nannospalax ehrenbergi] Length=216 Score = 375 bits (963), Expect = 2e-102 Identities = 199/216 (92%), Positives = 209/216 (96%), Gaps = 0/216 (0%) Frame = +2 Query 62 MATDSRtswlltvsllcllwPQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERA 241 MAT S+TSWLLT +LLCL WPQEA AFPAMPLS+LF+NAVLRAQHLHQLAADTYKEFERA Sbjct 1 MATGSQTSWLLTFTLLCLPWPQEAGAFPAMPLSNLFANAVLRAQHLHQLAADTYKEFERA 60 Query 242 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR 421 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQR+DMELLRFSLLLIQSWLGPVQFLSR Sbjct 61 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRSDMELLRFSLLLIQSWLGPVQFLSR 120 Query 422 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDAL 601 +FTNSL+FGTSDRV+EKLKDLEEGIQALM+ELEDGS R GQ+LKQTYDKFD NMRSDDAL Sbjct 121 VFTNSLVFGTSDRVFEKLKDLEEGIQALMRELEDGSLRAGQLLKQTYDKFDTNMRSDDAL 180 Query 602 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF 709 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF Sbjct 181 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF 216 >gb|ABG67748.1| growth hormone [Lama pacos] Length=216 Score = 374 bits (961), Expect = 3e-102 Identities = 183/196 (93%), Positives = 192/196 (97%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQEA AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFER YIPEGQRYSIQNAQAAFCFS Sbjct 21 PQEAGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERTYIPEGQRYSIQNAQAAFCFS 80 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKD Sbjct 81 ETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKD 140 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPR GQIL+QTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETY Sbjct 141 LEEGIQALMRELEDGSPRAGQILRQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETY 200 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 201 LRVMKCRRFVESSCAF 216 >sp|Q7YRR6|SOMA_CAMDR Somatotropin precursor (Growth hormone) emb|CAE01391.1| growth hormone [Camelus dromedarius] Length=216 Score = 374 bits (961), Expect = 3e-102 Identities = 183/196 (93%), Positives = 192/196 (97%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQEA AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFER YIPEGQRYSIQNAQAAFCFS Sbjct 21 PQEAGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERTYIPEGQRYSIQNAQAAFCFS 80 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKD Sbjct 81 ETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKD 140 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPR GQIL+QTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETY Sbjct 141 LEEGIQALMRELEDGSPRAGQILRQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETY 200 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 201 LRVMKCRRFVESSCAF 216 >sp|Q659Q8|SOMA_BALPH Somatotropin precursor (Growth hormone) emb|CAH42020.1| growth hormone precursor [Balaenoptera physalus] Length=216 Score = 374 bits (960), Expect = 4e-102 Identities = 184/195 (94%), Positives = 191/195 (97%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 QE AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE Sbjct 22 QEVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 81 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 82 TIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDL 141 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGIQALM+ELEDGSPR GQILKQTYDKFD NMRSDDALLKNYGLLSCFKKDLHKAETYL Sbjct 142 EEGIQALMRELEDGSPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFKKDLHKAETYL 201 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRFVESSCAF Sbjct 202 RVMKCRRFVESSCAF 216 >emb|CAA42448.2| growth factor [Mustela vison] Length=205 Score = 374 bits (959), Expect = 5e-102 Identities = 183/196 (93%), Positives = 191/196 (97%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQE AFPAMPLSSLF+NAVLRAQHLHQLAADTYK+FERAYIPEGQRYSIQNAQAAFCFS Sbjct 10 PQEVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKDFERAYIPEGQRYSIQNAQAAFCFS 69 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+DMELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKD Sbjct 70 ETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKD 129 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPR G ILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETY Sbjct 130 LEEGIQALMRELEDGSPRAGPILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETY 189 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 190 LRVMKCRRFVESSCAF 205 >sp|P19795|SOMA_MUSVI Somatotropin precursor (Growth hormone) emb|CAA39585.1| growth hormone [Mustela vison] Length=216 Score = 374 bits (959), Expect = 5e-102 Identities = 183/196 (93%), Positives = 191/196 (97%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQE AFPAMPLSSLF+NAVLRAQHLHQLAADTYK+FERAYIPEGQRYSIQNAQAAFCFS Sbjct 21 PQEVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKDFERAYIPEGQRYSIQNAQAAFCFS 80 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+DMELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKD Sbjct 81 ETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKD 140 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPR G ILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETY Sbjct 141 LEEGIQALMRELEDGSPRAGPILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETY 200 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 201 LRVMKCRRFVESSCAF 216 >gb|AAW48243.1| growth hormone [Sus scrofa] gb|AAW48246.1| growth hormone [Sus scrofa] gb|AAW48249.1| growth hormone [Sus scrofa] gb|AAY59032.1| Gene info growth hormone [Sus scrofa] gb|ABK55611.1| growth hormone [Sus scrofa] Length=216 Score = 373 bits (957), Expect = 9e-102 Identities = 183/195 (93%), Positives = 191/195 (97%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 QE AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE Sbjct 22 QEVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 81 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 82 TIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDL 141 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETYL Sbjct 142 EEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYL 201 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRFVESSCAF Sbjct 202 RVMKCRRFVESSCAF 216 >gb|AAS89356.1| UniGene info growth hormone [Sus scrofa] gb|AAW48240.1| growth hormone [Sus scrofa] gb|ABD76398.1| UniGene infoGene info growth hormone [Sus scrofa] Length=216 Score = 373 bits (957), Expect = 9e-102 Identities = 183/195 (93%), Positives = 191/195 (97%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 QE AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE Sbjct 22 QEVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 81 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 82 TIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDL 141 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETYL Sbjct 142 EEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYL 201 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRFVESSCAF Sbjct 202 RVMKCRRFVESSCAF 216 >gb|AAA96142.1| Gene info growth hormone precursor Length=216 Score = 373 bits (957), Expect = 9e-102 Identities = 183/196 (93%), Positives = 191/196 (97%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQE AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS Sbjct 21 PQEVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 80 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKD Sbjct 81 ETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKD 140 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDAL KNYGLLSCFKKDLHKAETY Sbjct 141 LEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALPKNYGLLSCFKKDLHKAETY 200 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 201 LRVMKCRRFVESSCAF 216 >gb|AAA31045.1| UniGene info growth hormone precursor Length=210 Score = 373 bits (957), Expect = 9e-102 Identities = 183/195 (93%), Positives = 191/195 (97%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 QE AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE Sbjct 16 QEVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 75 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 76 TIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDL 135 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETYL Sbjct 136 EEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYL 195 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRFVESSCAF Sbjct 196 RVMKCRRFVESSCAF 210 >ref|NP_001009337.1| Gene info growth hormone [Felis catus] sp|P46404|SOMA_FELCA Gene info Somatotropin precursor (Growth hormone) gb|AAA67294.1| Gene info growth hormone Length=216 Score = 373 bits (957), Expect = 9e-102 Identities = 183/196 (93%), Positives = 191/196 (97%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQE FPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS Sbjct 21 PQEVGTFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 80 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKD Sbjct 81 ETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKD 140 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETY Sbjct 141 LEEGIQALMRELEDGSPRGGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETY 200 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 201 LRVMKCRRFVESSCAF 216 >sp|Q7YQB8|SOMA_HIPAM Somatotropin precursor (Growth hormone) emb|CAE01394.1| growth hormone [Hippopotamus amphibius] emb|CAE01395.1| growth hormone [Hippopotamus amphibius] Length=216 Score = 372 bits (956), Expect = 1e-101 Identities = 183/195 (93%), Positives = 190/195 (97%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 QE AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQN QAAFCFSE Sbjct 22 QEVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNTQAAFCFSE 81 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 82 TIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDL 141 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGIQALM+ELEDGSPR GQILKQTYDKFD NMRSDDALLKNYGLLSCFKKDLHKAETYL Sbjct 142 EEGIQALMRELEDGSPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFKKDLHKAETYL 201 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRFVESSCAF Sbjct 202 RVMKCRRFVESSCAF 216 >prf||1709310A somatotropin Length=213 Score = 372 bits (956), Expect = 1e-101 Identities = 182/196 (92%), Positives = 191/196 (97%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQ+ AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS Sbjct 18 PQDVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 77 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+DMELLRFSLLLIQSWLGPVQ LSR+FTNSL+FGTSDRVYEKL+D Sbjct 78 ETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQLLSRVFTNSLVFGTSDRVYEKLRD 137 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETY Sbjct 138 LEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETY 197 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 198 LRVMKCRRFVESSCAF 213 >ref|NP_001075417.1| Gene info growth hormone [Equus caballus] sp|P01245|SOMA_HORSE Gene info Somatotropin precursor (Growth hormone) gb|AAA21027.1| UniGene infoGene info growth hormone [Equus caballus] Length=216 Score = 372 bits (956), Expect = 1e-101 Identities = 182/196 (92%), Positives = 191/196 (97%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQ+ AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS Sbjct 21 PQDVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 80 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+DMELLRFSLLLIQSWLGPVQ LSR+FTNSL+FGTSDRVYEKL+D Sbjct 81 ETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQLLSRVFTNSLVFGTSDRVYEKLRD 140 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETY Sbjct 141 LEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETY 200 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 201 LRVMKCRRFVESSCAF 216 >sp|Q8MI73|SOMA_DELDE Somatotropin precursor (Growth hormone) emb|CAD37292.1| growth hormone [Delphinus delphis] Length=216 Score = 372 bits (956), Expect = 1e-101 Identities = 183/195 (93%), Positives = 190/195 (97%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 QE AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQN QAAFCFSE Sbjct 22 QEVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNTQAAFCFSE 81 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 82 TIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDL 141 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGIQALM+ELEDGSPR GQILKQTYDKFD NMRSDDALLKNYGLLSCFKKDLHKAETYL Sbjct 142 EEGIQALMRELEDGSPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFKKDLHKAETYL 201 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRFVESSCAF Sbjct 202 RVMKCRRFVESSCAF 216 >sp|Q9GKA1|SOMA_GALSE Somatotropin precursor (Growth hormone) gb|AAG44952.1| growth hormone [Galago senegalensis] Length=217 Score = 372 bits (954), Expect = 2e-101 Identities = 183/196 (93%), Positives = 190/196 (96%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQEA AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQN QAAFCFS Sbjct 22 PQEAGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNTQAAFCFS 81 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+DMELLRFSLLLIQSWLGPVQ LSR+FTNSL+ GT DRVYEKLKD Sbjct 82 ETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQLLSRVFTNSLVLGTLDRVYEKLKD 141 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPRVGQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETY Sbjct 142 LEEGIQALMRELEDGSPRVGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETY 201 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 202 LRVMKCRRFVESSCAF 217 >sp|Q8HYE5|SOMA_AILME Somatotropin precursor (Growth hormone) gb|AAN77228.1| growth hormone precursor [Ailuropoda melanoleuca] Length=216 Score = 372 bits (954), Expect = 2e-101 Identities = 193/216 (89%), Positives = 205/216 (94%), Gaps = 0/216 (0%) Frame = +2 Query 62 MATDSRtswlltvsllcllwPQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERA 241 MA D ++S LL +LLCL WPQE AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERA Sbjct 1 MAADPQSSVLLAFALLCLPWPQEVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERA 60 Query 242 YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR 421 YIPEGQRYSIQNAQAAFCFSETIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR Sbjct 61 YIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSR 120 Query 422 IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDAL 601 +FTNSL+FGTSDRVYEKLKDLEEGIQALM+ELEDGSPR GQILK TYDKFD ++RSDDAL Sbjct 121 VFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKPTYDKFDTSLRSDDAL 180 Query 602 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF 709 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF Sbjct 181 LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF 216 >gb|AAW48242.1| growth hormone [Sus scrofa] Length=216 Score = 371 bits (953), Expect = 3e-101 Identities = 182/195 (93%), Positives = 191/195 (97%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 +E AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE Sbjct 22 REVDAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 81 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 82 TIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDL 141 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETYL Sbjct 142 EEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYL 201 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRFVESSCAF Sbjct 202 RVMKCRRFVESSCAF 216 >prf||1608112A somatotropin Length=216 Score = 371 bits (953), Expect = 3e-101 Identities = 182/195 (93%), Positives = 191/195 (97%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 +E AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE Sbjct 22 REVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 81 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 82 TIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDL 141 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETYL Sbjct 142 EEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYL 201 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRFVESSCAF Sbjct 202 RVMKCRRFVESSCAF 216 >sp|P01248|SOMA_PIG Somatotropin precursor (Growth hormone) gb|AAA31044.1| growth hormone emb|CAA37411.1| UniGene info Porcine growth hormone [Sus scrofa] gb|AAU00356.1| growth hormone [Sus scrofa] gb|AAW48241.1| growth hormone [Sus scrofa] gb|AAW48244.1| growth hormone [Sus scrofa] gb|AAW48245.1| growth hormone [Sus scrofa] gb|AAW48248.1| growth hormone [Sus scrofa] prf||1312298A somatotropin Length=216 Score = 371 bits (953), Expect = 3e-101 Identities = 182/195 (93%), Positives = 191/195 (97%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 +E AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE Sbjct 22 REVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 81 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 82 TIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDL 141 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETYL Sbjct 142 EEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYL 201 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRFVESSCAF Sbjct 202 RVMKCRRFVESSCAF 216 >gb|AAW48247.1| growth hormone [Sus scrofa] gb|AAY89257.1| growth hormone protein precursor [Sus scrofa] Length=216 Score = 371 bits (952), Expect = 4e-101 Identities = 181/195 (92%), Positives = 191/195 (97%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 +E AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE Sbjct 22 REVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 81 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDR+YEKLKDL Sbjct 82 TIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRIYEKLKDL 141 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETYL Sbjct 142 EEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYL 201 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRFVESSCAF Sbjct 202 RVMKCRRFVESSCAF 216 >gb|AAW29440.1| Gene info growth hormone [Equus caballus] Length=216 Score = 369 bits (946), Expect = 2e-100 Identities = 180/196 (91%), Positives = 190/196 (96%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQ+ AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS Sbjct 21 PQDVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 80 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTG++EAQQR+DMELLRFSLLLIQSWLGPVQ LSR+FTNSL+FGTSDRVYEKL+D Sbjct 81 ETIPAPTGRDEAQQRSDMELLRFSLLLIQSWLGPVQLLSRVFTNSLVFGTSDRVYEKLRD 140 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKK LHKAETY Sbjct 141 LEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKGLHKAETY 200 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 201 LRVMKCRRFVESSCAF 216 >gb|ABH10665.1| Gene info growth hormone [Equus caballus] Length=216 Score = 368 bits (945), Expect = 2e-100 Identities = 180/196 (91%), Positives = 189/196 (96%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQ+ AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS Sbjct 21 PQDVGAFPAMPLSSLFTNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 80 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+DMELLRFSLLLIQSWLGPVQ LSR+FTNSL+FGTSDRVYEKL+D Sbjct 81 ETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQLLSRVFTNSLVFGTSDRVYEKLRD 140 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSC KKDLH AETY Sbjct 141 LEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCLKKDLHNAETY 200 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 201 LRVMKCRRFVESSCAF 216 >gb|ABH10664.1| Gene info growth hormone [Equus caballus] Length=216 Score = 368 bits (944), Expect = 3e-100 Identities = 180/196 (91%), Positives = 189/196 (96%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQ+ AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYS QNAQAAFCFS Sbjct 21 PQDVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSTQNAQAAFCFS 80 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+DMELLRFSLLLIQSW GPVQ LSR+FTNSL+FGTSDRVYEKL+D Sbjct 81 ETIPAPTGKDEAQQRSDMELLRFSLLLIQSWPGPVQLLSRVFTNSLVFGTSDRVYEKLRD 140 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETY Sbjct 141 LEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETY 200 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 201 LRVMKCRRFVESSCAF 216 >sp|P20392|SOMA_LOXAF Somatotropin (Growth hormone) prf||1509285A somatotropin Length=190 Score = 367 bits (943), Expect = 4e-100 Identities = 180/190 (94%), Positives = 188/190 (98%), Gaps = 0/190 (0%) Frame = +2 Query 140 FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP 319 FPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP Sbjct 1 FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP 60 Query 320 TGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQ 499 TGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKDLEEGIQ Sbjct 61 TGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQ 120 Query 500 ALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC 679 ALM+ELEDGSPR GQ+LKQTYDKFD NMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC Sbjct 121 ALMRELEDGSPRPGQVLKQTYDKFDTNMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC 180 Query 680 RRFVESSCAF 709 RRFVESSCAF Sbjct 181 RRFVESSCAF 190 >pir||STHO somatotropin - horse Length=190 Score = 365 bits (938), Expect = 1e-99 Identities = 179/190 (94%), Positives = 187/190 (98%), Gaps = 0/190 (0%) Frame = +2 Query 140 FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP 319 FPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP Sbjct 1 FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP 60 Query 320 TGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQ 499 TGK+EAQQR+DMELLRFSLLLIQSWLGPVQ LSR+FTNSL+FGTSDRVYEKL+DLEEGIQ Sbjct 61 TGKDEAQQRSDMELLRFSLLLIQSWLGPVQLLSRVFTNSLVFGTSDRVYEKLRDLEEGIQ 120 Query 500 ALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC 679 ALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETYLRVMKC Sbjct 121 ALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC 180 Query 680 RRFVESSCAF 709 RRFVESSCAF Sbjct 181 RRFVESSCAF 190 >sp|P10766|SOMA_VULVU Somatotropin (Growth hormone) pir||JS0429 somatotropin - Arctic fox Length=190 Score = 365 bits (937), Expect = 2e-99 Identities = 178/190 (93%), Positives = 188/190 (98%), Gaps = 0/190 (0%) Frame = +2 Query 140 FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP 319 FPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP Sbjct 1 FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP 60 Query 320 TGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQ 499 TGK+EAQQR+D+ELLRFSL+LIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDLEEGIQ Sbjct 61 TGKDEAQQRSDVELLRFSLVLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQ 120 Query 500 ALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC 679 ALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETYLRVMKC Sbjct 121 ALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC 180 Query 680 RRFVESSCAF 709 RRFVESSCAF Sbjct 181 RRFVESSCAF 190 >sp|P37885|SOMA_LAMPA Somatotropin (Growth hormone) gb|ABO20977.1| growth hormone precursor [Camelus dromedarius] Length=190 Score = 365 bits (936), Expect = 3e-99 Identities = 178/190 (93%), Positives = 187/190 (98%), Gaps = 0/190 (0%) Frame = +2 Query 140 FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP 319 FPAMPLSSLF+NAVLRAQHLHQLAADTYKEFER YIPEGQRYSIQNAQAAFCFSETIPAP Sbjct 1 FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERTYIPEGQRYSIQNAQAAFCFSETIPAP 60 Query 320 TGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQ 499 TGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKDLEEGIQ Sbjct 61 TGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQ 120 Query 500 ALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC 679 ALM+ELEDGSPR GQIL+QTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETYLRVMKC Sbjct 121 ALMRELEDGSPRAGQILRQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC 180 Query 680 RRFVESSCAF 709 RRFVESSCAF Sbjct 181 RRFVESSCAF 190 >prf||1104245A somatotropin Length=190 Score = 364 bits (935), Expect = 3e-99 Identities = 179/190 (94%), Positives = 186/190 (97%), Gaps = 0/190 (0%) Frame = +2 Query 140 FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP 319 FPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP Sbjct 1 FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP 60 Query 320 TGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQ 499 TGK EAQQR+D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDLEEGIQ Sbjct 61 TGKNEAQQRSDVELLRLSLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQ 120 Query 500 ALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC 679 ALM+ELEDGSPR GQILKQTYDKFD NMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC Sbjct 121 ALMRELEDGSPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC 180 Query 680 RRFVESSCAF 709 RRFVESSCAF Sbjct 181 RRFVESSCAF 190 >ref|NP_999034.1| UniGene infoGene info growth hormone [Sus scrofa] gb|AAA73477.1| UniGene infoGene info growth hormone Length=217 Score = 362 bits (930), Expect = 1e-98 Identities = 178/195 (91%), Positives = 187/195 (95%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 QE A AMPLSSLF+NAVLRAQHLHQLAADTYKEF+R YIPEGQRYSIQNAQAAFCFSE Sbjct 23 QEVGALGAMPLSSLFANAVLRAQHLHQLAADTYKEFDRPYIPEGQRYSIQNAQAAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETYL Sbjct 143 EEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYL 202 Query 665 RVMKCRRFVESSCAF 709 R MKCRRFVESSCAF Sbjct 203 RAMKCRRFVESSCAF 217 >gb|AAA73478.1| UniGene info growth hormone Length=217 Score = 360 bits (923), Expect = 8e-98 Identities = 178/195 (91%), Positives = 188/195 (96%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 +E AFPAMPLSSLF+NAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAF FSE Sbjct 23 REVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFFFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK+EAQQR+D+ELLRFSLLLIQSWLGPV FLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVTFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGIQALM+ELEDGSPR GQILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETYL Sbjct 143 EEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYL 202 Query 665 RVMKCRRFVESSCAF 709 R+MK RRFVESSCAF Sbjct 203 RLMKSRRFVESSCAF 217 >gb|AAA30964.1| growth hormone Length=187 Score = 359 bits (921), Expect = 1e-97 Identities = 176/187 (94%), Positives = 184/187 (98%), Gaps = 0/187 (0%) Frame = +2 Query 149 MPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGK 328 MPLSSLF+NAVLRAQHLHQLAADTYK+FERAYIPEGQRYSIQNAQAAFCFSETIPAPTGK Sbjct 1 MPLSSLFANAVLRAQHLHQLAADTYKDFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGK 60 Query 329 EEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALM 508 +EAQQR+DMELLRFSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKDLEEGIQALM Sbjct 61 DEAQQRSDMELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALM 120 Query 509 QELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRF 688 +ELEDGSPR G ILKQTYDKFD N+RSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRF Sbjct 121 RELEDGSPRAGPILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRF 180 Query 689 VESSCAF 709 VESSCAF Sbjct 181 VESSCAF 187 >sp|Q9JKM4|SOMA_CAVPO Somatotropin precursor (Growth hormone) gb|AAF36409.1|AF233853_1 growth hormone precursor [Cavia porcellus] Length=216 Score = 355 bits (910), Expect = 3e-96 Identities = 172/196 (87%), Positives = 183/196 (93%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 P+E FPAMPLSSLF NAVLRAQHLHQLAADTYKEFER YIPEGQRYSI N Q AFCFS Sbjct 21 PKEVRGFPAMPLSSLFGNAVLRAQHLHQLAADTYKEFERTYIPEGQRYSIHNTQTAFCFS 80 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPT KEEAQQR+D+ELL FSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKD Sbjct 81 ETIPAPTDKEEAQQRSDVELLHFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKD 140 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALM+ELEDG+PR GQILKQTYDKFD N+RS+DALLKNYGLLSCF+KDLH+ ETY Sbjct 141 LEEGIQALMRELEDGTPRAGQILKQTYDKFDTNLRSNDALLKNYGLLSCFRKDLHRTETY 200 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 201 LRVMKCRRFVESSCAF 216 >sp|O62754|SOMA_TRIVU Somatotropin precursor (Growth hormone) gb|AAC08986.1| UniGene info growth hormone precursor [Trichosurus vulpecula] Length=215 Score = 348 bits (894), Expect = 2e-94 Identities = 170/196 (86%), Positives = 183/196 (93%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQ + AFPAMPLSSLF+NAVLRAQHLHQL ADTYKEFER YIPE QR+SIQ+ Q AFCFS Sbjct 20 PQRSGAFPAMPLSSLFANAVLRAQHLHQLVADTYKEFERTYIPEAQRHSIQSTQTAFCFS 79 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+D+ELLRFSLLLIQSWL PVQFLSR+FTNSL+FGTSDRVYEKL+D Sbjct 80 ETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLSPVQFLSRVFTNSLVFGTSDRVYEKLRD 139 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALMQELEDGS R G +LK TYDKFD N+RSD+ALLKNYGLLSCFKKDLHKAETY Sbjct 140 LEEGIQALMQELEDGSSRGGLVLKTTYDKFDTNLRSDEALLKNYGLLSCFKKDLHKAETY 199 Query 662 LRVMKCRRFVESSCAF 709 LRVMKCRRFVESSCAF Sbjct 200 LRVMKCRRFVESSCAF 215 >ref|NP_001028165.1| UniGene infoGene info growth hormone [Monodelphis domestica] sp|Q9GL60|SOMA_MONDO Gene info Somatotropin precursor (Growth hormone) gb|AAG27732.1|AF312023_1 UniGene infoGene info somatotropin precursor [Monodelphis domestica] Length=215 Score = 348 bits (894), Expect = 2e-94 Identities = 170/196 (86%), Positives = 184/196 (93%), Gaps = 0/196 (0%) Frame = +2 Query 122 PQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFS 301 PQ A+AFPAMPLSSLF+NAVLRAQHLHQL ADTYKEFER YIPE QR+SIQ+ Q AFCFS Sbjct 20 PQRAAAFPAMPLSSLFANAVLRAQHLHQLVADTYKEFERTYIPEAQRHSIQSTQTAFCFS 79 Query 302 ETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKD 481 ETIPAPTGK+EAQQR+D+ELLRFSLLLIQSWL PVQFLSR+FTNSL+FGTSDRVYEKL+D Sbjct 80 ETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLSPVQFLSRVFTNSLVFGTSDRVYEKLRD 139 Query 482 LEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETY 661 LEEGIQALMQELEDGS R G +LK TYDKFD N+RSD+ALLKNYGLLSCFKKDLHKAETY Sbjct 140 LEEGIQALMQELEDGSSRGGLVLKTTYDKFDTNLRSDEALLKNYGLLSCFKKDLHKAETY 199 Query 662 LRVMKCRRFVESSCAF 709 LRVM+CRRFVESSCAF Sbjct 200 LRVMECRRFVESSCAF 215 >emb|CAJ18232.1| growth hormone, variant B [Cervus elaphus] Length=217 Score = 348 bits (892), Expect = 3e-94 Identities = 169/195 (86%), Positives = 181/195 (92%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 QE AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QEVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >sp|P56437|SOMA_CEREL Somatotropin precursor (Growth hormone) emb|CAA73158.1| growth hormone, variant A precursor [Cervus elaphus] Length=217 Score = 348 bits (892), Expect = 3e-94 Identities = 169/195 (86%), Positives = 181/195 (92%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 QE AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QEVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABC18163.1| growth hormone precursor [Bubalus bubalis] Length=217 Score = 347 bits (889), Expect = 7e-94 Identities = 169/195 (86%), Positives = 181/195 (92%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LSSLF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSSLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|AAF67172.1|AF238493_1 growth hormone [Cavia porcellus] Length=190 Score = 346 bits (888), Expect = 9e-94 Identities = 168/190 (88%), Positives = 178/190 (93%), Gaps = 0/190 (0%) Frame = +2 Query 140 FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP 319 FPAMP SS F NAVLRAQHLHQLAADTYKEFER YIPEGQRYSI N Q AFCFSETIPAP Sbjct 1 FPAMPXSSXFGNAVLRAQHLHQLAADTYKEFERTYIPEGQRYSIHNTQTAFCFSETIPAP 60 Query 320 TGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQ 499 T KEEAQQR+D+ELL FSLLLIQSWLGPVQFLSR+FTNSL+FGTSDRVYEKLKDLEEGIQ Sbjct 61 TDKEEAQQRSDVELLHFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQ 120 Query 500 ALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC 679 ALM+ELEDG+PR GQILKQTYDKFD N+RS+DALLKNYGLLSCF+KDLH+ ETYLRVMKC Sbjct 121 ALMRELEDGTPRAGQILKQTYDKFDTNLRSNDALLKNYGLLSCFRKDLHRTETYLRVMKC 180 Query 680 RRFVESSCAF 709 RRFVESSCAF Sbjct 181 RRFVESSCAF 190 >gb|ABO21735.1| Gene info growth hormone precursor [Ovis aries] Length=191 Score = 345 bits (886), Expect = 2e-93 Identities = 168/191 (87%), Positives = 180/191 (94%), Gaps = 0/191 (0%) Frame = +2 Query 137 AFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPA 316 AFPAM LSSLF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSETIPA Sbjct 1 AFPAMSLSSLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPA 60 Query 317 PTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGI 496 PTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDLEEGI Sbjct 61 PTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGI 120 Query 497 QALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMK 676 ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYLRVMK Sbjct 121 LALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMK 180 Query 677 CRRFVESSCAF 709 CRRF E+SCAF Sbjct 181 CRRFGEASCAF 191 >gb|AAF03130.1| growth hormone [Capra hircus] Length=192 Score = 345 bits (886), Expect = 2e-93 Identities = 168/191 (87%), Positives = 180/191 (94%), Gaps = 0/191 (0%) Frame = +2 Query 137 AFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPA 316 AFPAM LSSLF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSETIPA Sbjct 2 AFPAMSLSSLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPA 61 Query 317 PTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGI 496 PTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDLEEGI Sbjct 62 PTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGI 121 Query 497 QALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMK 676 ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYLRVMK Sbjct 122 LALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMK 181 Query 677 CRRFVESSCAF 709 CRRF E+SCAF Sbjct 182 CRRFGEASCAF 192 >gb|ABC18166.1| UniGene infoGene info growth hormone precursor [Bos taurus] Length=217 Score = 345 bits (885), Expect = 2e-93 Identities = 168/195 (86%), Positives = 180/195 (92%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >ref|NP_851339.1| UniGene infoGene info growth hormone [Bos taurus] sp|P01246|SOMA_BOVIN Gene info Somatotropin precursor (Growth hormone) emb|CAA23445.1| UniGene infoGene info unnamed protein product [Bos taurus] gb|AAA30542.1| Gene info presomatotropin gb|AAA30543.1| UniGene infoGene info growth hormone precursor gb|AAA30544.1| Gene info growth hormone gb|AAA30556.1| UniGene infoGene info adrenocorticotropic gb|AAB92549.1| growth hormone [Bos indicus] gb|ABA26924.1| UniGene infoGene info growth hormone precursor [Bos taurus] gb|ABL89194.1| growth hormone [Bos grunniens] gb|ABO21739.1| Gene info growth hormone precursor [Bos taurus] gb|ABO21740.1| Gene info growth hormone precursor [Bos taurus] Length=217 Score = 345 bits (885), Expect = 2e-93 Identities = 168/195 (86%), Positives = 180/195 (92%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >emb|CAC29336.1| growth hormone-1 protein [Tragulus javanicus] Length=217 Score = 344 bits (882), Expect = 5e-93 Identities = 167/195 (85%), Positives = 179/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 +E AFPAM LS LF+NAVLR QHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 REVGAFPAMSLSGLFANAVLRVQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELEDG PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDGPPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|AAX31661.1| somatotropin [Bubalus bubalis] Length=191 Score = 344 bits (882), Expect = 5e-93 Identities = 167/191 (87%), Positives = 180/191 (94%), Gaps = 0/191 (0%) Frame = +2 Query 137 AFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPA 316 AFPAM LSSLF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSETIPA Sbjct 1 AFPAMSLSSLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPA 60 Query 317 PTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGI 496 PTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDLEEGI Sbjct 61 PTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGI 120 Query 497 QALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMK 676 ALM+ELEDG+PR GQILK+TYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYLRVMK Sbjct 121 LALMRELEDGTPRAGQILKRTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMK 180 Query 677 CRRFVESSCAF 709 CRRF E+SCAF Sbjct 181 CRRFGEASCAF 191 >gb|AAF03131.1| growth hormone [Bubalus bubalis] gb|AAF03132.1| growth hormone [Bos indicus] Length=192 Score = 344 bits (882), Expect = 5e-93 Identities = 167/191 (87%), Positives = 179/191 (93%), Gaps = 0/191 (0%) Frame = +2 Query 137 AFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPA 316 AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSETIPA Sbjct 2 AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPA 61 Query 317 PTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGI 496 PTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDLEEGI Sbjct 62 PTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGI 121 Query 497 QALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMK 676 ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYLRVMK Sbjct 122 LALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMK 181 Query 677 CRRFVESSCAF 709 CRRF E+SCAF Sbjct 182 CRRFGEASCAF 192 >gb|ABC18164.1| growth hormone precursor [Capra hircus] Length=217 Score = 343 bits (881), Expect = 6e-93 Identities = 167/195 (85%), Positives = 179/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFL R+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLGRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >sp|Q7YQD2|SOMA_GIRCA Somatotropin precursor (Growth hormone) emb|CAE01392.1| growth hormone [Giraffa camelopardalis] emb|CAE01393.1| growth hormone [Giraffa camelopardalis] Length=217 Score = 343 bits (881), Expect = 6e-93 Identities = 167/195 (85%), Positives = 180/195 (92%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QMVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+F+NSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFSNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >sp|O18938|SOMA_BUBBU Somatotropin precursor (Growth hormone) emb|CAA09679.1| growth hormone [Bubalus bubalis] Length=217 Score = 343 bits (881), Expect = 6e-93 Identities = 168/195 (86%), Positives = 180/195 (92%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LSSLF+NAVL AQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSSLFANAVLWAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >emb|CAC29337.1| growth hormone-2 protein [Tragulus javanicus] Length=217 Score = 343 bits (879), Expect = 1e-92 Identities = 166/195 (85%), Positives = 179/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 +E AFPAM LS LF+NAVLR QHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 REVGAFPAMSLSGLFANAVLRVQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELEDG PR GQILKQTYDKFD NMR+DDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDGPPRAGQILKQTYDKFDTNMRNDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABC18167.1| UniGene infoGene info growth hormone precursor [Bos taurus] Length=217 Score = 343 bits (879), Expect = 1e-92 Identities = 167/194 (86%), Positives = 179/194 (92%), Gaps = 0/194 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCA 706 RVMKCRRF E+SCA Sbjct 203 RVMKCRRFGEASCA 216 >gb|ABO64651.1| Gene info growth hormone [Bos taurus] Length=190 Score = 342 bits (878), Expect = 1e-92 Identities = 166/190 (87%), Positives = 178/190 (93%), Gaps = 0/190 (0%) Frame = +2 Query 140 FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP 319 FPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSETIPAP Sbjct 1 FPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAP 60 Query 320 TGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQ 499 TGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDLEEGI Sbjct 61 TGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIL 120 Query 500 ALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC 679 ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYLRVMKC Sbjct 121 ALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKC 180 Query 680 RRFVESSCAF 709 RRF E+SCAF Sbjct 181 RRFGEASCAF 190 >gb|AAX07134.1| UniGene infoGene info growth hormone 1 [Bos taurus] Length=191 Score = 342 bits (878), Expect = 1e-92 Identities = 166/191 (86%), Positives = 178/191 (93%), Gaps = 0/191 (0%) Frame = +2 Query 137 AFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPA 316 AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSETIPA Sbjct 1 AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPA 60 Query 317 PTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGI 496 PTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDLEEGI Sbjct 61 PTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGI 120 Query 497 QALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMK 676 ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGL SCF+KDLHK ETYLRVMK Sbjct 121 LALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLFSCFRKDLHKTETYLRVMK 180 Query 677 CRRFVESSCAF 709 CRRF E+SCAF Sbjct 181 CRRFGEASCAF 191 >sp|Q864S7|SOMA_BOSMU Somatotropin precursor (Growth hormone) gb|AAP06256.1| growth hormone [Bos grunniens] Length=217 Score = 342 bits (878), Expect = 1e-92 Identities = 167/195 (85%), Positives = 179/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIP GQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPGGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13538.1| growth hormone [Ovis aries] Length=217 Score = 342 bits (876), Expect = 2e-92 Identities = 167/195 (85%), Positives = 179/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 QE AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QEVGAFPAMSLSCLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPT K EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTSKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >sp|P33092|SOMA_BALBO Somatotropin (Growth hormone) prf||0812180A somatotropin Length=190 Score = 342 bits (876), Expect = 2e-92 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%) Frame = +2 Query 140 FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAP 319 FPAMPLSSLF+NAVLRAQHLH+LAADTYKEFERAYIPEGQRY +QNAQ+ CFSE IP P Sbjct 1 FPAMPLSSLFANAVLRAQHLHELAADTYKEFERAYIPEGQRYFLQNAQSTGCFSEVIPTP 60 Query 320 TGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQ 499 K+EAQQR+D+ELLRFSLLLIQSWLGPVQFL + + N L+FGTSDRVYEKLKDLEEGIQ Sbjct 61 ANKDEAQQRSDVELLRFSLLLIQSWLGPVQFLEKAYANELVFGTSDRVYEKLKDLEEGIQ 120 Query 500 ALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC 679 ALM+ELEDGSPR GQILKQTYDKFD NMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC Sbjct 121 ALMRELEDGSPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKC 180 Query 680 RRFVESSCAF 709 RRFVESSCAF Sbjct 181 RRFVESSCAF 190 >sp|P67930|SOMA_SHEEP Somatotropin precursor (Growth hormone) sp|P67931|SOMA_CAPHI Somatotropin precursor (Growth hormone) emb|CAA30083.1| unnamed protein product [Capra hircus] emb|CAA68736.1| unnamed protein product [Capra hircus] emb|CAA31063.1| Gene info growth hormone [Ovis aries] dbj|BAA00368.1| growth hormone [Capra hircus] emb|CAA51450.1| growth hormone [Bubalus bubalis] emb|CAA34098.1| UniGene infoGene info growth hormone precursor [Ovis aries] gb|AAB63272.1| Gene info growth hormone [Ovis aries] gb|AAB63273.1| Gene info growth hormone [Ovis aries] gb|ABE03000.1| growth hormone precursor [Ovis aries] gb|ABE03001.1| growth hormone precursor [Ovis aries] gb|ABF13540.1| growth hormone [Ovis aries] gb|ABF13541.1| growth hormone [Ovis aries] gb|ABF13543.1| growth hormone [Ovis aries] gb|ABF13544.1| growth hormone [Ovis aries] gb|ABF13545.1| growth hormone [Ovis aries] gb|ABF13547.1| growth hormone [Ovis aries] gb|ABF13548.1| growth hormone [Ovis aries] gb|ABF13549.1| growth hormone [Ovis aries] gb|ABF13551.1| growth hormone [Ovis aries] gb|ABF13554.1| growth hormone [Ovis aries] gb|ABF13555.1| growth hormone [Ovis aries] gb|ABF13557.1| growth hormone [Ovis aries] gb|ABF13558.1| growth hormone [Ovis aries] gb|ABF13559.1| growth hormone [Ovis aries] gb|ABF13560.1| growth hormone [Ovis aries] gb|ABF13561.1| growth hormone [Ovis aries] gb|ABF13563.1| growth hormone [Ovis aries] gb|ABF13565.1| growth hormone [Ovis aries] gb|ABF13567.1| growth hormone [Ovis aries] gb|ABF13569.1| growth hormone [Ovis aries] gb|ABF13571.1| growth hormone [Ovis aries] gb|ABF13573.1| growth hormone [Ovis aries] gb|ABF13574.1| growth hormone [Ovis aries] gb|ABF13575.1| growth hormone [Ovis aries] gb|ABF13577.1| growth hormone [Ovis aries] gb|ABF81831.1| growth hormone [Capra hircus] gb|ABF13552.3| growth hormone [Ovis aries] gb|ABF13553.3| growth hormone [Ovis aries] gb|ABK64197.1| growth hormone precursor [Ovis aries] gb|ABO21738.1| Gene info growth hormone precursor [Bos taurus] prf||1005182A somatotropin,pre prf||1510157A somatotropin Length=217 Score = 342 bits (876), Expect = 2e-92 Identities = 167/195 (85%), Positives = 179/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13513.1| growth hormone [Ovis aries] gb|ABF13533.1| growth hormone [Ovis aries] Length=217 Score = 341 bits (875), Expect = 3e-92 Identities = 167/195 (85%), Positives = 179/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSRLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >sp|Q1HFN3|SOMA_BOSGF Somatotropin precursor (Growth hormone) gb|ABF50814.2| growth hormone [Bos frontalis] Length=217 Score = 341 bits (875), Expect = 3e-92 Identities = 166/195 (85%), Positives = 179/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRY+IQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYTIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLL QSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLNQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >ref|NP_001009315.2| UniGene infoGene info growth hormone [Ovis aries] gb|AAB24467.2| UniGene infoGene info growth hormone; GH [Ovis aries] Length=217 Score = 341 bits (875), Expect = 3e-92 Identities = 167/195 (85%), Positives = 179/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDRNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13546.1| growth hormone [Ovis aries] Length=217 Score = 341 bits (874), Expect = 4e-92 Identities = 167/195 (85%), Positives = 178/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ+ D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKPDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABC18165.1| UniGene infoGene info growth hormone precursor [Bos taurus] Length=217 Score = 341 bits (874), Expect = 4e-92 Identities = 166/195 (85%), Positives = 179/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SL LI+SWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLPLIRSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELEDG+PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABO21737.1| Gene info growth hormone precursor [Ovis aries] Length=191 Score = 340 bits (873), Expect = 5e-92 Identities = 166/191 (86%), Positives = 178/191 (93%), Gaps = 0/191 (0%) Frame = +2 Query 137 AFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPA 316 AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSETIPA Sbjct 1 AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPA 60 Query 317 PTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGI 496 PTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDLEEGI Sbjct 61 PTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGI 120 Query 497 QALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMK 676 ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYLRVMK Sbjct 121 LALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMK 180 Query 677 CRRFVESSCAF 709 CRRF E+SCAF Sbjct 181 CRRFGEASCAF 191 >gb|AAX35770.1| growth hormone [Capra hircus] Length=192 Score = 340 bits (873), Expect = 5e-92 Identities = 166/191 (86%), Positives = 178/191 (93%), Gaps = 0/191 (0%) Frame = +2 Query 137 AFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPA 316 AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSETIPA Sbjct 2 AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPA 61 Query 317 PTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGI 496 PTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDLEEGI Sbjct 62 PTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGI 121 Query 497 QALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMK 676 ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYLRVMK Sbjct 122 LALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMK 181 Query 677 CRRFVESSCAF 709 CRRF E+SCAF Sbjct 182 CRRFGEASCAF 192 >gb|ABF13564.1| growth hormone [Ovis aries] Length=217 Score = 340 bits (872), Expect = 7e-92 Identities = 166/195 (85%), Positives = 178/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+ CAF Sbjct 203 RVMKCRRFGEAGCAF 217 >gb|ABF13556.1| growth hormone [Ovis aries] Length=217 Score = 340 bits (872), Expect = 7e-92 Identities = 166/195 (85%), Positives = 179/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLH+ ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHETETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13524.1| growth hormone [Ovis aries] Length=217 Score = 340 bits (871), Expect = 9e-92 Identities = 166/195 (85%), Positives = 178/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q FPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGTFPAMSLSRLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13566.1| growth hormone [Ovis aries] Length=217 Score = 339 bits (870), Expect = 1e-91 Identities = 166/195 (85%), Positives = 178/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFC SE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCLSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13562.1| growth hormone [Ovis aries] Length=217 Score = 339 bits (870), Expect = 1e-91 Identities = 166/195 (85%), Positives = 178/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM L LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLFGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABO21741.1| growth hormone precursor [Capra hircus] Length=217 Score = 339 bits (869), Expect = 1e-91 Identities = 166/195 (85%), Positives = 178/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDA LKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDAPLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABK20344.1| UniGene infoGene info growth hormone [Ovis aries] Length=217 Score = 339 bits (869), Expect = 1e-91 Identities = 166/195 (85%), Positives = 178/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+EL D +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELGDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13511.1| growth hormone [Ovis aries] gb|ABF13514.1| growth hormone [Ovis aries] gb|ABF13515.1| growth hormone [Ovis aries] gb|ABF13516.1| growth hormone [Ovis aries] gb|ABF13518.1| growth hormone [Ovis aries] gb|ABF13519.1| growth hormone [Ovis aries] gb|ABF13526.1| growth hormone [Ovis aries] gb|ABF13529.1| growth hormone [Ovis aries] gb|ABF13535.1| growth hormone [Ovis aries] gb|ABF13536.1| growth hormone [Ovis aries] gb|ABF13539.1| growth hormone [Ovis aries] Length=217 Score = 339 bits (869), Expect = 1e-91 Identities = 166/195 (85%), Positives = 178/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSRLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPT K EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTSKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13512.1| growth hormone [Ovis aries] gb|ABF13521.1| growth hormone [Ovis aries] gb|ABF13523.1| growth hormone [Ovis aries] gb|ABF13520.1| growth hormone [Ovis aries] Length=217 Score = 339 bits (869), Expect = 1e-91 Identities = 166/195 (85%), Positives = 178/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSCLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPT K EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTSKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|AAC48679.1| UniGene infoGene info placental growth hormone [Ovis aries] Length=204 Score = 339 bits (869), Expect = 1e-91 Identities = 166/195 (85%), Positives = 178/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 10 QVVGAFPAMSLSRLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 69 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPT K EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 70 TIPAPTSKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 129 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 130 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 189 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 190 RVMKCRRFGEASCAF 204 >prf||1805146A somatotropin Length=217 Score = 339 bits (869), Expect = 1e-91 Identities = 166/195 (85%), Positives = 178/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSRLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPT K EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTSKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABO21736.1| Gene info growth hormone precursor [Ovis aries] Length=191 Score = 338 bits (868), Expect = 2e-91 Identities = 165/191 (86%), Positives = 178/191 (93%), Gaps = 0/191 (0%) Frame = +2 Query 137 AFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPA 316 AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSETIPA Sbjct 1 AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPA 60 Query 317 PTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGI 496 PTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDLEEGI Sbjct 61 PTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGI 120 Query 497 QALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMK 676 ALM+ELED +PR GQILKQT+DKFD NMRSDDALLKNYGLLSCF+KDLHK ETYLRVMK Sbjct 121 LALMRELEDVTPRAGQILKQTHDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMK 180 Query 677 CRRFVESSCAF 709 CRRF E+SCAF Sbjct 181 CRRFGEASCAF 191 >gb|ABF13570.1| growth hormone [Ovis aries] Length=217 Score = 338 bits (868), Expect = 2e-91 Identities = 166/195 (85%), Positives = 178/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDL K ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLRKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13525.1| growth hormone [Ovis aries] Length=217 Score = 338 bits (866), Expect = 3e-91 Identities = 165/195 (84%), Positives = 177/195 (90%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q FPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGTFPAMSLSRLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTG EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGNNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13534.1| growth hormone [Ovis aries] Length=217 Score = 337 bits (865), Expect = 4e-91 Identities = 165/195 (84%), Positives = 177/195 (90%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q FPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGTFPAMSLSRLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPT K EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTSKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13550.1| growth hormone [Ovis aries] Length=217 Score = 337 bits (864), Expect = 6e-91 Identities = 165/195 (84%), Positives = 178/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHL QLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLRQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKSEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF++DLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFREDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13517.1| growth hormone [Ovis aries] gb|ABF13530.1| growth hormone [Ovis aries] gb|ABF13532.1| growth hormone [Ovis aries] gb|ABF13537.1| growth hormone [Ovis aries] Length=217 Score = 337 bits (863), Expect = 7e-91 Identities = 165/195 (84%), Positives = 177/195 (90%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSRLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPT K EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTSKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNY LLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYSLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13572.1| growth hormone [Ovis aries] Length=217 Score = 337 bits (863), Expect = 7e-91 Identities = 165/195 (84%), Positives = 178/195 (91%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KE ER+YIPEGQRYSIQN Q A CFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKESERSYIPEGQRYSIQNTQVALCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13522.1| growth hormone [Ovis aries] Length=217 Score = 337 bits (863), Expect = 7e-91 Identities = 165/195 (84%), Positives = 177/195 (90%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSCLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPT K EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTSKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNY LLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYSLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|AAA31527.1| growth hormone precursor Length=217 Score = 337 bits (863), Expect = 7e-91 Identities = 165/195 (84%), Positives = 177/195 (90%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPT K EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSD VYEKLKDL Sbjct 83 TIPAPTSKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDLVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13542.1| growth hormone [Ovis aries] Length=217 Score = 336 bits (862), Expect = 1e-90 Identities = 165/195 (84%), Positives = 177/195 (90%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AF AM LS LF+NAVLRAQHLHQL ADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFLAMSLSGLFANAVLRAQHLHQLVADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13568.1| growth hormone [Ovis aries] Length=217 Score = 336 bits (861), Expect = 1e-90 Identities = 164/195 (84%), Positives = 177/195 (90%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER +IPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTHIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDR YEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRAYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNYGL SCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLRSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13531.1| growth hormone [Ovis aries] Length=217 Score = 335 bits (859), Expect = 2e-90 Identities = 164/195 (84%), Positives = 176/195 (90%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q FPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGTFPAMSLSRLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPT K EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTSKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNY LLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYSLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13528.1| growth hormone [Ovis aries] Length=217 Score = 333 bits (854), Expect = 8e-90 Identities = 163/195 (83%), Positives = 176/195 (90%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q A PAM LS LF+NAVLRAQH+HQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGALPAMSLSRLFANAVLRAQHVHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPT K EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTSKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNY LLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYSLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >dbj|BAE66634.1| UniGene infoGene info growth hormone [Ovis aries] Length=187 Score = 332 bits (852), Expect = 1e-89 Identities = 162/187 (86%), Positives = 174/187 (93%), Gaps = 0/187 (0%) Frame = +2 Query 149 MPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGK 328 M LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q AFCFSETIPAPTGK Sbjct 1 MSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGK 60 Query 329 EEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALM 508 EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDLEEGI ALM Sbjct 61 NEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALM 120 Query 509 QELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRF 688 +ELED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYLRVMKCRRF Sbjct 121 RELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRF 180 Query 689 VESSCAF 709 E+SCAF Sbjct 181 GEASCAF 187 >gb|ABF13527.1| growth hormone [Ovis aries] Length=217 Score = 332 bits (850), Expect = 2e-89 Identities = 163/195 (83%), Positives = 175/195 (89%), Gaps = 0/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q A PAM LS LF+NAVLRAQH HQLAADT+KEFER YIPEGQRYSIQN Q AFCFSE Sbjct 23 QVVGAXPAMSLSRLFANAVLRAQHXHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPT K EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTSKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ELED +PR GQILKQTYDKFD NMRSDDALLKNY LLSCF+KDLHK ETYL Sbjct 143 EEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYXLLSCFRKDLHKTETYL 202 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+SCAF Sbjct 203 RVMKCRRFGEASCAF 217 >gb|ABF13576.1| growth hormone [Ovis aries] Length=216 Score = 329 bits (843), Expect = 2e-88 Identities = 164/195 (84%), Positives = 176/195 (90%), Gaps = 1/195 (0%) Frame = +2 Query 125 QEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSE 304 Q AFPAM LS LF+NAVLRAQHLHQLAADT+KEFER YIPEGQRYSIQN Q A CFSE Sbjct 23 QVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVALCFSE 82 Query 305 TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDL 484 TIPAPTGK EAQQ++D+ELLR SLLLIQSWLGP+QFLSR+FTNSL+FGTSDRVYEKLKDL Sbjct 83 TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDL 142 Query 485 EEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYL 664 EEGI ALM+ LED +PR GQILKQTYDKFD NMRSDDALLKNYGLLSCF+KDLHK ETYL Sbjct 143 EEGILALMR-LEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYL 201 Query 665 RVMKCRRFVESSCAF 709 RVMKCRRF E+S AF Sbjct 202 RVMKCRRFGEASSAF 216
  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding 
environmental samples from WGS projects
    Posted date:  Jun 2, 2007  5:54 PM
  Number of letters in database: 1,728,490,168
  Number of sequences in database:  4,999,723
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4999723
Number of Hits to DB: 114800342
Number of extensions: 2292386
Number of successful extensions: 9152
Number of sequences better than 10: 2
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 9144
Number of HSP's successfully gapped: 2
Length of query: 935
Length of database: 1728490168
Length adjustment: 132
Effective length of query: 803
Effective length of database: 1068526732
Effective search space: 858026965796
Effective search space used: 191266285028
T: 12
A: 40
X1: 16 (7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 77 (34.3 bits)